1F68A

Nmr solution structure of the bromodomain from human gcn5
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
103
structure length
103
Chain Sequence
GDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords HISTONE ACETYLTRANSFERASE
publication title Solution structure and acetyl-lysine binding activity of the GCN5 bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 103
sequence length 103
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 1f68A00
3HMFA 4YBTA 4A9OA 5L97A 4HXSA 2RNWA 5TB6A 5D3PA 5EVAA 5CS8A 4Y03A 2DVQA 5FG5A 5TCMA 4IR4A 5HJCA 5LUUA 1EQFA 2R0YA 5FB1A 2YQDA 2H60A 3AADA 4QY4A 4O7AA 4MR3A 5EU1A 4CFLA 5CUCA 5FH8A 1JM4B 5F25A 2DVRA 5HQ7A 4LZRA 5CUAA 3HMEA 5F1LA 4TT6A 4TU6A 5KHMA 5CQAA 3LJWA 4LYSA 4Z6IA 4QBMA 4QSPA 5AD3A 3UVXA 4NR4A 4A9NA 5EGUA 4TS8A 4UYFB 2FSAA 5DLXA 4KV1A 4NYWA 4PY6A 4YYJA 4Z6HA 5DW2A 5II1A 4E96A 2L5EA 4YH4A 5DYXA 2YEMA 2DVSA 1WUGA 4N4FA 5E74A 5I80A 5D0CA 4ZW1A 4XUBA 4O77A 5E7DA 5EM3A 5CQ8A 5D3TA 4QUUA 5C89A 4HBWA 3LXJA 3O35A 4BW2A 4F3IA 4Q0OA 5E9VA 4YBMA 3U5LA 5C85A 4TT2A 3LQHA 4NR6A 4CUQA 4O7BA 4HXPA 5A5RA 5FE7A 2F6JA 4QEVA 4CUUA 4LR6A 5IBNA 4ZC9A 3FKMX 4PS5A 5DKCA 3QZSA 5G4RA 4IOOA 5L98A 3P1EA 3SVHA 4Z1SA 5CZGA 5D7XA 5CFWA 2G4AA 4O71A 2NXBA 5F1HA 2R0SA 3AQAA 4HXNA 5DFDA 5AD2A 5I40A 4NS5A 2F6NA 2L84A 4TTEA 3LQIA 4NYVA 5DFCA 2DVVA 3DWYA 4QZSA 5EP7A 5LJ2A 4CFKA 3O34A 5D3NA 5D3SA 3P5OA 3U5KA 5CPEA 3U5NA 4PCIA 5HQ6A 2RS9B 4MR5A 4IORA 5HENA 5F2PA 5EPRA 5ENIA 5A83A 4Z93A 5AMFA 4QYLA 4YYIA 5CP5A 4CURA 5LKUA 4UYHA 2RI7A 4IR5A 4A9IA 5CRZA 3U5MA 4NRCA 4HXKA 5DKDA 5E9YA 4A9KA 4Z1QA 5LKZA 4TZ8A 3JVMA 4BJXA 1F68A 5EK9A 4XY9A 5ENJA 4CLBA 4YYMA 5I29A 5FH6A 4NR9A 4HBVA 5KTWA 4UYGA 3MB3A 3MQMA 5L8UA 5FH7A 4NUDA 5EWDA 3UV5A 4AKNA 4HXOA 4PCEA 2WP1A 3P1CA 2OSSA 5A81A 5F62A 3QZVA 5HCLA 3NXBA 4OGIA 5CUEA 4BW1A 4A9EA 4A9LA 5HRXA 4LC2A 5I83A 3K2JA 2I8NA 2YW5A 4C67A 5A5OA 4YYDA 3UW9A 5LKXA 5JI8A 2R0VA 5HRWA 4O70A 4N3WA 3MXFA 3GG3A 4ALHA 1E6IA 4NUCA 5DYUA 4NR5A 5BT4A 4LYWA 4QC1A 2DKWA 4QSQA 2DWWA 4C66A 4QC3A 4QSTA 5EWCA 5ENGA 4HXMA 4QEUA 1WUMA 5DW1A 5FE6A 3IU5A 2RFJA 2RO1A 4QR3A 4YY4A 4NQNA 4YYGA 5L8TA 4MENA 5KO4A 3JVLA 3MB4A 1N72A 4O74A 5FDZA 3ZYUA 3P1DA 5FBXA 3U5OA 4QUTA 5CUDA 5E9MA 4ALGA 4QNSA 4UIYA 5CQ6A 2OO1A 3LQJA 5D24A 4YH3A 3UV4A 4N4IA 4TZ2A 5E73A 2GRCA 4OGJA 5ETDA 5FG6A 5EI4A 2LSPB 4TU4A 5EWHA 5FE2A 5I89A 3G0LA 4QSUA 5E0RA 3O37A 5FG4A 4PKLA 3SVGA 5C8GA 4A9JA 4RVRA 5A5QA 5DLZA 4YK0A 4A9MA 4QSWA 5A5NA 5EQ1A 4UIXA 4NR7A 4NRBA 5D3LA 5KTUA 4UITA 3D7CA 5EWWA 2OUOA 4O76A 5EPSA 5E9KA 5ENHA 5F5ZA 2L85A 4QR4A 4YYKA 5LJ0A 5F60A 5DY7A 5LKTA 5KTXA 4QSXA 5IG6A 3O36A 4QSRA 5DBMA 5FE8A 4LRGA 3ONIA 4NXJA 5FFVA 4ZQLA 5DFBA 4N4HA 3TLPA 4QR5A 4CUTA 5H1VA 4MEPA 5H1UA 5II2A 5ENEA 5LVRA 3JVKA 3I3JA 4HXRA 4MEOA 4O72A 5EV9A 5C7NA 3U5JA 4KV4A 5D25A 5DYAA 4YADA 5E9IA 5J0DA 3O33A 4CUSA 5A5PA 5JWMA 5FFYA 4HXLA 4HBXA 4XUAA 5D3RA 5CU8A 5IGLA 5K29A 5CQ5A 5IGMA 5A7CA 5HFRA 4HBYA 2E7OA 5FB0A 5E3DA 5F63A 5D3HA 4OUFA 4UIZA 4TT4A 4XY8A 2RNYA 5CY9A 2E3KA 5HLSA 4X2IA 4YBSA 5IGKA 2D82A 4GPJA 5CUGA 3UV2A 5D3JA 5E3GA 3HMHA 5G4SA 4O7CA 5HFQA 4XYAA 3MUKA 4PTBA 5BT5A 5CQTA 3DAIA 5EISA 4QSSA 4YYNA 5F3AA 4YAXA 4NR8A 5I86A 4MEQA 5FFWA 3UVYA 3UVWA 4N4GA 4NQMA 2N9GA 4UIUA 4QSVA 4WIVA 4QEWA 4YYHA 2I7KA 2KTBB 3Q2EA 4J0SA 5CGPA 4UYDA 2WP2A 4MR4A 4O7FA 5L96A 3SVFA 5L99A 4O78A 4J1PA 5ENFA 5IGNA 4LDFA 4UIWA 3MULA 2YEKA 5EICA 4KCXA 5IIDA 5EWVA 5LVQA 5I1QA 3G0JA 5HM0A 5ENCA 3Q2FA 4CL9A 4WHUA 4A9FA 5COIA 5FE4A 2D9EA 5FE1A 5H85A 4BW3A 4NRAA 5C4QA 5DYCA 3UVDA 4TQNA 5CUBA 2E7NA 5HELA 4YABA 4J0RA 5CRMA 4UIVA 4Q0NA 5F61A 5EA1A 5D26A 4LZ2A 5F36A 4O7EA 5AMEA 5ENBA 5EPBA 4FLPA 2RNXA 5H1TA 3RCWA 5LJ1A 3P1FA 4LYIA 5HEMA 5HRVA 5FE5A 3QZTA 5CQ3A 5ACYA 2YELA 5A85A 4O75A 4YY6A 4MR6A 4IR3A 1JSPB 3U5PA 4IR6A 4BW4A 4UYEA 4DONA 5CTLA 5A82A 4LZSA 4IOQA 3S91A 4NUEA 3JVJA 2YYNA 5DKHA 5DX4A 3S92A 5FE0A 4QB3A 4WHWA 4YATA 5HQ5A 5CQ7A 5A5SA 5I7YA 2DATA 5I88A 2R10A 5FE9A 4CUPA 5CQ4A 4BHWA 4J3IA 5ETBA 4NYXA 5BT3A 5I7XA 1X0JA 1ZS5A 4YC9A 2MJVB 5FE3A 2YDWA 4QYDA 3IU6A 4UYFA 4A9HA 5C87A 5E9LA 5KU3A 4TYLA
chains in the Genus database with same CATH superfamily
3HMFA 4YBTA 4A9OA 5L97A 4HXSA 2RNWA 5TB6A 5D3PA 5EVAA 5CS8A 4Y03A 2DVQA 5FG5A 5TCMA 4IR4A 5HJCA 5LUUA 1EQFA 2R0YA 5FB1A 2YQDA 2H60A 3AADA 4QY4A 4O7AA 4MR3A 5EU1A 4CFLA 5CUCA 5FH8A 3VKHA 1JM4B 5F25A 2DVRA 5HQ7A 4LZRA 5CUAA 3HMEA 5F1LA 4TT6A 4TU6A 5KHMA 5CQAA 3LJWA 4LYSA 4Z6IA 4QBMA 4QSPA 5AD3A 3UVXA 4NR4A 4A9NA 5EGUA 4TS8A 4UYFB 2FSAA 5DLXA 4KV1A 4NYWA 4PY6A 4YYJA 4Z6HA 5DW2A 5II1A 4E96A 2L5EA 4YH4A 5DYXA 2YEMA 2DVSA 1WUGA 4N4FA 5E74A 5I80A 5D0CA 4ZW1A 4XUBA 4O77A 5E7DA 5EM3A 5CQ8A 5D3TA 4QUUA 5C89A 4HBWA 3LXJA 3O35A 4BW2A 4F3IA 4Q0OA 5E9VA 4YBMA 3U5LA 5C85A 4TT2A 3LQHA 4NR6A 4CUQA 4O7BA 4HXPA 5A5RA 5FE7A 2F6JA 4QEVA 4CUUA 4LR6A 5IBNA 3VKGA 4ZC9A 3FKMX 4PS5A 5DKCA 3QZSA 5G4RA 4IOOA 5L98A 3P1EA 3SVHA 4Z1SA 5CZGA 5D7XA 5CFWA 2G4AA 4O71A 2NXBA 5F1HA 2R0SA 3AQAA 4HXNA 5DFDA 5AD2A 5I40A 4NS5A 2F6NA 2L84A 4TTEA 3LQIA 4NYVA 5DFCA 2DVVA 3DWYA 4QZSA 5EP7A 5LJ2A 4CFKA 3O34A 5D3NA 5D3SA 3P5OA 3U5KA 5CPEA 3U5NA 4PCIA 5HQ6A 2RS9B 4MR5A 4IORA 5HENA 5F2PA 5EPRA 5ENIA 5A83A 4Z93A 5AMFA 4QYLA 4YYIA 5CP5A 4CURA 5LKUA 4UYHA 2RI7A 4IR5A 4A9IA 5CRZA 3U5MA 4NRCA 4HXKA 5DKDA 5E9YA 4A9KA 4Z1QA 5LKZA 4TZ8A 3JVMA 4BJXA 4AKHA 1F68A 5EK9A 4XY9A 5ENJA 4CLBA 4YYMA 5I29A 5FH6A 4NR9A 4HBVA 5KTWA 4UYGA 3MB3A 3MQMA 1PUOA 5L8UA 5FH7A 4NUDA 5EWDA 2EJNA 3UV5A 4AKNA 4HXOA 4PCEA 2WP1A 3P1CA 2OSSA 5A81A 5F62A 3QZVA 5HCLA 3NXBA 4OGIA 5CUEA 4BW1A 4A9EA 4A9LA 5HRXA 4LC2A 5I83A 3K2JA 2I8NA 2YW5A 4C67A 5A5OA 4YYDA 3UW9A 5LKXA 5JI8A 2R0VA 5HRWA 4O70A 4N3WA 3MXFA 3GG3A 4ALHA 1E6IA 4NUCA 5DYUA 4NR5A 5BT4A 4LYWA 4QC1A 2DKWA 4QSQA 2DWWA 4C66A 4QC3A 4QSTA 5EWCA 5ENGA 4AKGA 4HXMA 4QEUA 1WUMA 5DW1A 5FE6A 3IU5A 2RFJA 2RO1A 4QR3A 4YY4A 4NQNA 4YYGA 5L8TA 4MENA 5KO4A 3JVLA 3MB4A 1N72A 4O74A 5FDZA 3ZYUA 3P1DA 5FBXA 3U5OA 4QUTA 5CUDA 5E9MA 4ALGA 4QNSA 4UIYA 5CQ6A 2OO1A 3LQJA 5D24A 4YH3A 3UV4A 4N4IA 4TZ2A 5E73A 2GRCA 4OGJA 5ETDA 5FG6A 5EI4A 2LSPB 4TU4A 5EWHA 3D1BA 5FE2A 5I89A 3G0LA 4QSUA 5E0RA 3O37A 5FG4A 4PKLA 3SVGA 5C8GA 4A9JA 4RVRA 5A5QA 5DLZA 4YK0A 4A9MA 1ZKRA 4QSWA 5A5NA 5EQ1A 4UIXA 4NR7A 4NRBA 5D3LA 5KTUA 4UITA 3D7CA 4AKIA 5EWWA 2OUOA 4O76A 5EPSA 5E9KA 5ENHA 5F5ZA 2L85A 4QR4A 4YYKA 5LJ0A 5F60A 5DY7A 5LKTA 5KTXA 4QSXA 5IG6A 3O36A 4QSRA 5DBMA 5FE8A 4LRGA 3ONIA 4NXJA 5FFVA 4ZQLA 5DFBA 4N4HA 3TLPA 4QR5A 4CUTA 5H1VA 4MEPA 5H1UA 5II2A 5ENEA 5LVRA 3JVKA 3I3JA 4HXRA 4MEOA 4O72A 5EV9A 5C7NA 3U5JA 4KV4A 5D25A 5DYAA 4YADA 5E9IA 5J0DA 3O33A 4CUSA 5A5PA 5JWMA 5FFYA 4HXLA 4HBXA 4XUAA 5D3RA 5CU8A 5IGLA 5K29A 5CQ5A 5IGMA 5A7CA 5HFRA 4HBYA 2E7OA 5FB0A 5E3DA 5F63A 5D3HA 4OUFA 4UIZA 4TT4A 4XY8A 2RNYA 5CY9A 2E3KA 5HLSA 4X2IA 4YBSA 5IGKA 2D82A 4GPJA 5CUGA 3UV2A 5D3JA 5E3GA 3HMHA 5G4SA 4O7CA 5HFQA 4XYAA 3MUKA 4PTBA 5BT5A 5CQTA 3DAIA 5EISA 4QSSA 4YYNA 5F3AA 4YAXA 4NR8A 5I86A 4MEQA 5FFWA 3UVYA 3UVWA 4N4GA 4NQMA 2N9GA 4UIUA 4QSVA 4WIVA 4QEWA 4YYHA 2I7KA 2KTBB 3Q2EA 5CGPA 4J0SA 4UYDA 2WP2A 4MR4A 4O7FA 5L96A 3SVFA 5L99A 4O78A 4J1PA 5ENFA 5IGNA 4LDFA 4UIWA 3MULA 2YEKA 5EICA 4KCXA 5IIDA 5EWVA 5LVQA 5I1QA 3G0JA 5HM0A 5ENCA 3Q2FA 4CL9A 4WHUA 4A9FA 5COIA 5FE4A 2D9EA 5FE1A 5H85A 4BW3A 4NRAA 5C4QA 5DYCA 3UVDA 4TQNA 5CUBA 2E7NA 5HELA 4YABA 4J0RA 5CRMA 4UIVA 4Q0NA 5F61A 5EA1A 5D26A 4LZ2A 5F36A 4O7EA 5AMEA 5ENBA 5EPBA 4FLPA 2RNXA 5H1TA 3RCWA 5LJ1A 3P1FA 4LYIA 5HEMA 5HRVA 4AI6A 5FE5A 3QZTA 5CQ3A 5ACYA 2YELA 5A85A 4O75A 4YY6A 4MR6A 4IR3A 1JSPB 3U5PA 4IR6A 4BW4A 4UYEA 4DONA 5CTLA 5A82A 4LZSA 4IOQA 3S91A 4NUEA 3D1DA 3JVJA 2YYNA 5DKHA 5DX4A 3S92A 5FE0A 4QB3A 4WHWA 4YATA 5HQ5A 5CQ7A 5A5SA 5I7YA 2DATA 5I88A 2R10A 5FE9A 4CUPA 5CQ4A 4BHWA 4J3IA 5ETBA 4NYXA 5BT3A 5I7XA 1X0JA 1ZS5A 4YC9A 2MJVB 5FE3A 2YDWA 3ERRA 3IU6A 4QYDA 4UYFA 4A9HA 5C87A 5E9LA 5KU3A 4TYLA
chains in the Genus database with same CATH topology
3HMFA 4YBTA 4A9OA 5L97A 4HXSA 2RNWA 5TB6A 5D3PA 5EVAA 5CS8A 4Y03A 2DVQA 5FG5A 5TCMA 4IR4A 5HJCA 5LUUA 1EQFA 2R0YA 5FB1A 2YQDA 2H60A 3AADA 4QY4A 4O7AA 4MR3A 5EU1A 4CFLA 5CUCA 5FH8A 1JM4B 5F25A 2DVRA 5HQ7A 4LZRA 5CUAA 3HMEA 5F1LA 4TT6A 4TU6A 5KHMA 5CQAA 3LJWA 4LYSA 4Z6IA 4QBMA 4QSPA 5AD3A 3UVXA 4NR4A 4A9NA 5EGUA 4TS8A 4UYFB 2FSAA 5DLXA 4KV1A 4NYWA 4PY6A 4YYJA 4Z6HA 5DW2A 5II1A 4E96A 2L5EA 4YH4A 5DYXA 2YEMA 2DVSA 1WUGA 4N4FA 5E74A 5I80A 5D0CA 4ZW1A 4XUBA 4O77A 5E7DA 5EM3A 5CQ8A 5D3TA 4QUUA 5C89A 4HBWA 3LXJA 3O35A 4BW2A 4F3IA 4Q0OA 5E9VA 4YBMA 3U5LA 5C85A 4TT2A 3LQHA 4NR6A 4CUQA 4O7BA 4HXPA 5A5RA 5FE7A 2F6JA 4QEVA 4CUUA 4LR6A 5IBNA 4ZC9A 3FKMX 4PS5A 5DKCA 3QZSA 5G4RA 4IOOA 5L98A 3P1EA 3SVHA 4Z1SA 5CZGA 5D7XA 5CFWA 2G4AA 4O71A 2NXBA 5F1HA 2R0SA 3AQAA 4HXNA 5DFDA 5AD2A 5I40A 4NS5A 2F6NA 2L84A 4TTEA 3LQIA 4NYVA 5DFCA 2DVVA 3DWYA 4QZSA 5EP7A 5LJ2A 4CFKA 3O34A 5D3NA 5D3SA 3P5OA 3U5KA 5CPEA 3U5NA 4PCIA 5HQ6A 2RS9B 4MR5A 4IORA 5HENA 5F2PA 5EPRA 5ENIA 5A83A 4Z93A 5AMFA 4QYLA 4YYIA 5CP5A 4CURA 5LKUA 4UYHA 2RI7A 4IR5A 4A9IA 5CRZA 3U5MA 4NRCA 4HXKA 5DKDA 5E9YA 4A9KA 4Z1QA 5LKZA 4TZ8A 3JVMA 4BJXA 1F68A 5EK9A 4XY9A 5ENJA 4CLBA 4YYMA 5I29A 5FH6A 4NR9A 4HBVA 5KTWA 4UYGA 3MB3A 3MQMA 5L8UA 5FH7A 4NUDA 5EWDA 3UV5A 4AKNA 4HXOA 4PCEA 2WP1A 3P1CA 2OSSA 5A81A 5F62A 3QZVA 5HCLA 3NXBA 4OGIA 5CUEA 4BW1A 4A9EA 4A9LA 5HRXA 4LC2A 5I83A 3K2JA 2I8NA 2YW5A 4C67A 5A5OA 4YYDA 3UW9A 5LKXA 5JI8A 2R0VA 5HRWA 4O70A 4N3WA 3MXFA 3GG3A 4ALHA 1E6IA 4NUCA 5DYUA 4NR5A 5BT4A 4LYWA 4QC1A 2DKWA 4QSQA 2DWWA 4C66A 4QC3A 4QSTA 5EWCA 5ENGA 4HXMA 4QEUA 1WUMA 5DW1A 5FE6A 3IU5A 2RFJA 2RO1A 4QR3A 4YY4A 4NQNA 4YYGA 5L8TA 4MENA 5KO4A 3JVLA 3MB4A 1N72A 4O74A 5FDZA 3ZYUA 3P1DA 5FBXA 3U5OA 4QUTA 5CUDA 5E9MA 4ALGA 4QNSA 4UIYA 5CQ6A 2OO1A 3LQJA 5D24A 4YH3A 3UV4A 4N4IA 4TZ2A 5E73A 2GRCA 4OGJA 5ETDA 5FG6A 5EI4A 2LSPB 4TU4A 5EWHA 5FE2A 5I89A 3G0LA 4QSUA 5E0RA 3O37A 5FG4A 4PKLA 3SVGA 5C8GA 4A9JA 4RVRA 5A5QA 5DLZA 4YK0A 4A9MA 4QSWA 5A5NA 5EQ1A 4UIXA 4NR7A 4NRBA 5D3LA 5KTUA 4UITA 3D7CA 5EWWA 2OUOA 4O76A 5EPSA 5E9KA 5ENHA 5F5ZA 2L85A 4QR4A 4YYKA 5LJ0A 5F60A 5DY7A 5LKTA 5KTXA 4QSXA 5IG6A 3O36A 4QSRA 5DBMA 5FE8A 4LRGA 3ONIA 4NXJA 5FFVA 4ZQLA 5DFBA 4N4HA 3TLPA 4QR5A 4CUTA 5H1VA 4MEPA 5H1UA 5II2A 5ENEA 5LVRA 3JVKA 3I3JA 4HXRA 4MEOA 4O72A 5EV9A 5C7NA 3U5JA 4KV4A 5D25A 5DYAA 4YADA 5E9IA 5J0DA 3O33A 4CUSA 5A5PA 5JWMA 5FFYA 4HXLA 4HBXA 4XUAA 5D3RA 5CU8A 5IGLA 5K29A 5CQ5A 5IGMA 5A7CA 5HFRA 4HBYA 2E7OA 5FB0A 5E3DA 5F63A 5D3HA 4OUFA 4UIZA 4TT4A 4XY8A 2RNYA 5CY9A 2E3KA 5HLSA 4X2IA 4YBSA 5IGKA 2D82A 4GPJA 5CUGA 3UV2A 5D3JA 5E3GA 3HMHA 5G4SA 4O7CA 5HFQA 4XYAA 3MUKA 4PTBA 5BT5A 5CQTA 3DAIA 5EISA 4QSSA 4YYNA 5F3AA 4YAXA 4NR8A 5I86A 4MEQA 5FFWA 3UVYA 3UVWA 4N4GA 4NQMA 2N9GA 4UIUA 4QSVA 4WIVA 4QEWA 4YYHA 2I7KA 2KTBB 3Q2EA 4J0SA 5CGPA 4UYDA 2WP2A 4MR4A 4O7FA 5L96A 3SVFA 5L99A 4O78A 4J1PA 5ENFA 5IGNA 4LDFA 4UIWA 3MULA 2YEKA 5EICA 4KCXA 5IIDA 5EWVA 5LVQA 5I1QA 3G0JA 5HM0A 5ENCA 3Q2FA 4CL9A 4WHUA 4A9FA 5COIA 5FE4A 2D9EA 5FE1A 5H85A 4BW3A 4NRAA 5C4QA 5DYCA 3UVDA 4TQNA 5CUBA 2E7NA 5HELA 4YABA 4J0RA 5CRMA 4UIVA 4Q0NA 5F61A 5EA1A 5D26A 4LZ2A 5F36A 4O7EA 5AMEA 5ENBA 5EPBA 4FLPA 2RNXA 5H1TA 3RCWA 5LJ1A 3P1FA 4LYIA 5HEMA 5HRVA 5FE5A 3QZTA 5CQ3A 5ACYA 2YELA 5A85A 4O75A 4YY6A 4MR6A 4IR3A 1JSPB 3U5PA 4IR6A 4BW4A 4UYEA 4DONA 5CTLA 5A82A 4LZSA 4IOQA 3S91A 4NUEA 3JVJA 2YYNA 5DKHA 5DX4A 3S92A 5FE0A 4QB3A 4WHWA 4YATA 5HQ5A 5CQ7A 5A5SA 5I7YA 2DATA 5I88A 2R10A 5FE9A 4CUPA 5CQ4A 4BHWA 4J3IA 5ETBA 4NYXA 5BT3A 5I7XA 1X0JA 1ZS5A 4YC9A 2MJVB 5FE3A 2YDWA 4QYDA 3IU6A 4UYFA 4A9HA 5C87A 5E9LA 5KU3A 4TYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HMF A;  4YBT A;  4A9O A;  5L97 A;  4HXS A;  2RNW A;  5TB6 A;  5D3P A;  5EVA A;  5CS8 A;  4Y03 A;  2DVQ A;  5FG5 A;  5TCM A;  4IR4 A;  5HJC A;  5LUU A;  1EQF A;  2R0Y A;  5FB1 A;  2YQD A;  2H60 A;  3AAD A;  4QY4 A;  4O7A A;  4MR3 A;  5EU1 A;  4CFL A;  5CUC A;  5FH8 A;  1JM4 B;  5F25 A;  2DVR A;  5HQ7 A;  4LZR A;  5CUA A;  3HME A;  5F1L A;  4TT6 A;  4TU6 A;  5KHM A;  5CQA A;  3LJW A;  4LYS A;  4Z6I A;  4QBM A;  4QSP A;  5AD3 A;  3UVX A;  4NR4 A;  4A9N A;  5EGU A;  4TS8 A;  4UYF B;  2FSA A;  5DLX A;  4KV1 A;  4NYW A;  4PY6 A;  4YYJ A;  4Z6H A;  5DW2 A;  5II1 A;  4E96 A;  2L5E A;  4YH4 A;  5DYX A;  2YEM A;  2DVS A;  1WUG A;  4N4F A;  5E74 A;  5I80 A;  5D0C A;  4ZW1 A;  4XUB A;  4O77 A;  5E7D A;  5EM3 A;  5CQ8 A;  5D3T A;  4QUU A;  5C89 A;  4HBW A;  3LXJ A;  3O35 A;  4BW2 A;  4F3I A;  4Q0O A;  5E9V A;  4YBM A;  3U5L A;  5C85 A;  4TT2 A;  3LQH A;  4NR6 A;  4CUQ A;  4O7B A;  4HXP A;  5A5R A;  5FE7 A;  2F6J A;  4QEV A;  4CUU A;  4LR6 A;  5IBN A;  4ZC9 A;  3FKM X;  4PS5 A;  5DKC A;  3QZS A;  5G4R A;  4IOO A;  5L98 A;  3P1E A;  3SVH A;  4Z1S A;  5CZG A;  5D7X A;  5CFW A;  2G4A A;  4O71 A;  2NXB A;  5F1H A;  2R0S A;  3AQA A;  4HXN A;  5DFD A;  5AD2 A;  5I40 A;  4NS5 A;  2F6N A;  2L84 A;  4TTE A;  3LQI A;  4NYV A;  5DFC A;  2DVV A;  3DWY A;  4QZS A;  5EP7 A;  5LJ2 A;  4CFK A;  3O34 A;  5D3N A;  5D3S A;  3P5O A;  3U5K A;  5CPE A;  3U5N A;  4PCI A;  5HQ6 A;  2RS9 B;  4MR5 A;  4IOR A;  5HEN A;  5F2P A;  5EPR A;  5ENI A;  5A83 A;  4Z93 A;  5AMF A;  4QYL A;  4YYI A;  5CP5 A;  4CUR A;  5LKU A;  4UYH A;  2RI7 A;  4IR5 A;  4A9I A;  5CRZ A;  3U5M A;  4NRC A;  4HXK A;  5DKD A;  5E9Y A;  4A9K A;  4Z1Q A;  5LKZ A;  4TZ8 A;  3JVM A;  4BJX A;  1F68 A;  5EK9 A;  4XY9 A;  5ENJ A;  4CLB A;  4YYM A;  5I29 A;  5FH6 A;  4NR9 A;  4HBV A;  5KTW A;  4UYG A;  3MB3 A;  3MQM A;  5L8U A;  5FH7 A;  4NUD A;  5EWD A;  3UV5 A;  4AKN A;  4HXO A;  4PCE A;  2WP1 A;  3P1C A;  2OSS A;  5A81 A;  5F62 A;  3QZV A;  5HCL A;  3NXB A;  4OGI A;  5CUE A;  4BW1 A;  4A9E A;  4A9L A;  5HRX A;  4LC2 A;  5I83 A;  3K2J A;  2I8N A;  2YW5 A;  4C67 A;  5A5O A;  4YYD A;  3UW9 A;  5LKX A;  5JI8 A;  2R0V A;  5HRW A;  4O70 A;  4N3W A;  3MXF A;  3GG3 A;  4ALH A;  1E6I A;  4NUC A;  5DYU A;  4NR5 A;  5BT4 A;  4LYW A;  4QC1 A;  2DKW A;  4QSQ A;  2DWW A;  4C66 A;  4QC3 A;  4QST A;  5EWC A;  5ENG A;  4HXM A;  4QEU A;  1WUM A;  5DW1 A;  5FE6 A;  3IU5 A;  2RFJ A;  2RO1 A;  4QR3 A;  4YY4 A;  4NQN A;  4YYG A;  5L8T A;  4MEN A;  5KO4 A;  3JVL A;  3MB4 A;  1N72 A;  4O74 A;  5FDZ A;  3ZYU A;  3P1D A;  5FBX A;  3U5O A;  4QUT A;  5CUD A;  5E9M A;  4ALG A;  4QNS A;  4UIY A;  5CQ6 A;  2OO1 A;  3LQJ A;  5D24 A;  4YH3 A;  3UV4 A;  4N4I A;  4TZ2 A;  5E73 A;  2GRC A;  4OGJ A;  5ETD A;  5FG6 A;  5EI4 A;  2LSP B;  4TU4 A;  5EWH A;  5FE2 A;  5I89 A;  3G0L A;  4QSU A;  5E0R A;  3O37 A;  5FG4 A;  4PKL A;  3SVG A;  5C8G A;  4A9J A;  4RVR A;  5A5Q A;  5DLZ A;  4YK0 A;  4A9M A;  4QSW A;  5A5N A;  5EQ1 A;  4UIX A;  4NR7 A;  4NRB A;  5D3L A;  5KTU A;  4UIT A;  3D7C A;  5EWW A;  2OUO A;  4O76 A;  5EPS A;  5E9K A;  5ENH A;  5F5Z A;  2L85 A;  4QR4 A;  4YYK A;  5LJ0 A;  5F60 A;  5DY7 A;  5LKT A;  5KTX A;  4QSX A;  5IG6 A;  3O36 A;  4QSR A;  5DBM A;  5FE8 A;  4LRG A;  3ONI A;  4NXJ A;  5FFV A;  4ZQL A;  5DFB A;  4N4H A;  3TLP A;  4QR5 A;  4CUT A;  5H1V A;  4MEP A;  5H1U A;  5II2 A;  5ENE A;  5LVR A;  3JVK A;  3I3J A;  4HXR A;  4MEO A;  4O72 A;  5EV9 A;  5C7N A;  3U5J A;  4KV4 A;  5D25 A;  5DYA A;  4YAD A;  5E9I A;  5J0D A;  3O33 A;  4CUS A;  5A5P A;  5JWM A;  5FFY A;  4HXL A;  4HBX A;  4XUA A;  5D3R A;  5CU8 A;  5IGL A;  5K29 A;  5CQ5 A;  5IGM A;  5A7C A;  5HFR A;  4HBY A;  2E7O A;  5FB0 A;  5E3D A;  5F63 A;  5D3H A;  4OUF A;  4UIZ A;  4TT4 A;  4XY8 A;  2RNY A;  5CY9 A;  2E3K A;  5HLS A;  4X2I A;  4YBS A;  5IGK A;  2D82 A;  4GPJ A;  5CUG A;  3UV2 A;  5D3J A;  5E3G A;  3HMH A;  5G4S A;  4O7C A;  5HFQ A;  4XYA A;  3MUK A;  4PTB A;  5BT5 A;  5CQT A;  3DAI A;  5EIS A;  4QSS A;  4YYN A;  5F3A A;  4YAX A;  4NR8 A;  5I86 A;  4MEQ A;  5FFW A;  3UVY A;  3UVW A;  4N4G A;  4NQM A;  2N9G A;  4UIU A;  4QSV A;  4WIV A;  4QEW A;  4YYH A;  2I7K A;  2KTB B;  3Q2E A;  4J0S A;  5CGP A;  4UYD A;  2WP2 A;  4MR4 A;  4O7F A;  5L96 A;  3SVF A;  5L99 A;  4O78 A;  4J1P A;  5ENF A;  5IGN A;  4LDF A;  4UIW A;  3MUL A;  2YEK A;  5EIC A;  4KCX A;  5IID A;  5EWV A;  5LVQ A;  5I1Q A;  3G0J A;  5HM0 A;  5ENC A;  3Q2F A;  4CL9 A;  4WHU A;  4A9F A;  5COI A;  5FE4 A;  2D9E A;  5FE1 A;  5H85 A;  4BW3 A;  4NRA A;  5C4Q A;  5DYC A;  3UVD A;  4TQN A;  5CUB A;  2E7N A;  5HEL A;  4YAB A;  4J0R A;  5CRM A;  4UIV A;  4Q0N A;  5F61 A;  5EA1 A;  5D26 A;  4LZ2 A;  5F36 A;  4O7E A;  5AME A;  5ENB A;  5EPB A;  4FLP A;  2RNX A;  5H1T A;  3RCW A;  5LJ1 A;  3P1F A;  4LYI A;  5HEM A;  5HRV A;  5FE5 A;  3QZT A;  5CQ3 A;  5ACY A;  2YEL A;  5A85 A;  4O75 A;  4YY6 A;  4MR6 A;  4IR3 A;  1JSP B;  3U5P A;  4IR6 A;  4BW4 A;  4UYE A;  4DON A;  5CTL A;  5A82 A;  4LZS A;  4IOQ A;  3S91 A;  4NUE A;  3JVJ A;  2YYN A;  5DKH A;  5DX4 A;  3S92 A;  5FE0 A;  4QB3 A;  4WHW A;  4YAT A;  5HQ5 A;  5CQ7 A;  5A5S A;  5I7Y A;  2DAT A;  5I88 A;  2R10 A;  5FE9 A;  4CUP A;  5CQ4 A;  4BHW A;  4J3I A;  5ETB A;  4NYX A;  5BT3 A;  5I7X A;  1X0J A;  1ZS5 A;  4YC9 A;  2MJV B;  5FE3 A;  2YDW A;  4QYD A;  3IU6 A;  4UYF A;  4A9H A;  5C87 A;  5E9L A;  5KU3 A;  4TYL A; 
#chains in the Genus database with same CATH topology
 3HMF A;  4YBT A;  4A9O A;  5L97 A;  4HXS A;  2RNW A;  5TB6 A;  5D3P A;  5EVA A;  5CS8 A;  4Y03 A;  2DVQ A;  5FG5 A;  5TCM A;  4IR4 A;  5HJC A;  5LUU A;  1EQF A;  2R0Y A;  5FB1 A;  2YQD A;  2H60 A;  3AAD A;  4QY4 A;  4O7A A;  4MR3 A;  5EU1 A;  4CFL A;  5CUC A;  5FH8 A;  3VKH A;  1JM4 B;  5F25 A;  2DVR A;  5HQ7 A;  4LZR A;  5CUA A;  3HME A;  5F1L A;  4TT6 A;  4TU6 A;  5KHM A;  5CQA A;  3LJW A;  4LYS A;  4Z6I A;  4QBM A;  4QSP A;  5AD3 A;  3UVX A;  4NR4 A;  4A9N A;  5EGU A;  4TS8 A;  4UYF B;  2FSA A;  5DLX A;  4KV1 A;  4NYW A;  4PY6 A;  4YYJ A;  4Z6H A;  5DW2 A;  5II1 A;  4E96 A;  2L5E A;  4YH4 A;  5DYX A;  2YEM A;  2DVS A;  1WUG A;  4N4F A;  5E74 A;  5I80 A;  5D0C A;  4ZW1 A;  4XUB A;  4O77 A;  5E7D A;  5EM3 A;  5CQ8 A;  5D3T A;  4QUU A;  5C89 A;  4HBW A;  3LXJ A;  3O35 A;  4BW2 A;  4F3I A;  4Q0O A;  5E9V A;  4YBM A;  3U5L A;  5C85 A;  4TT2 A;  3LQH A;  4NR6 A;  4CUQ A;  4O7B A;  4HXP A;  5A5R A;  5FE7 A;  2F6J A;  4QEV A;  4CUU A;  4LR6 A;  5IBN A;  3VKG A;  4ZC9 A;  3FKM X;  4PS5 A;  5DKC A;  3QZS A;  5G4R A;  4IOO A;  5L98 A;  3P1E A;  3SVH A;  4Z1S A;  5CZG A;  5D7X A;  5CFW A;  2G4A A;  4O71 A;  2NXB A;  5F1H A;  2R0S A;  3AQA A;  4HXN A;  5DFD A;  5AD2 A;  5I40 A;  4NS5 A;  2F6N A;  2L84 A;  4TTE A;  3LQI A;  4NYV A;  5DFC A;  2DVV A;  3DWY A;  4QZS A;  5EP7 A;  5LJ2 A;  4CFK A;  3O34 A;  5D3N A;  5D3S A;  3P5O A;  3U5K A;  5CPE A;  3U5N A;  4PCI A;  5HQ6 A;  2RS9 B;  4MR5 A;  4IOR A;  5HEN A;  5F2P A;  5EPR A;  5ENI A;  5A83 A;  4Z93 A;  5AMF A;  4QYL A;  4YYI A;  5CP5 A;  4CUR A;  5LKU A;  4UYH A;  2RI7 A;  4IR5 A;  4A9I A;  5CRZ A;  3U5M A;  4NRC A;  4HXK A;  5DKD A;  5E9Y A;  4A9K A;  4Z1Q A;  5LKZ A;  4TZ8 A;  3JVM A;  4BJX A;  4AKH A;  1F68 A;  5EK9 A;  4XY9 A;  5ENJ A;  4CLB A;  4YYM A;  5I29 A;  5FH6 A;  4NR9 A;  4HBV A;  5KTW A;  4UYG A;  3MB3 A;  3MQM A;  1PUO A;  5L8U A;  5FH7 A;  4NUD A;  5EWD A;  2EJN A;  3UV5 A;  4AKN A;  4HXO A;  4PCE A;  2WP1 A;  3P1C A;  2OSS A;  5A81 A;  5F62 A;  3QZV A;  5HCL A;  3NXB A;  4OGI A;  5CUE A;  4BW1 A;  4A9E A;  4A9L A;  5HRX A;  4LC2 A;  5I83 A;  3K2J A;  2I8N A;  2YW5 A;  4C67 A;  5A5O A;  4YYD A;  3UW9 A;  5LKX A;  5JI8 A;  2R0V A;  5HRW A;  4O70 A;  4N3W A;  3MXF A;  3GG3 A;  4ALH A;  1E6I A;  4NUC A;  5DYU A;  4NR5 A;  5BT4 A;  4LYW A;  4QC1 A;  2DKW A;  4QSQ A;  2DWW A;  4C66 A;  4QC3 A;  4QST A;  5EWC A;  5ENG A;  4AKG A;  4HXM A;  4QEU A;  1WUM A;  5DW1 A;  5FE6 A;  3IU5 A;  2RFJ A;  2RO1 A;  4QR3 A;  4YY4 A;  4NQN A;  4YYG A;  5L8T A;  4MEN A;  5KO4 A;  3JVL A;  3MB4 A;  1N72 A;  4O74 A;  5FDZ A;  3ZYU A;  3P1D A;  5FBX A;  3U5O A;  4QUT A;  5CUD A;  5E9M A;  4ALG A;  4QNS A;  4UIY A;  5CQ6 A;  2OO1 A;  3LQJ A;  5D24 A;  4YH3 A;  3UV4 A;  4N4I A;  4TZ2 A;  5E73 A;  2GRC A;  4OGJ A;  5ETD A;  5FG6 A;  5EI4 A;  2LSP B;  4TU4 A;  5EWH A;  3D1B A;  5FE2 A;  5I89 A;  3G0L A;  4QSU A;  5E0R A;  3O37 A;  5FG4 A;  4PKL A;  3SVG A;  5C8G A;  4A9J A;  4RVR A;  5A5Q A;  5DLZ A;  4YK0 A;  4A9M A;  1ZKR A;  4QSW A;  5A5N A;  5EQ1 A;  4UIX A;  4NR7 A;  4NRB A;  5D3L A;  5KTU A;  4UIT A;  3D7C A;  4AKI A;  5EWW A;  2OUO A;  4O76 A;  5EPS A;  5E9K A;  5ENH A;  5F5Z A;  2L85 A;  4QR4 A;  4YYK A;  5LJ0 A;  5F60 A;  5DY7 A;  5LKT A;  5KTX A;  4QSX A;  5IG6 A;  3O36 A;  4QSR A;  5DBM A;  5FE8 A;  4LRG A;  3ONI A;  4NXJ A;  5FFV A;  4ZQL A;  5DFB A;  4N4H A;  3TLP A;  4QR5 A;  4CUT A;  5H1V A;  4MEP A;  5H1U A;  5II2 A;  5ENE A;  5LVR A;  3JVK A;  3I3J A;  4HXR A;  4MEO A;  4O72 A;  5EV9 A;  5C7N A;  3U5J A;  4KV4 A;  5D25 A;  5DYA A;  4YAD A;  5E9I A;  5J0D A;  3O33 A;  4CUS A;  5A5P A;  5JWM A;  5FFY A;  4HXL A;  4HBX A;  4XUA A;  5D3R A;  5CU8 A;  5IGL A;  5K29 A;  5CQ5 A;  5IGM A;  5A7C A;  5HFR A;  4HBY A;  2E7O A;  5FB0 A;  5E3D A;  5F63 A;  5D3H A;  4OUF A;  4UIZ A;  4TT4 A;  4XY8 A;  2RNY A;  5CY9 A;  2E3K A;  5HLS A;  4X2I A;  4YBS A;  5IGK A;  2D82 A;  4GPJ A;  5CUG A;  3UV2 A;  5D3J A;  5E3G A;  3HMH A;  5G4S A;  4O7C A;  5HFQ A;  4XYA A;  3MUK A;  4PTB A;  5BT5 A;  5CQT A;  3DAI A;  5EIS A;  4QSS A;  4YYN A;  5F3A A;  4YAX A;  4NR8 A;  5I86 A;  4MEQ A;  5FFW A;  3UVY A;  3UVW A;  4N4G A;  4NQM A;  2N9G A;  4UIU A;  4QSV A;  4WIV A;  4QEW A;  4YYH A;  2I7K A;  2KTB B;  3Q2E A;  5CGP A;  4J0S A;  4UYD A;  2WP2 A;  4MR4 A;  4O7F A;  5L96 A;  3SVF A;  5L99 A;  4O78 A;  4J1P A;  5ENF A;  5IGN A;  4LDF A;  4UIW A;  3MUL A;  2YEK A;  5EIC A;  4KCX A;  5IID A;  5EWV A;  5LVQ A;  5I1Q A;  3G0J A;  5HM0 A;  5ENC A;  3Q2F A;  4CL9 A;  4WHU A;  4A9F A;  5COI A;  5FE4 A;  2D9E A;  5FE1 A;  5H85 A;  4BW3 A;  4NRA A;  5C4Q A;  5DYC A;  3UVD A;  4TQN A;  5CUB A;  2E7N A;  5HEL A;  4YAB A;  4J0R A;  5CRM A;  4UIV A;  4Q0N A;  5F61 A;  5EA1 A;  5D26 A;  4LZ2 A;  5F36 A;  4O7E A;  5AME A;  5ENB A;  5EPB A;  4FLP A;  2RNX A;  5H1T A;  3RCW A;  5LJ1 A;  3P1F A;  4LYI A;  5HEM A;  5HRV A;  4AI6 A;  5FE5 A;  3QZT A;  5CQ3 A;  5ACY A;  2YEL A;  5A85 A;  4O75 A;  4YY6 A;  4MR6 A;  4IR3 A;  1JSP B;  3U5P A;  4IR6 A;  4BW4 A;  4UYE A;  4DON A;  5CTL A;  5A82 A;  4LZS A;  4IOQ A;  3S91 A;  4NUE A;  3D1D A;  3JVJ A;  2YYN A;  5DKH A;  5DX4 A;  3S92 A;  5FE0 A;  4QB3 A;  4WHW A;  4YAT A;  5HQ5 A;  5CQ7 A;  5A5S A;  5I7Y A;  2DAT A;  5I88 A;  2R10 A;  5FE9 A;  4CUP A;  5CQ4 A;  4BHW A;  4J3I A;  5ETB A;  4NYX A;  5BT3 A;  5I7X A;  1X0J A;  1ZS5 A;  4YC9 A;  2MJV B;  5FE3 A;  2YDW A;  3ERR A;  3IU6 A;  4QYD A;  4UYF A;  4A9H A;  5C87 A;  5E9L A;  5KU3 A;  4TYL A; 
#chains in the Genus database with same CATH homology
 3HMF A;  4YBT A;  4A9O A;  5L97 A;  4HXS A;  2RNW A;  5TB6 A;  5D3P A;  5EVA A;  5CS8 A;  4Y03 A;  2DVQ A;  5FG5 A;  5TCM A;  4IR4 A;  5HJC A;  5LUU A;  1EQF A;  2R0Y A;  5FB1 A;  2YQD A;  2H60 A;  3AAD A;  4QY4 A;  4O7A A;  4MR3 A;  5EU1 A;  4CFL A;  5CUC A;  5FH8 A;  1JM4 B;  5F25 A;  2DVR A;  5HQ7 A;  4LZR A;  5CUA A;  3HME A;  5F1L A;  4TT6 A;  4TU6 A;  5KHM A;  5CQA A;  3LJW A;  4LYS A;  4Z6I A;  4QBM A;  4QSP A;  5AD3 A;  3UVX A;  4NR4 A;  4A9N A;  5EGU A;  4TS8 A;  4UYF B;  2FSA A;  5DLX A;  4KV1 A;  4NYW A;  4PY6 A;  4YYJ A;  4Z6H A;  5DW2 A;  5II1 A;  4E96 A;  2L5E A;  4YH4 A;  5DYX A;  2YEM A;  2DVS A;  1WUG A;  4N4F A;  5E74 A;  5I80 A;  5D0C A;  4ZW1 A;  4XUB A;  4O77 A;  5E7D A;  5EM3 A;  5CQ8 A;  5D3T A;  4QUU A;  5C89 A;  4HBW A;  3LXJ A;  3O35 A;  4BW2 A;  4F3I A;  4Q0O A;  5E9V A;  4YBM A;  3U5L A;  5C85 A;  4TT2 A;  3LQH A;  4NR6 A;  4CUQ A;  4O7B A;  4HXP A;  5A5R A;  5FE7 A;  2F6J A;  4QEV A;  4CUU A;  4LR6 A;  5IBN A;  4ZC9 A;  3FKM X;  4PS5 A;  5DKC A;  3QZS A;  5G4R A;  4IOO A;  5L98 A;  3P1E A;  3SVH A;  4Z1S A;  5CZG A;  5D7X A;  5CFW A;  2G4A A;  4O71 A;  2NXB A;  5F1H A;  2R0S A;  3AQA A;  4HXN A;  5DFD A;  5AD2 A;  5I40 A;  4NS5 A;  2F6N A;  2L84 A;  4TTE A;  3LQI A;  4NYV A;  5DFC A;  2DVV A;  3DWY A;  4QZS A;  5EP7 A;  5LJ2 A;  4CFK A;  3O34 A;  5D3N A;  5D3S A;  3P5O A;  3U5K A;  5CPE A;  3U5N A;  4PCI A;  5HQ6 A;  2RS9 B;  4MR5 A;  4IOR A;  5HEN A;  5F2P A;  5EPR A;  5ENI A;  5A83 A;  4Z93 A;  5AMF A;  4QYL A;  4YYI A;  5CP5 A;  4CUR A;  5LKU A;  4UYH A;  2RI7 A;  4IR5 A;  4A9I A;  5CRZ A;  3U5M A;  4NRC A;  4HXK A;  5DKD A;  5E9Y A;  4A9K A;  4Z1Q A;  5LKZ A;  4TZ8 A;  3JVM A;  4BJX A;  1F68 A;  5EK9 A;  4XY9 A;  5ENJ A;  4CLB A;  4YYM A;  5I29 A;  5FH6 A;  4NR9 A;  4HBV A;  5KTW A;  4UYG A;  3MB3 A;  3MQM A;  5L8U A;  5FH7 A;  4NUD A;  5EWD A;  3UV5 A;  4AKN A;  4HXO A;  4PCE A;  2WP1 A;  3P1C A;  2OSS A;  5A81 A;  5F62 A;  3QZV A;  5HCL A;  3NXB A;  4OGI A;  5CUE A;  4BW1 A;  4A9E A;  4A9L A;  5HRX A;  4LC2 A;  5I83 A;  3K2J A;  2I8N A;  2YW5 A;  4C67 A;  5A5O A;  4YYD A;  3UW9 A;  5LKX A;  5JI8 A;  2R0V A;  5HRW A;  4O70 A;  4N3W A;  3MXF A;  3GG3 A;  4ALH A;  1E6I A;  4NUC A;  5DYU A;  4NR5 A;  5BT4 A;  4LYW A;  4QC1 A;  2DKW A;  4QSQ A;  2DWW A;  4C66 A;  4QC3 A;  4QST A;  5EWC A;  5ENG A;  4HXM A;  4QEU A;  1WUM A;  5DW1 A;  5FE6 A;  3IU5 A;  2RFJ A;  2RO1 A;  4QR3 A;  4YY4 A;  4NQN A;  4YYG A;  5L8T A;  4MEN A;  5KO4 A;  3JVL A;  3MB4 A;  1N72 A;  4O74 A;  5FDZ A;  3ZYU A;  3P1D A;  5FBX A;  3U5O A;  4QUT A;  5CUD A;  5E9M A;  4ALG A;  4QNS A;  4UIY A;  5CQ6 A;  2OO1 A;  3LQJ A;  5D24 A;  4YH3 A;  3UV4 A;  4N4I A;  4TZ2 A;  5E73 A;  2GRC A;  4OGJ A;  5ETD A;  5FG6 A;  5EI4 A;  2LSP B;  4TU4 A;  5EWH A;  5FE2 A;  5I89 A;  3G0L A;  4QSU A;  5E0R A;  3O37 A;  5FG4 A;  4PKL A;  3SVG A;  5C8G A;  4A9J A;  4RVR A;  5A5Q A;  5DLZ A;  4YK0 A;  4A9M A;  4QSW A;  5A5N A;  5EQ1 A;  4UIX A;  4NR7 A;  4NRB A;  5D3L A;  5KTU A;  4UIT A;  3D7C A;  5EWW A;  2OUO A;  4O76 A;  5EPS A;  5E9K A;  5ENH A;  5F5Z A;  2L85 A;  4QR4 A;  4YYK A;  5LJ0 A;  5F60 A;  5DY7 A;  5LKT A;  5KTX A;  4QSX A;  5IG6 A;  3O36 A;  4QSR A;  5DBM A;  5FE8 A;  4LRG A;  3ONI A;  4NXJ A;  5FFV A;  4ZQL A;  5DFB A;  4N4H A;  3TLP A;  4QR5 A;  4CUT A;  5H1V A;  4MEP A;  5H1U A;  5II2 A;  5ENE A;  5LVR A;  3JVK A;  3I3J A;  4HXR A;  4MEO A;  4O72 A;  5EV9 A;  5C7N A;  3U5J A;  4KV4 A;  5D25 A;  5DYA A;  4YAD A;  5E9I A;  5J0D A;  3O33 A;  4CUS A;  5A5P A;  5JWM A;  5FFY A;  4HXL A;  4HBX A;  4XUA A;  5D3R A;  5CU8 A;  5IGL A;  5K29 A;  5CQ5 A;  5IGM A;  5A7C A;  5HFR A;  4HBY A;  2E7O A;  5FB0 A;  5E3D A;  5F63 A;  5D3H A;  4OUF A;  4UIZ A;  4TT4 A;  4XY8 A;  2RNY A;  5CY9 A;  2E3K A;  5HLS A;  4X2I A;  4YBS A;  5IGK A;  2D82 A;  4GPJ A;  5CUG A;  3UV2 A;  5D3J A;  5E3G A;  3HMH A;  5G4S A;  4O7C A;  5HFQ A;  4XYA A;  3MUK A;  4PTB A;  5BT5 A;  5CQT A;  3DAI A;  5EIS A;  4QSS A;  4YYN A;  5F3A A;  4YAX A;  4NR8 A;  5I86 A;  4MEQ A;  5FFW A;  3UVY A;  3UVW A;  4N4G A;  4NQM A;  2N9G A;  4UIU A;  4QSV A;  4WIV A;  4QEW A;  4YYH A;  2I7K A;  2KTB B;  3Q2E A;  4J0S A;  5CGP A;  4UYD A;  2WP2 A;  4MR4 A;  4O7F A;  5L96 A;  3SVF A;  5L99 A;  4O78 A;  4J1P A;  5ENF A;  5IGN A;  4LDF A;  4UIW A;  3MUL A;  2YEK A;  5EIC A;  4KCX A;  5IID A;  5EWV A;  5LVQ A;  5I1Q A;  3G0J A;  5HM0 A;  5ENC A;  3Q2F A;  4CL9 A;  4WHU A;  4A9F A;  5COI A;  5FE4 A;  2D9E A;  5FE1 A;  5H85 A;  4BW3 A;  4NRA A;  5C4Q A;  5DYC A;  3UVD A;  4TQN A;  5CUB A;  2E7N A;  5HEL A;  4YAB A;  4J0R A;  5CRM A;  4UIV A;  4Q0N A;  5F61 A;  5EA1 A;  5D26 A;  4LZ2 A;  5F36 A;  4O7E A;  5AME A;  5ENB A;  5EPB A;  4FLP A;  2RNX A;  5H1T A;  3RCW A;  5LJ1 A;  3P1F A;  4LYI A;  5HEM A;  5HRV A;  5FE5 A;  3QZT A;  5CQ3 A;  5ACY A;  2YEL A;  5A85 A;  4O75 A;  4YY6 A;  4MR6 A;  4IR3 A;  1JSP B;  3U5P A;  4IR6 A;  4BW4 A;  4UYE A;  4DON A;  5CTL A;  5A82 A;  4LZS A;  4IOQ A;  3S91 A;  4NUE A;  3JVJ A;  2YYN A;  5DKH A;  5DX4 A;  3S92 A;  5FE0 A;  4QB3 A;  4WHW A;  4YAT A;  5HQ5 A;  5CQ7 A;  5A5S A;  5I7Y A;  2DAT A;  5I88 A;  2R10 A;  5FE9 A;  4CUP A;  5CQ4 A;  4BHW A;  4J3I A;  5ETB A;  4NYX A;  5BT3 A;  5I7X A;  1X0J A;  1ZS5 A;  4YC9 A;  2MJV B;  5FE3 A;  2YDW A;  4QYD A;  3IU6 A;  4UYF A;  4A9H A;  5C87 A;  5E9L A;  5KU3 A;  4TYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...