4LR2A

Crystal structure of human enpp4 (apo)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
Knots found
sequence length
379
structure length
379
Chain Sequence
LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Bis(5'-adenosyl)-triphosphatase ENPP4
total genus 128
structure length 379
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.6.1.29: Bis(5'-adenosyl)-triphosphatase.
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.180 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4lr2A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4lr2A01
2X98A 2W8DA 1KH7A 5GOVA 1ZEBA 5DLTA 1ED9A 3MK2A 3TX0A 4CXUA 1E3CP 3MK0A 4ZG7A 1O99A 3NVLA 1K7HA 1ELXA 3CMRA 1E1ZP 1SHQA 1KH5A 1N2LA 2GSOA 5EGHA 1HJKA 3M8ZA 5TJ3A 5LIAA 1ALIA 5LRNA 4KAYA 3NKMA 1AJBA 2IUCA 4LR8A 4B56A 3A52A 1EW8A 3Q3QA 4UPIA 3WAWA 3BDHA 1Y7AA 3IDDA 5IJQA 1AJAA 1KHNA 2W5SA 1AJCA 1ELZA 4GTYA 1ALKA 4NWJA 4LR2A 4LRAA 4GTZA 5DLWA 3E2DA 4KJDA 4KM4A 4LREA 2W8SA 4UOOA 2XRGA 1B8JA 4NWXA 1KHKA 4FDIA 2QZUA 3IGZB 2XR9A 3TG0A 4CYRA 2ANHA 4LR9A 3BDGB 1ZEDA 2GA3A 3M8YA 4LRFA 4UPHA 5C66A 4UPLA 1ALHA 4LQYA 5K4PA 5INHA 4ZG9A 2W5VA 3SZZA 3UO0A 3DPCA 3WBHA 3UN2A 1ANJA 1AUKA 2GLQA 2W5WA 2W5XA 1KHLA 4LRBA 3NKRA 2IFYA 3NKOA 1N2KA 1E2SP 4MIVA 5KXAA 5L0EA 4LR7A 3WAVA 1O98A 4UORA 3MK1A 4UPKA 4QAXA 3KD8A 1ANIA 5AJ9A 4KJGA 5GRRA 5EGEA 2W5RA 1HQAA 5DLVA 4UOPA 3UN3A 5L0BA 5HRTA 3UN5A 4N7TA 1EJJA 3BDFA 1KHJA 3IGYB 1URAA 1SHNA 5LRMA 1ALJA 5IJSA 4LRCA 1ED8A 4MY4A 4CXKA 4YR1A 1EW2A 4KAVA 1KH4A 4ZGAA 3T00A 1P49A 3NKQA 1FSUA 4ZG6A 2IUCB 2GSNA 4LRDA 3TWZA 1EW9A 3WAYA 1HDHA 1AJDA 2D1GA 3BDGA 1ZEFA 3LXQA 3ED4A 1E33P 3NKPA 4TN0A 1KH9A 3NKNA 1EI6A 2VQRA 3B5QA 3SZYA 3UNYA 4CXSA 3DYCA 1URBA 2RH6A 5L0KA 2W5TA 2ZKTA 1ELYA 3OT9A 2G9YA 1EQJA 3WAXA 3T02A 2GSUA 2W5QA 4GTWA 3M7VA 3M8WA 1Y6VA 4MHXA 4CYSA 5LQQA 3T01A 4GTXA 4FDJA
chains in the Genus database with same CATH superfamily
2ZUEA 4X6AC 1ZEBA 5DLTA 1ED9A 4A3JC 4CXUA 3HOWC 3MK0A 3RZOK 4A3CC 1K7HA 3CMRA 4LK0A 1SHQA 1KH5A 5JVOA 1J6WA 1SFOK 3CQZA 3M8ZA 5TJ3A 4A3LK 1Y1WA 3GTJC 5LRNA 2NVQC 1AJBA 4LR8A 2R93A 1I50C 2P5MA 4UPIA 3WODA 3RZDC 1Y1WK 3GTOC 2VUMC 3H3VD 1KHNA 1J6VA 4ILDA 4BLAA 4A3KC 4GTYA 4M1XA 5HL8A 1O2AA 4KJDA 4P5AA 5TMFA 2JA6A 1XZPA 5FJ8K 2XRGA 3H0GK 3V4GA 2D6FC 4OIOA 4FDIA 3IGZB 5IORA 3BUEA 2JA5K 4KMUA 5CJ9A 3BP3A 4Y52C 2JA7A 1R9TC 3BDGB 1ZEDA 2JA8K 4GTEA 1BJTA 1ALHA 3GTPA 4MEYA 5K4PA 5INHA 4A93C 2PMZL 5IYBK 3GTPK 3GTMC 1ANJA 1WSVA 1AUKA 2W5WA 3RZOC 4A3CK 3S1RK 2A68A 3GTQA 3I4MC 3G4CA 1E2SP 1N2KA 5L0EA 5M3FK 3LAPA 1R9TK 1IW7A 4A3MK 3MK1A 3KD8A 3H3VL 2JA6C 5AJ9A 1XXBA 1HQAA 2O5JA 4G0UA 1DCHA 1TWAA 5L0BA 5CHPA 4KB4A 1I6HK 4GTBA 1L0WA 2ZUFA 2JA7C 4BBRK 4KAWX 4A3KK 3N0BA 2ZFZA 2NVXK 5M5WK 3S17C 1ED8A 1VLOA 1IS1A 4NOIA 1XXAA 2JH3A 4ZGAA 2XCQA 1P49A 3NKQA 4BY7C 1I50K 2IUCB 4GTLA 3HOYK 4LRDA 1GE9A 3S16K 2PA8D 5FLMK 1O2FB 4PAAA 1EW9A 1HDHA 1EH1A 1TWCK 1AJDA 2PMZD 2D1GA 5FLMC 1O26A 2A69A 1Y1VA 3ADAC 4KN4A 1BS2A 1JOEA 1WQHA 5IOSA 5IYCC 3NKPA 4P9SA 3TFHA 3M3YC 2R93C 1KH9A 3HOZC 2VQRA 3GTLC 2CW0A 2FQOA 1XXCA 2B63C 3GTKK 1I6HC 3OEPA 4O2DA 1EQJA 2GSUA 5LQQA 4MHXA 2Y3PA 4QJVB 5C3EC 4GTXA 5IP9K 4BXXK 1TWFC 4FDJA 2NVQK 1TWGC 4G7OA 2NVTK 3MK2A 2E2IC 3NVLA 1EFWA 4A3BK 2A6HA 2E2IK 5IOQA 3PO3K 5IP7C 4KMAA 1YNNA 4KAYA 3AD8C 4Y7NC 4B56A 4BXXC 5JFEA 1WCMC 3HOUC 3A52A 2YU9K 1AJAA 3DXJA 2Y0SD 2JA5C 4KASA 3GDZA 2YU9C 2YU9A 3S14C 2W5SA 1ELZA 3S1MC 4BY1K 4NWJA 1ZXOA 4UOOA 4LRAA 2EBBA 3GTGK 5DLWA 3AH5A 4KM9A 5IP7K 1TWCC 1WCMA 1I6VA 3TTGA 3S1RC 1XZQB 3NUHA 4NWXA 1KHKA 1USOA 2QZUA 3GEIA 4GT9A 4LR9A 3M8YA 2NVXA 1VGXA 1VJEA 1DD5A 5C3EK 2KWAA 4UPLA 1G51A 4KMHA 3M4OC 4P5BA 1I3QK 1J6XA 1X31C 3QX3A 3UO0A 4XSZA 3L4KA 1AB4A 1O25A 1XZPB 1F7UA 2W5XA 1KHLA 4A3EC 3NKRA 3NKOA 4MIVA 1WCMK 4OINA 3K7AK 4BBRC 4C45A 1O98A 4QAXA 1ANIA 3S14K 4QJVA 4KDDA 5DLVA 4YG2A 3FOFA 5D4DA 3GTPC 1DCPA 3VA7A 3UN5A 1ZVUA 3LPXA 1USMA 2E2HK 2NVTC 1EJJA 3BDFA 3S15K 5L46A 2PA8L 4QIWD 3I4NC 1URAA 1ALJA 4LRCA 4MY4A 4AH6A 3FKIA 1BGWA 4DDQA 4Y52K 1EW2A 4YR1A 3A8IA 1WQFA 4C3HC 3S1NK 3S15C 4Q5SA 2V6UA 4RMFA 1TWFK 4XLPA 4A3EK 1PJ5A 1TWFA 1ZEFA 3LXQA 2P8TA 3ED4A 3GTOA 1E33P 4TN0A 1F9NA 1F7VA 3GIRA 3MMLB 2B63K 3L4JA 3RZDK 5M5YK 4PABA 1JQWA 3GTOK 2V6SA 3S0XA 3AD9C 2A6EA 4C3HK 3S1NC 2W5QA 3M7VA 3M8WA 1Y6VA 3CAGA 4CYSA 1VRQC 1IE0A 2NVYA 5C4JK 3G4AA 4MQ9A 3GEEA 3HXAA 3GTGC 1Y1VC 3GTJK 2W8DA 1WOOA 3S1MK 3IPJA 3TX0A 4ZG7A 1O99A 3S1QK 1ELXA 2BE5A 2B63A 1WSRA 2Y0SL 1KQ4A 4MEXA 4KB2A 1ISEA 4XCHA 3HOUK 1N2LA 3TFIA 1YX2A 3TFJA 4Y7NK 3GTKC 1IBAA 1V5VA 2WB1L 1ALIA 1HJKA 3NKMA 2IUCA 2CFAA 3FOEA 3Q3QA 1SFOA 3I4MK 3WAWA 1Y7AA 5IJQA 5C4XC 2PHCB 2V6TA 1AJCA 5IYCK 3OREA 3S2HK 3I4NK 4KC6A 4LR2A 2PPBA 1UV7A 4KM4A 1SFOC 4WJ4A 2W8SA 4LREA 1WOSA 4GTDA 4QIWL 5M5XK 4LLGA 4KARA 5IYBC 2E2JC 3S2DK 3TG0A 3EQLA 2ANHA 3FHZA 1ZQ1C 2GA3A 4C3IC 5C66A 2JA7K 4ZG9A 4GTAA 1O2BA 3HOXC 4BBSC 3SZZA 2W5VA 3GTQK 3UN2A 3WBHA 4KATA 1J98A 4A3FK 2WB1D 3S1QC 1Y1WC 4LRBA 3N0CA 4A3DC 4Q4ZA 2JA6K 3WAVA 3HOZK 4UPKA 2FQTA 3GTMA 3M3YK 1IQ0A 1TWCA 5GRRA 2E2IA 5C4JC 1YCLA 1HQMA 3GTMK 4A3BC 3UN3A 1C0AA 1INNA 4N7TA 4A3JK 2NVXC 1B4BA 1F93A 3S16C 2VUMA 5IYDK 4BY1C 2GAHC 1SHNA 3S2HC 5IJSA 5IP9C 4GFQA 1HI9A 5C4XK 1I3QA 1XZQA 2WAQL 1FSUA 3HOXK 4BBSK 4KN7A 4A3GK 1SMYA 3TWZA 4FZBA 2R92C 1BDFA 1TWAK 4G0WA 2R7ZC 4XSXA 4J3NA 3H0GA 1EK8A 4A93K 5C44C 4A3MC 2VUMK 3B5QA 1TWGK 3GTKA 2E2HA 3DYCA 1URBA 2RH6A 4A3LC 5L0KA 1O29A 2E2HC 2ZKTA 3WAXA 4KM8A 4BY7K 3FKIC 4AYBD 3T02A 4FM9A 4GTWA 3T01A 3HOWK 4C3JC 3GTLK 3PO2K 4KMDA 2X98A 1KH7A 5GOVA 4BKWA 4C3JK 2WAQD 1K83C 1E3CP 4OIRA 5M3MK 1E1ZP 4ZH4A 4G7HA 2GSOA 1WIHA 1TWHK 1I3QC 1WQGA 5EGHA 4C2MC 5LIAA 1JVIA 5IYDC 3PO2C 3LAJA 1ZBSA 1TWHA 1EW8A 5IOTA 3HOVK 3BDHA 3IDDA 4GTFA 3BP8C 4LJZA 3HOVC 1B4AA 3HKZL 2RGRA 3S17K 1ALKA 1IL2A 3GEHA 1R9TA 2NVYK 4GTZA 3E2DA 1TWHC 4A3DK 4AYBL 3GTJA 2XCOA 4XLNA 1B8JA 1XPPA 4A3GC 3GTQC 3AD7C 2XR9A 4CYRA 4OIPA 4X6AK 3OPFA 4JK1A 4LRFA 3K7AC 1WORA 4UPHA 1TWGA 4LQYA 1O24A 5E68A 2R93K 1EQRA 3FKIK 3PO3C 3DPCA 4LOWA 1I50A 2GLQA 3AQPA 1RU0A 2IFYA 5KXAA 4LR7A 2JA8C 4G0VA 1Y1VK 4UORA 4LK1A 3HOYC 4YFNA 4KJGA 4YFKA 1VH2A 1ZYRA 5EGEA 2W5RA 3CQZK 4UOPA 2R92K 2R7ZA 5HRTA 2JA5A 1O28A 4BLBA 1KHJA 3IGYB 5LRMA 4CXKA 4A3FC 3JSTA 1WOPA 3ERED 3CQZC 1KH4A 4KAVA 3T00A 4ZG6A 2GSNA 2O5IA 3GSIA 4GTCA 3M4OK 3GTLA 4OIQA 3WAYA 3A8KA 1O27A 3BDGA 5C44K 4A3IK 2R7ZK 2R92A 1PJ7A 5TMCA 2E2JK 3S2DC 1PJ6A 1DCOA 1TWAC 3N3YA 4A3IC 3NKNA 1EI6A 3SZYA 4WJ3M 3UNYA 4YFXA 4CXSA 3HKZD 2XCRB 1YNJA 4C2MK 4G7ZA 4GZYA 2W5TA 1ELYA 3OT9A 2G9YA 2GAGC 3AQOA 1K83A 2W7VA 3A8JA 2CFAB 3H0GC 4C3IK 3GTGA 1K83K 4WILA 2NVYC
chains in the Genus database with same CATH topology
1ZEBA 5DLTA 1ED9A 4CXUA 3MK0A 1K7HA 3CMRA 1SHQA 1KH5A 5JVOA 3CQZA 3M8ZA 5TJ3A 1Y1WA 5LRNA 1AJBA 4LR8A 2R93A 2P5MA 4UPIA 1KHNA 4ILDA 4BLAA 4GTYA 4M1XA 1O2AA 4KJDA 4P5AA 2JA6A 2XRGA 3V4GA 4FDIA 3IGZB 5IORA 3BUEA 5CJ9A 2JA7A 3BDGB 1ZEDA 4GTEA 1BJTA 1ALHA 3GTPA 5K4PA 5INHA 1ANJA 1AUKA 2W5WA 5L0EA 3GTQA 1E2SP 3G4CA 1N2KA 3LAPA 3MK1A 3KD8A 5AJ9A 1XXBA 1HQAA 4G0UA 1TWAA 5L0BA 5CHPA 4KB4A 4GTBA 4KAWX 3N0BA 2ZFZA 1ED8A 1IS1A 1XXAA 2JH3A 4ZGAA 2XCQA 1P49A 3NKQA 2IUCB 4GTLA 4LRDA 1GE9A 1EW9A 1HDHA 1EH1A 1AJDA 2D1GA 1O26A 1Y1VA 1WQHA 5IOSA 3NKPA 1KH9A 2VQRA 1XXCA 3OEPA 1EQJA 2GSUA 5LQQA 4MHXA 2Y3PA 4GTXA 4FDJA 3MK2A 3NVLA 5IOQA 4KMAA 4KAYA 4B56A 5JFEA 3A52A 1AJAA 2W5SA 4KASA 2YU9A 1ELZA 4NWJA 1ZXOA 4UOOA 4LRAA 5DLWA 3AH5A 4KM9A 1WCMA 3NUHA 4NWXA 1KHKA 2QZUA 4GT9A 4LR9A 3M8YA 2NVXA 1DD5A 2KWAA 4UPLA 4KMHA 4P5BA 3QX3A 3UO0A 3L4KA 1AB4A 1O25A 2W5XA 1KHLA 3NKRA 3NKOA 4MIVA 1O98A 4QAXA 1ANIA 4KDDA 5DLVA 3FOFA 3VA7A 3UN5A 1ZVUA 3LPXA 1EJJA 3BDFA 1URAA 1ALJA 4LRCA 4MY4A 3FKIA 1BGWA 4DDQA 4YR1A 1EW2A 1WQFA 4C3HC 1TWFA 1ZEFA 3LXQA 3ED4A 3GTOA 1E33P 4TN0A 1F9NA 3MMLB 3L4JA 3S0XA 2W5QA 3M7VA 3M8WA 1Y6VA 3CAGA 4CYSA 2NVYA 3G4AA 2W8DA 3TX0A 4ZG7A 1O99A 1ELXA 2B63A 4KB2A 1ISEA 1N2LA 1HJKA 1ALIA 3NKMA 2IUCA 2CFAA 3FOEA 3Q3QA 1SFOA 3WAWA 1Y7AA 5IJQA 2PHCB 1AJCA 3OREA 4KC6A 4LR2A 4KM4A 4LREA 2W8SA 4GTDA 4KARA 3TG0A 2ANHA 3FHZA 2GA3A 4C3IC 5C66A 4ZG9A 4GTAA 1O2BA 2W5VA 3SZZA 3WBHA 3UN2A 4KATA 4LRBA 3N0CA 3WAVA 4UPKA 3GTMA 1TWCA 5GRRA 2E2IA 3UN3A 4N7TA 1B4BA 2VUMA 1SHNA 5IJSA 4GFQA 1I3QA 1FSUA 3TWZA 4FZBA 4G0WA 4J3NA 3H0GA 1EK8A 3B5QA 3GTKA 2E2HA 3DYCA 1URBA 2RH6A 5L0KA 1O29A 2ZKTA 3WAXA 4KM8A 4FM9A 3T02A 4GTWA 3T01A 4C3JC 2X98A 4KMDA 1KH7A 5GOVA 4BKWA 1E3CP 1E1ZP 2GSOA 1WIHA 5EGHA 1WQGA 4C2MC 5LIAA 3LAJA 1ZBSA 1TWHA 1EW8A 5IOTA 3BDHA 3IDDA 4GTFA 1B4AA 2RGRA 1ALKA 1R9TA 4GTZA 3E2DA 3GTJA 2XCOA 1B8JA 2XR9A 4CYRA 3OPFA 4LRFA 4UPHA 1TWGA 4LQYA 1O24A 3DPCA 1I50A 2GLQA 3AQPA 2IFYA 5KXAA 4LR7A 4G0VA 4UORA 4KJGA 5EGEA 2W5RA 4UOPA 2R7ZA 5HRTA 2JA5A 1O28A 4BLBA 1KHJA 3IGYB 5LRMA 4CXKA 3ERED 4KAVA 1KH4A 3T00A 4ZG6A 2GSNA 4GTCA 3GTLA 3WAYA 1O27A 3BDGA 2R92A 3N3YA 3NKNA 1EI6A 3SZYA 3UNYA 4CXSA 2XCRB 2W5TA 1ELYA 3OT9A 2G9YA 3AQOA 1K83A 2CFAB 3GTGA 1KQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X98 A;  2W8D A;  1KH7 A;  5GOV A;  1ZEB A;  5DLT A;  1ED9 A;  3MK2 A;  3TX0 A;  4CXU A;  1E3C P;  3MK0 A;  4ZG7 A;  1O99 A;  3NVL A;  1K7H A;  1ELX A;  3CMR A;  1E1Z P;  1SHQ A;  1KH5 A;  1N2L A;  2GSO A;  5EGH A;  1HJK A;  3M8Z A;  5TJ3 A;  5LIA A;  1ALI A;  5LRN A;  4KAY A;  3NKM A;  1AJB A;  2IUC A;  4LR8 A;  4B56 A;  3A52 A;  1EW8 A;  3Q3Q A;  4UPI A;  3WAW A;  3BDH A;  1Y7A A;  3IDD A;  5IJQ A;  1AJA A;  1KHN A;  2W5S A;  1AJC A;  1ELZ A;  4GTY A;  1ALK A;  4NWJ A;  4LR2 A;  4LRA A;  4GTZ A;  5DLW A;  3E2D A;  4KJD A;  4KM4 A;  4LRE A;  2W8S A;  4UOO A;  2XRG A;  1B8J A;  4NWX A;  1KHK A;  4FDI A;  2QZU A;  3IGZ B;  2XR9 A;  3TG0 A;  4CYR A;  2ANH A;  4LR9 A;  3BDG B;  1ZED A;  2GA3 A;  3M8Y A;  4LRF A;  4UPH A;  5C66 A;  4UPL A;  1ALH A;  4LQY A;  5K4P A;  5INH A;  4ZG9 A;  2W5V A;  3SZZ A;  3UO0 A;  3DPC A;  3WBH A;  3UN2 A;  1ANJ A;  1AUK A;  2GLQ A;  2W5W A;  2W5X A;  1KHL A;  4LRB A;  3NKR A;  2IFY A;  3NKO A;  1N2K A;  1E2S P;  4MIV A;  5KXA A;  5L0E A;  4LR7 A;  3WAV A;  1O98 A;  4UOR A;  3MK1 A;  4UPK A;  4QAX A;  3KD8 A;  1ANI A;  5AJ9 A;  4KJG A;  5GRR A;  5EGE A;  2W5R A;  1HQA A;  5DLV A;  4UOP A;  3UN3 A;  5L0B A;  5HRT A;  3UN5 A;  4N7T A;  1EJJ A;  3BDF A;  1KHJ A;  3IGY B;  1URA A;  1SHN A;  5LRM A;  1ALJ A;  5IJS A;  4LRC A;  1ED8 A;  4MY4 A;  4CXK A;  4YR1 A;  1EW2 A;  4KAV A;  1KH4 A;  4ZGA A;  3T00 A;  1P49 A;  3NKQ A;  1FSU A;  4ZG6 A;  2IUC B;  2GSN A;  4LRD A;  3TWZ A;  1EW9 A;  3WAY A;  1HDH A;  1AJD A;  2D1G A;  3BDG A;  1ZEF A;  3LXQ A;  3ED4 A;  1E33 P;  3NKP A;  4TN0 A;  1KH9 A;  3NKN A;  1EI6 A;  2VQR A;  3B5Q A;  3SZY A;  3UNY A;  4CXS A;  3DYC A;  1URB A;  2RH6 A;  5L0K A;  2W5T A;  2ZKT A;  1ELY A;  3OT9 A;  2G9Y A;  1EQJ A;  3WAX A;  3T02 A;  2GSU A;  2W5Q A;  4GTW A;  3M7V A;  3M8W A;  1Y6V A;  4MHX A;  4CYS A;  5LQQ A;  3T01 A;  4GTX A;  4FDJ A; 
#chains in the Genus database with same CATH topology
 2ZUE A;  4X6A C;  1ZEB A;  5DLT A;  1ED9 A;  4A3J C;  4CXU A;  3HOW C;  3MK0 A;  3RZO K;  4A3C C;  1K7H A;  3CMR A;  4LK0 A;  1SHQ A;  1KH5 A;  5JVO A;  1J6W A;  1SFO K;  3CQZ A;  3M8Z A;  5TJ3 A;  4A3L K;  1Y1W A;  3GTJ C;  5LRN A;  2NVQ C;  1AJB A;  4LR8 A;  2R93 A;  1I50 C;  2P5M A;  4UPI A;  3WOD A;  3RZD C;  1Y1W K;  3GTO C;  2VUM C;  3H3V D;  1KHN A;  1J6V A;  4ILD A;  4BLA A;  4A3K C;  4GTY A;  4M1X A;  5HL8 A;  1O2A A;  4KJD A;  4P5A A;  5TMF A;  2JA6 A;  1XZP A;  5FJ8 K;  2XRG A;  3H0G K;  3V4G A;  2D6F C;  4OIO A;  4FDI A;  3IGZ B;  5IOR A;  3BUE A;  2JA5 K;  4KMU A;  5CJ9 A;  3BP3 A;  4Y52 C;  2JA7 A;  1R9T C;  3BDG B;  1ZED A;  2JA8 K;  4GTE A;  1BJT A;  1ALH A;  3GTP A;  4MEY A;  5K4P A;  5INH A;  4A93 C;  2PMZ L;  5IYB K;  3GTP K;  3GTM C;  1ANJ A;  1WSV A;  1AUK A;  2W5W A;  3RZO C;  4A3C K;  3S1R K;  2A68 A;  3GTQ A;  3I4M C;  3G4C A;  1E2S P;  1N2K A;  5L0E A;  5M3F K;  3LAP A;  1R9T K;  1IW7 A;  4A3M K;  3MK1 A;  3KD8 A;  3H3V L;  2JA6 C;  5AJ9 A;  1XXB A;  1HQA A;  2O5J A;  4G0U A;  1DCH A;  1TWA A;  5L0B A;  5CHP A;  4KB4 A;  1I6H K;  4GTB A;  1L0W A;  2ZUF A;  2JA7 C;  4BBR K;  4KAW X;  4A3K K;  3N0B A;  2ZFZ A;  2NVX K;  5M5W K;  3S17 C;  1ED8 A;  1VLO A;  1IS1 A;  4NOI A;  1XXA A;  2JH3 A;  4ZGA A;  2XCQ A;  1P49 A;  3NKQ A;  4BY7 C;  1I50 K;  2IUC B;  4GTL A;  3HOY K;  4LRD A;  1GE9 A;  3S16 K;  2PA8 D;  5FLM K;  1O2F B;  4PAA A;  1EW9 A;  1HDH A;  1EH1 A;  1TWC K;  1AJD A;  2PMZ D;  2D1G A;  5FLM C;  1O26 A;  2A69 A;  1Y1V A;  3ADA C;  4KN4 A;  1BS2 A;  1JOE A;  1WQH A;  5IOS A;  5IYC C;  3NKP A;  4P9S A;  3TFH A;  3M3Y C;  2R93 C;  1KH9 A;  3HOZ C;  2VQR A;  3GTL C;  2CW0 A;  2FQO A;  1XXC A;  2B63 C;  3GTK K;  1I6H C;  3OEP A;  4O2D A;  1EQJ A;  2GSU A;  5LQQ A;  4MHX A;  2Y3P A;  4QJV B;  5C3E C;  4GTX A;  5IP9 K;  4BXX K;  1TWF C;  4FDJ A;  2NVQ K;  1TWG C;  4G7O A;  2NVT K;  3MK2 A;  2E2I C;  3NVL A;  1EFW A;  4A3B K;  2A6H A;  2E2I K;  5IOQ A;  3PO3 K;  5IP7 C;  4KMA A;  1YNN A;  4KAY A;  3AD8 C;  4Y7N C;  4B56 A;  4BXX C;  5JFE A;  1WCM C;  3HOU C;  3A52 A;  2YU9 K;  1AJA A;  3DXJ A;  2Y0S D;  2JA5 C;  4KAS A;  3GDZ A;  2YU9 C;  2YU9 A;  3S14 C;  2W5S A;  1ELZ A;  3S1M C;  4BY1 K;  4NWJ A;  1ZXO A;  4UOO A;  4LRA A;  2EBB A;  3GTG K;  5DLW A;  3AH5 A;  4KM9 A;  5IP7 K;  1TWC C;  1WCM A;  1I6V A;  3TTG A;  3S1R C;  1XZQ B;  3NUH A;  4NWX A;  1KHK A;  1USO A;  2QZU A;  3GEI A;  4GT9 A;  4LR9 A;  3M8Y A;  2NVX A;  1VGX A;  1VJE A;  1DD5 A;  5C3E K;  2KWA A;  4UPL A;  1G51 A;  4KMH A;  3M4O C;  4P5B A;  1I3Q K;  1J6X A;  1X31 C;  3QX3 A;  3UO0 A;  4XSZ A;  3L4K A;  1AB4 A;  1O25 A;  1XZP B;  1F7U A;  2W5X A;  1KHL A;  4A3E C;  3NKR A;  3NKO A;  4MIV A;  1WCM K;  4OIN A;  3K7A K;  4BBR C;  4C45 A;  1O98 A;  4QAX A;  1ANI A;  3S14 K;  4QJV A;  4KDD A;  5DLV A;  4YG2 A;  3FOF A;  5D4D A;  3GTP C;  1DCP A;  3VA7 A;  3UN5 A;  1ZVU A;  3LPX A;  1USM A;  2E2H K;  2NVT C;  1EJJ A;  3BDF A;  3S15 K;  5L46 A;  2PA8 L;  4QIW D;  3I4N C;  1URA A;  1ALJ A;  4LRC A;  4MY4 A;  4AH6 A;  3FKI A;  1BGW A;  4DDQ A;  4Y52 K;  1EW2 A;  4YR1 A;  3A8I A;  1WQF A;  4C3H C;  3S1N K;  3S15 C;  4Q5S A;  2V6U A;  4RMF A;  1TWF K;  4XLP A;  4A3E K;  1PJ5 A;  1TWF A;  1ZEF A;  3LXQ A;  2P8T A;  3ED4 A;  3GTO A;  1E33 P;  4TN0 A;  1F9N A;  1F7V A;  3GIR A;  3MML B;  2B63 K;  3L4J A;  3RZD K;  5M5Y K;  4PAB A;  1JQW A;  3GTO K;  2V6S A;  3S0X A;  3AD9 C;  2A6E A;  4C3H K;  3S1N C;  2W5Q A;  3M7V A;  3M8W A;  1Y6V A;  3CAG A;  4CYS A;  1VRQ C;  1IE0 A;  2NVY A;  5C4J K;  3G4A A;  4MQ9 A;  3GEE A;  3HXA A;  3GTG C;  1Y1V C;  3GTJ K;  2W8D A;  1WOO A;  3S1M K;  3IPJ A;  3TX0 A;  4ZG7 A;  1O99 A;  3S1Q K;  1ELX A;  2BE5 A;  2B63 A;  1WSR A;  2Y0S L;  1KQ4 A;  4MEX A;  4KB2 A;  1ISE A;  4XCH A;  3HOU K;  1N2L A;  3TFI A;  1YX2 A;  3TFJ A;  4Y7N K;  3GTK C;  1IBA A;  1V5V A;  2WB1 L;  1ALI A;  1HJK A;  3NKM A;  2IUC A;  2CFA A;  3FOE A;  3Q3Q A;  1SFO A;  3I4M K;  3WAW A;  1Y7A A;  5IJQ A;  5C4X C;  2PHC B;  2V6T A;  1AJC A;  5IYC K;  3ORE A;  3S2H K;  3I4N K;  4KC6 A;  4LR2 A;  2PPB A;  1UV7 A;  4KM4 A;  1SFO C;  4WJ4 A;  2W8S A;  4LRE A;  1WOS A;  4GTD A;  4QIW L;  5M5X K;  4LLG A;  4KAR A;  5IYB C;  2E2J C;  3S2D K;  3TG0 A;  3EQL A;  2ANH A;  3FHZ A;  1ZQ1 C;  2GA3 A;  4C3I C;  5C66 A;  2JA7 K;  4ZG9 A;  4GTA A;  1O2B A;  3HOX C;  4BBS C;  3SZZ A;  2W5V A;  3GTQ K;  3UN2 A;  3WBH A;  4KAT A;  1J98 A;  4A3F K;  2WB1 D;  3S1Q C;  1Y1W C;  4LRB A;  3N0C A;  4A3D C;  4Q4Z A;  2JA6 K;  3WAV A;  3HOZ K;  4UPK A;  2FQT A;  3GTM A;  3M3Y K;  1IQ0 A;  1TWC A;  5GRR A;  2E2I A;  5C4J C;  1YCL A;  1HQM A;  3GTM K;  4A3B C;  3UN3 A;  1C0A A;  1INN A;  4N7T A;  4A3J K;  2NVX C;  1B4B A;  1F93 A;  3S16 C;  2VUM A;  5IYD K;  4BY1 C;  2GAH C;  1SHN A;  3S2H C;  5IJS A;  5IP9 C;  4GFQ A;  1HI9 A;  5C4X K;  1I3Q A;  1XZQ A;  2WAQ L;  1FSU A;  3HOX K;  4BBS K;  4KN7 A;  4A3G K;  1SMY A;  3TWZ A;  4FZB A;  2R92 C;  1BDF A;  1TWA K;  4G0W A;  2R7Z C;  4XSX A;  4J3N A;  3H0G A;  1EK8 A;  4A93 K;  5C44 C;  4A3M C;  2VUM K;  3B5Q A;  1TWG K;  3GTK A;  2E2H A;  3DYC A;  1URB A;  2RH6 A;  4A3L C;  5L0K A;  1O29 A;  2E2H C;  2ZKT A;  3WAX A;  4KM8 A;  4BY7 K;  3FKI C;  4AYB D;  3T02 A;  4FM9 A;  4GTW A;  3T01 A;  3HOW K;  4C3J C;  3GTL K;  3PO2 K;  4KMD A;  2X98 A;  1KH7 A;  5GOV A;  4BKW A;  4C3J K;  2WAQ D;  1K83 C;  1E3C P;  4OIR A;  5M3M K;  1E1Z P;  4ZH4 A;  4G7H A;  2GSO A;  1WIH A;  1TWH K;  1I3Q C;  1WQG A;  5EGH A;  4C2M C;  5LIA A;  1JVI A;  5IYD C;  3PO2 C;  3LAJ A;  1ZBS A;  1TWH A;  1EW8 A;  5IOT A;  3HOV K;  3BDH A;  3IDD A;  4GTF A;  3BP8 C;  4LJZ A;  3HOV C;  1B4A A;  3HKZ L;  2RGR A;  3S17 K;  1ALK A;  1IL2 A;  3GEH A;  1R9T A;  2NVY K;  4GTZ A;  3E2D A;  1TWH C;  4A3D K;  4AYB L;  3GTJ A;  2XCO A;  4XLN A;  1B8J A;  1XPP A;  4A3G C;  3GTQ C;  3AD7 C;  2XR9 A;  4CYR A;  4OIP A;  4X6A K;  3OPF A;  4JK1 A;  4LRF A;  3K7A C;  1WOR A;  4UPH A;  1TWG A;  4LQY A;  1O24 A;  5E68 A;  2R93 K;  1EQR A;  3FKI K;  3PO3 C;  3DPC A;  4LOW A;  1I50 A;  2GLQ A;  3AQP A;  1RU0 A;  2IFY A;  5KXA A;  4LR7 A;  2JA8 C;  4G0V A;  1Y1V K;  4UOR A;  4LK1 A;  3HOY C;  4YFN A;  4KJG A;  4YFK A;  1VH2 A;  1ZYR A;  5EGE A;  2W5R A;  3CQZ K;  4UOP A;  2R92 K;  2R7Z A;  5HRT A;  2JA5 A;  1O28 A;  4BLB A;  1KHJ A;  3IGY B;  5LRM A;  4CXK A;  4A3F C;  3JST A;  1WOP A;  3ERE D;  3CQZ C;  1KH4 A;  4KAV A;  3T00 A;  4ZG6 A;  2GSN A;  2O5I A;  3GSI A;  4GTC A;  3M4O K;  3GTL A;  4OIQ A;  3WAY A;  3A8K A;  1O27 A;  3BDG A;  5C44 K;  4A3I K;  2R7Z K;  2R92 A;  1PJ7 A;  5TMC A;  2E2J K;  3S2D C;  1PJ6 A;  1DCO A;  1TWA C;  3N3Y A;  4A3I C;  3NKN A;  1EI6 A;  3SZY A;  4WJ3 M;  3UNY A;  4YFX A;  4CXS A;  3HKZ D;  2XCR B;  1YNJ A;  4C2M K;  4G7Z A;  4GZY A;  2W5T A;  1ELY A;  3OT9 A;  2G9Y A;  2GAG C;  3AQO A;  1K83 A;  2W7V A;  3A8J A;  2CFA B;  3H0G C;  4C3I K;  3GTG A;  1K83 K;  4WIL A;  2NVY C; 
#chains in the Genus database with same CATH homology
 1ZEB A;  5DLT A;  1ED9 A;  4CXU A;  3MK0 A;  1K7H A;  3CMR A;  1SHQ A;  1KH5 A;  5JVO A;  3CQZ A;  3M8Z A;  5TJ3 A;  1Y1W A;  5LRN A;  1AJB A;  4LR8 A;  2R93 A;  2P5M A;  4UPI A;  1KHN A;  4ILD A;  4BLA A;  4GTY A;  4M1X A;  1O2A A;  4KJD A;  4P5A A;  2JA6 A;  2XRG A;  3V4G A;  4FDI A;  3IGZ B;  5IOR A;  3BUE A;  5CJ9 A;  2JA7 A;  3BDG B;  1ZED A;  4GTE A;  1BJT A;  1ALH A;  3GTP A;  5K4P A;  5INH A;  1ANJ A;  1AUK A;  2W5W A;  5L0E A;  3GTQ A;  1E2S P;  3G4C A;  1N2K A;  3LAP A;  3MK1 A;  3KD8 A;  5AJ9 A;  1XXB A;  1HQA A;  4G0U A;  1TWA A;  5L0B A;  5CHP A;  4KB4 A;  4GTB A;  4KAW X;  3N0B A;  2ZFZ A;  1ED8 A;  1IS1 A;  1XXA A;  2JH3 A;  4ZGA A;  2XCQ A;  1P49 A;  3NKQ A;  2IUC B;  4GTL A;  4LRD A;  1GE9 A;  1EW9 A;  1HDH A;  1EH1 A;  1AJD A;  2D1G A;  1O26 A;  1Y1V A;  1WQH A;  5IOS A;  3NKP A;  1KH9 A;  2VQR A;  1XXC A;  3OEP A;  1EQJ A;  2GSU A;  5LQQ A;  4MHX A;  2Y3P A;  4GTX A;  4FDJ A;  3MK2 A;  3NVL A;  5IOQ A;  4KMA A;  4KAY A;  4B56 A;  5JFE A;  3A52 A;  1AJA A;  2W5S A;  4KAS A;  2YU9 A;  1ELZ A;  4NWJ A;  1ZXO A;  4UOO A;  4LRA A;  5DLW A;  3AH5 A;  4KM9 A;  1WCM A;  3NUH A;  4NWX A;  1KHK A;  2QZU A;  4GT9 A;  4LR9 A;  3M8Y A;  2NVX A;  1DD5 A;  2KWA A;  4UPL A;  4KMH A;  4P5B A;  3QX3 A;  3UO0 A;  3L4K A;  1AB4 A;  1O25 A;  2W5X A;  1KHL A;  3NKR A;  3NKO A;  4MIV A;  1O98 A;  4QAX A;  1ANI A;  4KDD A;  5DLV A;  3FOF A;  3VA7 A;  3UN5 A;  1ZVU A;  3LPX A;  1EJJ A;  3BDF A;  1URA A;  1ALJ A;  4LRC A;  4MY4 A;  3FKI A;  1BGW A;  4DDQ A;  4YR1 A;  1EW2 A;  1WQF A;  4C3H C;  1TWF A;  1ZEF A;  3LXQ A;  3ED4 A;  3GTO A;  1E33 P;  4TN0 A;  1F9N A;  3MML B;  3L4J A;  3S0X A;  2W5Q A;  3M7V A;  3M8W A;  1Y6V A;  3CAG A;  4CYS A;  2NVY A;  3G4A A;  2W8D A;  3TX0 A;  4ZG7 A;  1O99 A;  1ELX A;  2B63 A;  4KB2 A;  1ISE A;  1N2L A;  1HJK A;  1ALI A;  3NKM A;  2IUC A;  2CFA A;  3FOE A;  3Q3Q A;  1SFO A;  3WAW A;  1Y7A A;  5IJQ A;  2PHC B;  1AJC A;  3ORE A;  4KC6 A;  4LR2 A;  4KM4 A;  4LRE A;  2W8S A;  4GTD A;  4KAR A;  3TG0 A;  2ANH A;  3FHZ A;  2GA3 A;  4C3I C;  5C66 A;  4ZG9 A;  4GTA A;  1O2B A;  2W5V A;  3SZZ A;  3WBH A;  3UN2 A;  4KAT A;  4LRB A;  3N0C A;  3WAV A;  4UPK A;  3GTM A;  1TWC A;  5GRR A;  2E2I A;  3UN3 A;  4N7T A;  1B4B A;  2VUM A;  1SHN A;  5IJS A;  4GFQ A;  1I3Q A;  1FSU A;  3TWZ A;  4FZB A;  4G0W A;  4J3N A;  3H0G A;  1EK8 A;  3B5Q A;  3GTK A;  2E2H A;  3DYC A;  1URB A;  2RH6 A;  5L0K A;  1O29 A;  2ZKT A;  3WAX A;  4KM8 A;  4FM9 A;  3T02 A;  4GTW A;  3T01 A;  4C3J C;  2X98 A;  4KMD A;  1KH7 A;  5GOV A;  4BKW A;  1E3C P;  1E1Z P;  2GSO A;  1WIH A;  5EGH A;  1WQG A;  4C2M C;  5LIA A;  3LAJ A;  1ZBS A;  1TWH A;  1EW8 A;  5IOT A;  3BDH A;  3IDD A;  4GTF A;  1B4A A;  2RGR A;  1ALK A;  1R9T A;  4GTZ A;  3E2D A;  3GTJ A;  2XCO A;  1B8J A;  2XR9 A;  4CYR A;  3OPF A;  4LRF A;  4UPH A;  1TWG A;  4LQY A;  1O24 A;  3DPC A;  1I50 A;  2GLQ A;  3AQP A;  2IFY A;  5KXA A;  4LR7 A;  4G0V A;  4UOR A;  4KJG A;  5EGE A;  2W5R A;  4UOP A;  2R7Z A;  5HRT A;  2JA5 A;  1O28 A;  4BLB A;  1KHJ A;  3IGY B;  5LRM A;  4CXK A;  3ERE D;  4KAV A;  1KH4 A;  3T00 A;  4ZG6 A;  2GSN A;  4GTC A;  3GTL A;  3WAY A;  1O27 A;  3BDG A;  2R92 A;  3N3Y A;  3NKN A;  1EI6 A;  3SZY A;  3UNY A;  4CXS A;  2XCR B;  2W5T A;  1ELY A;  3OT9 A;  2G9Y A;  3AQO A;  1K83 A;  2CFA B;  3GTG A;  1KQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...