5EM3A

Crystal structure of the human brpf1 bromodomain in complex with seed9
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
SMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 43
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5em3A00
5ENIA 4NYXA 5II1A 3G0LA 3UV2A 3MB4A 4WIVA 4PCEA 3ONIA 4TT2A 3UV5A 5TB6A 2L84A 5CQ8A 4LDFA 2RNWA 3MB3A 3DAIA 4A9IA 2OUOA 4XYAA 2OO1A 4QR4A 4F3IA 3SVGA 5EWDA 4O7EA 5IGNA 4IORA 3UVDA 4A9NA 5DLXA 3O35A 4YBTA 4LRGA 4AKNA 1JSPB 2YEKA 5CUGA 5FH8A 5ENFA 4YK0A 3QZSA 3D7CA 4NXJA 5CU8A 3O34A 5ENHA 4YC9A 5DW2A 2YW5A 4MEPA 4QSUA 5KHMA 4NUDA 3MXFA 2YEMA 4QR3A 4WHUA 5HELA 5AD3A 4HXNA 4UIYA 5FDZA 5DYUA 4C67A 4YH3A 5D25A 1JM4B 5EM3A 5CPEA 5CRZA 4HBYA 1E6IA 5H1UA 4O7CA 4KCXA 4Z93A 4QSXA 4QSSA 2L5EA 5HM0A 5HRXA 4Z1QA 3SVFA 5IGLA 2F6JA 5C8GA 4CUQA 5FFWA 3O36A 5F60A 5CQ7A 5HFQA 4BW3A 4YYNA 4YYIA 3HMEA 5FG6A 2NXBA 5EQ1A 4HXPA 4WHWA 5D7XA 5DLZA 4NR4A 4BW1A 5CUBA 5FH6A 5H1TA 3JVMA 4NUCA 4A9KA 4LYWA 3P1DA 5HRVA 5LVRA 4MR3A 2RI7A 5BT3A 5EWCA 5CUDA 5CZGA 5I29A 4QEWA 5HJCA 5DKHA 3O33A 4NR7A 4TZ2A 4UYEA 5ETBA 5HFRA 4NRBA 3AADA 4LZRA 4QR5A 4LC2A 5A7CA 5EK9A 4LR6A 4YADA 4IR6A 4QSRA 3Q2EA 2DWWA 5E9MA 4BHWA 5HEMA 5L8TA 3TLPA 4FLPA 5E9YA 4RVRA 5HQ6A 2RNYA 5FH7A 5FE2A 5II2A 4OUFA 3O37A 3UVYA 4A9OA 4O7FA 5D3NA 4QSVA 4HBXA 5CFWA 5F62A 5DFBA 5E74A 3K2JA 5EGUA 2YQDA 4QSQA 5EPBA 4YABA 5EISA 3U5NA 4PKLA 5IGKA 4PY6A 3U5PA 4TT6A 5I86A 4YY4A 4XY9A 4A9HA 4YH4A 4UYFA 4QNSA 5DY7A 5F63A 4HXLA 4O72A 5F2PA 5HRWA 5DYCA 2E7OA 5H1VA 4O78A 4O75A 5I80A 4CFLA 4ZQLA 4CUPA 4E96A 2G4AA 5EP7A 3MUKA 4TZ8A 5A5PA 3P1CA 5CQAA 5IGMA 4O74A 5FE1A 4QYLA 4HXOA 5CQTA 5BT4A 3HMHA 2DVSA 5A83A 4Z6HA 5CTLA 5D26A 4YY6A 3RCWA 2E3KA 5A81A 4HBVA 5FG4A 5LVQA 4N4HA 5FE8A 2WP1A 5EPRA 3G0JA 5CGPA 5C85A 5J0DA 4HXSA 4QC1A 5DFCA 4YBMA 4NRAA 5D3HA 5FFVA 5ENJA 4IOOA 5CUCA 5FE9A 4KV4A 5FFYA 5A5NA 4HBWA 4LYSA 5E73A 5EICA 3SVHA 3U5OA 4XUAA 2R0SA 3U5KA 5LKZA 5D0CA 4O7BA 4Q0OA 2MJVB 5FE7A 2L85A 4TYLA 5I40A 5ACYA 4Z1SA 5D3JA 4NYWA 5CUAA 4QUUA 5L98A 5HENA 5DFDA 5F61A 2FSAA 5H85A 5JWMA 3DWYA 4YYGA 5DW1A 3HMFA 5EI4A 5A5RA 5DKDA 4NR9A 5LJ2A 2YYNA 5AMFA 5EU1A 2YELA 4O76A 3NXBA 4HXMA 5IG6A 5E9LA 4Z6IA 4CUTA 3P1EA 2KTBB 5A5QA 4QYDA 5L97A 5IIDA 4YAXA 4UYGA 5EWVA 5ENBA 5E9IA 5COIA 2OSSA 5F36A 4QEUA 4BW4A 4UIWA 3P5OA 3MQMA 5ETDA 3GG3A 4QB3A 3ZYUA 5KO4A 4IR5A 5CP5A 5LKTA 5D3LA 3S92A 5DYXA 4YYKA 5CQ4A 4YYJA 5F1HA 5HCLA 5E0RA 5EPSA 4QY4A 1X0JA 3LQIA 4HXKA 4IR4A 5DBMA 4O7AA 3S91A 5EV9A 4KV1A 3IU6A 1F68A 5F5ZA 5F3AA 2I7KA 3LJWA 4XUBA 5FE0A 5CQ6A 4J1PA 4J0SA 4N3WA 2DVQA 4NRCA 2R0VA 4A9EA 3AQAA 3LQHA 2DATA 4ZW1A 5L96A 2I8NA 2YDWA 4QUTA 4LZSA 2N9GA 5I83A 5AD2A 5KTXA 4YATA 5L8UA 3JVKA 5HQ7A 4YYMA 2DVVA 4UIXA 4ZC9A 5ENCA 4PCIA 4NQMA 4MR5A 4IR3A 4J3IA 5C4QA 4YBSA 1ZS5A 3I3JA 5C87A 5CY9A 2R0YA 4MR4A 4LZ2A 5F1LA 5LJ0A 5FE4A 4CFKA 4UIVA 5A5SA 5E7DA 3U5MA 2DKWA 4O77A 4CLBA 5I1QA 3QZTA 5G4RA 4OGJA 4NS5A 4NUEA 3LXJA 3Q2FA 5EWWA 4BJXA 4HXRA 5CS8A 5EVAA 5FBXA 5FG5A 5F25A 3UVWA 4N4FA 4IOQA 3FKMX 5E9VA 4Q0NA 5IBNA 2LSPB 5LKXA 5BT5A 2WP2A 4NYVA 5A5OA 5FB0A 4NR8A 5D3SA 3MULA 4TS8A 4PTBA 2D82A 5DX4A 2RNXA 4N4IA 4YYDA 4GPJA 5D3TA 4A9JA 5A82A 3UVXA 5AMEA 5KTUA 5D24A 5LUUA 4QSWA 5KTWA 4O70A 4CUSA 4CUUA 4QSTA 5CUEA 1EQFA 2GRCA 2R10A 4QSPA 5FE6A 4UIUA 5HQ5A 3UV4A 5HLSA 4A9LA 4MEOA 4QEVA 4UIZA 5I7XA 4CURA 4XY8A 3LQJA 5CRMA 4C66A 4TTEA 5I88A 4TT4A 2E7NA 4BW2A 5FE3A 2D9EA 5JI8A 3IU5A 3U5JA 5L99A 5C89A 4X2IA 4MR6A 3P1FA 5D3RA 4QBMA 4UYHA 5KU3A 4OGIA 5TCMA 2RFJA 4TU4A 5DKCA 5LKUA 5I89A 3U5LA 3QZVA 5E9KA 4A9MA 4NQNA 4MEQA 2DVRA 4MENA 5CQ5A 4NR6A 5FB1A 5G4SA 3UW9A 4QC3A 5A85A 4UITA 5CQ3A 2RS9B 5FE5A 5D3PA 4CL9A 4A9FA 5I7YA 1N72A 5K29A 4N4GA 5E3GA 2F6NA 5E3DA 4TQNA 4Y03A 4ALHA 4LYIA 4O71A 3JVJA 5C7NA 5LJ1A 2RO1A 1WUGA 4ALGA 1WUMA 4YYHA 5DYAA 4PS5A 4QZSA 4TU6A 4NR5A 5ENGA 5EA1A 3JVLA 5ENEA 4DONA 2H60A 5EWHA 4UYDA 4UYFB 4J0RA
chains in the Genus database with same CATH superfamily
5ENIA 4NYXA 5II1A 3VKGA 3G0LA 3UV2A 3MB4A 4WIVA 4PCEA 4TT2A 3UV5A 5TB6A 2L84A 5CQ8A 4LDFA 2RNWA 3MB3A 3DAIA 4A9IA 2OUOA 4XYAA 2OO1A 4QR4A 4F3IA 3SVGA 5EWDA 4O7EA 5IGNA 4IORA 3UVDA 4A9NA 5DLXA 3O35A 4YBTA 4LRGA 4AKNA 1JSPB 2YEKA 5CUGA 5FH8A 5ENFA 4YK0A 3QZSA 3D7CA 4NXJA 5CU8A 3O34A 5ENHA 4YC9A 5DW2A 2YW5A 4MEPA 4QSUA 5KHMA 4NUDA 3MXFA 2YEMA 4QR3A 4WHUA 5HELA 5AD3A 4HXNA 4UIYA 5FDZA 5DYUA 4C67A 4YH3A 5D25A 1JM4B 5EM3A 5CPEA 5CRZA 4HBYA 1E6IA 5H1UA 4O7CA 4KCXA 4Z93A 4QSXA 4QSSA 2L5EA 5HM0A 5HRXA 4Z1QA 3SVFA 5IGLA 2F6JA 5C8GA 4CUQA 5FFWA 3O36A 5F60A 5CQ7A 5HFQA 4BW3A 4YYNA 4YYIA 3HMEA 5FG6A 2NXBA 5EQ1A 4HXPA 4WHWA 5D7XA 5DLZA 4AI6A 4NR4A 4BW1A 5CUBA 5FH6A 5H1TA 3JVMA 4NUCA 4A9KA 4LYWA 3P1DA 5HRVA 5LVRA 4MR3A 2RI7A 5BT3A 5EWCA 5CUDA 5CZGA 5I29A 4QEWA 5HJCA 5DKHA 3O33A 4NR7A 4TZ2A 4UYEA 5ETBA 5HFRA 4NRBA 3AADA 4LZRA 4QR5A 4LC2A 5A7CA 5EK9A 4LR6A 4YADA 4IR6A 4QSRA 3Q2EA 2DWWA 5E9MA 4BHWA 5HEMA 5L8TA 3TLPA 4FLPA 5E9YA 4RVRA 5HQ6A 2RNYA 5FH7A 5FE2A 5II2A 4OUFA 3O37A 3UVYA 4A9OA 4O7FA 5D3NA 4QSVA 4HBXA 5CFWA 5F62A 5DFBA 5E74A 3K2JA 5EGUA 2YQDA 4QSQA 5EPBA 4YABA 5EISA 3U5NA 4PKLA 5IGKA 4PY6A 3U5PA 4TT6A 5I86A 4YY4A 4XY9A 4A9HA 4YH4A 4UYFA 4QNSA 4AKIA 5DY7A 5F63A 4HXLA 4O72A 5F2PA 5HRWA 5DYCA 2E7OA 5H1VA 4O78A 4O75A 5I80A 4CFLA 4ZQLA 4CUPA 4E96A 2G4AA 5EP7A 3MUKA 4TZ8A 5A5PA 3P1CA 5CQAA 5IGMA 4O74A 5FE1A 4QYLA 4HXOA 5CQTA 5BT4A 3HMHA 2DVSA 5A83A 4Z6HA 5CTLA 5D26A 4YY6A 3RCWA 2E3KA 5A81A 4HBVA 5FG4A 5LVQA 4N4HA 5FE8A 2WP1A 5EPRA 3G0JA 5CGPA 5C85A 5J0DA 4HXSA 4QC1A 5DFCA 4YBMA 1ZKRA 4NRAA 5D3HA 5FFVA 5ENJA 4IOOA 5CUCA 5FE9A 4KV4A 5FFYA 5A5NA 4HBWA 4LYSA 5E73A 5EICA 3SVHA 3U5OA 4XUAA 2R0SA 3U5KA 5LKZA 5D0CA 4O7BA 4Q0OA 2MJVB 5FE7A 2L85A 3D1DA 4TYLA 5I40A 5ACYA 4Z1SA 5D3JA 4NYWA 5CUAA 4QUUA 5L98A 5HENA 5DFDA 5F61A 2FSAA 5H85A 5JWMA 3DWYA 4YYGA 5DW1A 3HMFA 5EI4A 5A5RA 5DKDA 4NR9A 5LJ2A 2YYNA 5AMFA 5EU1A 2YELA 4O76A 3VKHA 2EJNA 3NXBA 4HXMA 5IG6A 5E9LA 4Z6IA 4AKGA 4CUTA 3P1EA 2KTBB 5A5QA 4QYDA 5L97A 5IIDA 4YAXA 4UYGA 5EWVA 5ENBA 5E9IA 5COIA 2OSSA 5F36A 4QEUA 4BW4A 4UIWA 3P5OA 3MQMA 5ETDA 3GG3A 4QB3A 3ZYUA 5KO4A 4IR5A 5CP5A 5LKTA 5D3LA 3S92A 5DYXA 4YYKA 5CQ4A 4YYJA 5F1HA 5HCLA 5E0RA 5EPSA 4QY4A 1X0JA 3LQIA 4HXKA 4IR4A 5DBMA 4O7AA 3S91A 5EV9A 4KV1A 3IU6A 1F68A 5F5ZA 5F3AA 2I7KA 3LJWA 4XUBA 5FE0A 5CQ6A 4J1PA 4J0SA 4N3WA 2DVQA 4NRCA 2R0VA 4A9EA 3AQAA 3LQHA 2DATA 4ZW1A 5L96A 2I8NA 2YDWA 4QUTA 4LZSA 2N9GA 5I83A 5AD2A 5KTXA 4YATA 5L8UA 3JVKA 5HQ7A 4YYMA 2DVVA 4UIXA 4ZC9A 5ENCA 4PCIA 4UYFB 4NQMA 4MR5A 4IR3A 4J3IA 5C4QA 4YBSA 1ZS5A 3I3JA 5C87A 5CY9A 2R0YA 4MR4A 4LZ2A 5F1LA 5LJ0A 5FE4A 4CFKA 4UIVA 5A5SA 5E7DA 3U5MA 2DKWA 4O77A 4CLBA 5I1QA 3QZTA 5G4RA 4OGJA 4NS5A 4NUEA 3LXJA 3Q2FA 5EWWA 4BJXA 4HXRA 5CS8A 5EVAA 5FBXA 5FG5A 5F25A 3UVWA 4N4FA 4IOQA 1PUOA 3FKMX 5E9VA 4Q0NA 5IBNA 2LSPB 5LKXA 5BT5A 2WP2A 4NYVA 5A5OA 5FB0A 4NR8A 5D3SA 3MULA 4TS8A 4PTBA 2D82A 5DX4A 2RNXA 4N4IA 4YYDA 4GPJA 5D3TA 4A9JA 5A82A 3UVXA 5AMEA 5KTUA 5D24A 5LUUA 3ERRA 4QSWA 5KTWA 4O70A 4CUSA 4CUUA 4QSTA 5CUEA 1EQFA 2GRCA 2R10A 4QSPA 5FE6A 4UIUA 5HQ5A 3UV4A 5HLSA 4A9LA 4MEOA 4QEVA 4UIZA 5I7XA 4CURA 3D1BA 4XY8A 3LQJA 5CRMA 4C66A 4TTEA 5I88A 4TT4A 2E7NA 4BW2A 5FE3A 2D9EA 5JI8A 3IU5A 3U5JA 5L99A 5C89A 4X2IA 4MR6A 3P1FA 5D3RA 4QBMA 4UYHA 5KU3A 4OGIA 5TCMA 2RFJA 4TU4A 5DKCA 5LKUA 5I89A 3U5LA 3QZVA 5E9KA 4A9MA 4NQNA 4MEQA 2DVRA 4MENA 5CQ5A 4NR6A 5FB1A 5G4SA 3UW9A 4QC3A 5A85A 4UITA 5CQ3A 2RS9B 5FE5A 5D3PA 4CL9A 4A9FA 5I7YA 1N72A 5K29A 4N4GA 5E3GA 2F6NA 5E3DA 4TQNA 4Y03A 4ALHA 4LYIA 4O71A 3JVJA 5C7NA 5LJ1A 4AKHA 2RO1A 1WUGA 4ALGA 1WUMA 4YYHA 5DYAA 4PS5A 4QZSA 4TU6A 4NR5A 5ENGA 5EA1A 3JVLA 5ENEA 4DONA 2H60A 5EWHA 4UYDA 3ONIA 4J0RA
chains in the Genus database with same CATH topology
5ENIA 4NYXA 5II1A 3G0LA 3UV2A 3MB4A 4WIVA 4PCEA 3ONIA 4TT2A 3UV5A 5TB6A 2L84A 5CQ8A 4LDFA 2RNWA 3MB3A 3DAIA 4A9IA 2OUOA 4XYAA 2OO1A 4QR4A 4F3IA 3SVGA 5EWDA 4O7EA 5IGNA 4IORA 3UVDA 4A9NA 5DLXA 3O35A 4YBTA 4LRGA 4AKNA 1JSPB 2YEKA 5CUGA 5FH8A 5ENFA 4YK0A 3QZSA 3D7CA 4NXJA 5CU8A 3O34A 5ENHA 4YC9A 5DW2A 2YW5A 4MEPA 4QSUA 5KHMA 4NUDA 3MXFA 2YEMA 4QR3A 4WHUA 5HELA 5AD3A 4HXNA 4UIYA 5FDZA 5DYUA 4C67A 4YH3A 5D25A 1JM4B 5EM3A 5CPEA 5CRZA 4HBYA 1E6IA 5H1UA 4O7CA 4KCXA 4Z93A 4QSXA 4QSSA 2L5EA 5HM0A 5HRXA 4Z1QA 3SVFA 5IGLA 2F6JA 5C8GA 4CUQA 5FFWA 3O36A 5F60A 5CQ7A 5HFQA 4BW3A 4YYNA 4YYIA 3HMEA 5FG6A 2NXBA 5EQ1A 4HXPA 4WHWA 5D7XA 5DLZA 4NR4A 4BW1A 5CUBA 5FH6A 5H1TA 3JVMA 4NUCA 4A9KA 4LYWA 3P1DA 5HRVA 5LVRA 4MR3A 2RI7A 5BT3A 5EWCA 5CUDA 5CZGA 5I29A 4QEWA 5HJCA 5DKHA 3O33A 4NR7A 4TZ2A 4UYEA 5ETBA 5HFRA 4NRBA 3AADA 4LZRA 4QR5A 4LC2A 5A7CA 5EK9A 4LR6A 4YADA 4IR6A 4QSRA 3Q2EA 2DWWA 5E9MA 4BHWA 5HEMA 5L8TA 3TLPA 4FLPA 5E9YA 4RVRA 5HQ6A 2RNYA 5FH7A 5FE2A 5II2A 4OUFA 3O37A 3UVYA 4A9OA 4O7FA 5D3NA 4QSVA 4HBXA 5CFWA 5F62A 5DFBA 5E74A 3K2JA 5EGUA 2YQDA 4QSQA 5EPBA 4YABA 5EISA 3U5NA 4PKLA 5IGKA 4PY6A 3U5PA 4TT6A 5I86A 4YY4A 4XY9A 4A9HA 4YH4A 4UYFA 4QNSA 5DY7A 5F63A 4HXLA 4O72A 5F2PA 5HRWA 5DYCA 2E7OA 5H1VA 4O78A 4O75A 5I80A 4CFLA 4ZQLA 4CUPA 4E96A 2G4AA 5EP7A 3MUKA 4TZ8A 5A5PA 3P1CA 5CQAA 5IGMA 4O74A 5FE1A 4QYLA 4HXOA 5CQTA 5BT4A 3HMHA 2DVSA 5A83A 4Z6HA 5CTLA 5D26A 4YY6A 3RCWA 2E3KA 5A81A 4HBVA 5FG4A 5LVQA 4N4HA 5FE8A 2WP1A 5EPRA 3G0JA 5CGPA 5C85A 5J0DA 4HXSA 4QC1A 5DFCA 4YBMA 4NRAA 5D3HA 5FFVA 5ENJA 4IOOA 5CUCA 5FE9A 4KV4A 5FFYA 5A5NA 4HBWA 4LYSA 5E73A 5EICA 3SVHA 3U5OA 4XUAA 2R0SA 3U5KA 5LKZA 5D0CA 4O7BA 4Q0OA 2MJVB 5FE7A 2L85A 4TYLA 5I40A 5ACYA 4Z1SA 5D3JA 4NYWA 5CUAA 4QUUA 5L98A 5HENA 5DFDA 5F61A 2FSAA 5H85A 5JWMA 3DWYA 4YYGA 5DW1A 3HMFA 5EI4A 5A5RA 5DKDA 4NR9A 5LJ2A 2YYNA 5AMFA 5EU1A 2YELA 4O76A 3NXBA 4HXMA 5IG6A 5E9LA 4Z6IA 4CUTA 3P1EA 2KTBB 5A5QA 4QYDA 5L97A 5IIDA 4YAXA 4UYGA 5EWVA 5ENBA 5E9IA 5COIA 2OSSA 5F36A 4QEUA 4BW4A 4UIWA 3P5OA 3MQMA 5ETDA 3GG3A 4QB3A 3ZYUA 5KO4A 4IR5A 5CP5A 5LKTA 5D3LA 3S92A 5DYXA 4YYKA 5CQ4A 4YYJA 5F1HA 5HCLA 5E0RA 5EPSA 4QY4A 1X0JA 3LQIA 4HXKA 4IR4A 5DBMA 4O7AA 3S91A 5EV9A 4KV1A 3IU6A 1F68A 5F5ZA 5F3AA 2I7KA 3LJWA 4XUBA 5FE0A 5CQ6A 4J1PA 4J0SA 4N3WA 2DVQA 4NRCA 2R0VA 4A9EA 3AQAA 3LQHA 2DATA 4ZW1A 5L96A 2I8NA 2YDWA 4QUTA 4LZSA 2N9GA 5I83A 5AD2A 5KTXA 4YATA 5L8UA 3JVKA 5HQ7A 4YYMA 2DVVA 4UIXA 4ZC9A 5ENCA 4PCIA 4NQMA 4MR5A 4IR3A 4J3IA 5C4QA 4YBSA 1ZS5A 3I3JA 5C87A 5CY9A 2R0YA 4MR4A 4LZ2A 5F1LA 5LJ0A 5FE4A 4CFKA 4UIVA 5A5SA 5E7DA 3U5MA 2DKWA 4O77A 4CLBA 5I1QA 3QZTA 5G4RA 4OGJA 4NS5A 4NUEA 3LXJA 3Q2FA 5EWWA 4BJXA 4HXRA 5CS8A 5EVAA 5FBXA 5FG5A 5F25A 3UVWA 4N4FA 4IOQA 3FKMX 5E9VA 4Q0NA 5IBNA 2LSPB 5LKXA 5BT5A 2WP2A 4NYVA 5A5OA 5FB0A 4NR8A 5D3SA 3MULA 4TS8A 4PTBA 2D82A 5DX4A 2RNXA 4N4IA 4YYDA 4GPJA 5D3TA 4A9JA 5A82A 3UVXA 5AMEA 5KTUA 5D24A 5LUUA 4QSWA 5KTWA 4O70A 4CUSA 4CUUA 4QSTA 5CUEA 1EQFA 2GRCA 2R10A 4QSPA 5FE6A 4UIUA 5HQ5A 3UV4A 5HLSA 4A9LA 4MEOA 4QEVA 4UIZA 5I7XA 4CURA 4XY8A 3LQJA 5CRMA 4C66A 4TTEA 5I88A 4TT4A 2E7NA 4BW2A 5FE3A 2D9EA 5JI8A 3IU5A 3U5JA 5L99A 5C89A 4X2IA 4MR6A 3P1FA 5D3RA 4QBMA 4UYHA 5KU3A 4OGIA 5TCMA 2RFJA 4TU4A 5DKCA 5LKUA 5I89A 3U5LA 3QZVA 5E9KA 4A9MA 4NQNA 4MEQA 2DVRA 4MENA 5CQ5A 4NR6A 5FB1A 5G4SA 3UW9A 4QC3A 5A85A 4UITA 5CQ3A 2RS9B 5FE5A 5D3PA 4CL9A 4A9FA 5I7YA 1N72A 5K29A 4N4GA 5E3GA 2F6NA 5E3DA 4TQNA 4Y03A 4ALHA 4LYIA 4O71A 3JVJA 5C7NA 5LJ1A 2RO1A 1WUGA 4ALGA 1WUMA 4YYHA 5DYAA 4PS5A 4QZSA 4TU6A 4NR5A 5ENGA 5EA1A 3JVLA 5ENEA 4DONA 2H60A 5EWHA 4UYDA 4UYFB 4J0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENI A;  4NYX A;  5II1 A;  3G0L A;  3UV2 A;  3MB4 A;  4WIV A;  4PCE A;  3ONI A;  4TT2 A;  3UV5 A;  5TB6 A;  2L84 A;  5CQ8 A;  4LDF A;  2RNW A;  3MB3 A;  3DAI A;  4A9I A;  2OUO A;  4XYA A;  2OO1 A;  4QR4 A;  4F3I A;  3SVG A;  5EWD A;  4O7E A;  5IGN A;  4IOR A;  3UVD A;  4A9N A;  5DLX A;  3O35 A;  4YBT A;  4LRG A;  4AKN A;  1JSP B;  2YEK A;  5CUG A;  5FH8 A;  5ENF A;  4YK0 A;  3QZS A;  3D7C A;  4NXJ A;  5CU8 A;  3O34 A;  5ENH A;  4YC9 A;  5DW2 A;  2YW5 A;  4MEP A;  4QSU A;  5KHM A;  4NUD A;  3MXF A;  2YEM A;  4QR3 A;  4WHU A;  5HEL A;  5AD3 A;  4HXN A;  4UIY A;  5FDZ A;  5DYU A;  4C67 A;  4YH3 A;  5D25 A;  1JM4 B;  5EM3 A;  5CPE A;  5CRZ A;  4HBY A;  1E6I A;  5H1U A;  4O7C A;  4KCX A;  4Z93 A;  4QSX A;  4QSS A;  2L5E A;  5HM0 A;  5HRX A;  4Z1Q A;  3SVF A;  5IGL A;  2F6J A;  5C8G A;  4CUQ A;  5FFW A;  3O36 A;  5F60 A;  5CQ7 A;  5HFQ A;  4BW3 A;  4YYN A;  4YYI A;  3HME A;  5FG6 A;  2NXB A;  5EQ1 A;  4HXP A;  4WHW A;  5D7X A;  5DLZ A;  4NR4 A;  4BW1 A;  5CUB A;  5FH6 A;  5H1T A;  3JVM A;  4NUC A;  4A9K A;  4LYW A;  3P1D A;  5HRV A;  5LVR A;  4MR3 A;  2RI7 A;  5BT3 A;  5EWC A;  5CUD A;  5CZG A;  5I29 A;  4QEW A;  5HJC A;  5DKH A;  3O33 A;  4NR7 A;  4TZ2 A;  4UYE A;  5ETB A;  5HFR A;  4NRB A;  3AAD A;  4LZR A;  4QR5 A;  4LC2 A;  5A7C A;  5EK9 A;  4LR6 A;  4YAD A;  4IR6 A;  4QSR A;  3Q2E A;  2DWW A;  5E9M A;  4BHW A;  5HEM A;  5L8T A;  3TLP A;  4FLP A;  5E9Y A;  4RVR A;  5HQ6 A;  2RNY A;  5FH7 A;  5FE2 A;  5II2 A;  4OUF A;  3O37 A;  3UVY A;  4A9O A;  4O7F A;  5D3N A;  4QSV A;  4HBX A;  5CFW A;  5F62 A;  5DFB A;  5E74 A;  3K2J A;  5EGU A;  2YQD A;  4QSQ A;  5EPB A;  4YAB A;  5EIS A;  3U5N A;  4PKL A;  5IGK A;  4PY6 A;  3U5P A;  4TT6 A;  5I86 A;  4YY4 A;  4XY9 A;  4A9H A;  4YH4 A;  4UYF A;  4QNS A;  5DY7 A;  5F63 A;  4HXL A;  4O72 A;  5F2P A;  5HRW A;  5DYC A;  2E7O A;  5H1V A;  4O78 A;  4O75 A;  5I80 A;  4CFL A;  4ZQL A;  4CUP A;  4E96 A;  2G4A A;  5EP7 A;  3MUK A;  4TZ8 A;  5A5P A;  3P1C A;  5CQA A;  5IGM A;  4O74 A;  5FE1 A;  4QYL A;  4HXO A;  5CQT A;  5BT4 A;  3HMH A;  2DVS A;  5A83 A;  4Z6H A;  5CTL A;  5D26 A;  4YY6 A;  3RCW A;  2E3K A;  5A81 A;  4HBV A;  5FG4 A;  5LVQ A;  4N4H A;  5FE8 A;  2WP1 A;  5EPR A;  3G0J A;  5CGP A;  5C85 A;  5J0D A;  4HXS A;  4QC1 A;  5DFC A;  4YBM A;  4NRA A;  5D3H A;  5FFV A;  5ENJ A;  4IOO A;  5CUC A;  5FE9 A;  4KV4 A;  5FFY A;  5A5N A;  4HBW A;  4LYS A;  5E73 A;  5EIC A;  3SVH A;  3U5O A;  4XUA A;  2R0S A;  3U5K A;  5LKZ A;  5D0C A;  4O7B A;  4Q0O A;  2MJV B;  5FE7 A;  2L85 A;  4TYL A;  5I40 A;  5ACY A;  4Z1S A;  5D3J A;  4NYW A;  5CUA A;  4QUU A;  5L98 A;  5HEN A;  5DFD A;  5F61 A;  2FSA A;  5H85 A;  5JWM A;  3DWY A;  4YYG A;  5DW1 A;  3HMF A;  5EI4 A;  5A5R A;  5DKD A;  4NR9 A;  5LJ2 A;  2YYN A;  5AMF A;  5EU1 A;  2YEL A;  4O76 A;  3NXB A;  4HXM A;  5IG6 A;  5E9L A;  4Z6I A;  4CUT A;  3P1E A;  2KTB B;  5A5Q A;  4QYD A;  5L97 A;  5IID A;  4YAX A;  4UYG A;  5EWV A;  5ENB A;  5E9I A;  5COI A;  2OSS A;  5F36 A;  4QEU A;  4BW4 A;  4UIW A;  3P5O A;  3MQM A;  5ETD A;  3GG3 A;  4QB3 A;  3ZYU A;  5KO4 A;  4IR5 A;  5CP5 A;  5LKT A;  5D3L A;  3S92 A;  5DYX A;  4YYK A;  5CQ4 A;  4YYJ A;  5F1H A;  5HCL A;  5E0R A;  5EPS A;  4QY4 A;  1X0J A;  3LQI A;  4HXK A;  4IR4 A;  5DBM A;  4O7A A;  3S91 A;  5EV9 A;  4KV1 A;  3IU6 A;  1F68 A;  5F5Z A;  5F3A A;  2I7K A;  3LJW A;  4XUB A;  5FE0 A;  5CQ6 A;  4J1P A;  4J0S A;  4N3W A;  2DVQ A;  4NRC A;  2R0V A;  4A9E A;  3AQA A;  3LQH A;  2DAT A;  4ZW1 A;  5L96 A;  2I8N A;  2YDW A;  4QUT A;  4LZS A;  2N9G A;  5I83 A;  5AD2 A;  5KTX A;  4YAT A;  5L8U A;  3JVK A;  5HQ7 A;  4YYM A;  2DVV A;  4UIX A;  4ZC9 A;  5ENC A;  4PCI A;  4NQM A;  4MR5 A;  4IR3 A;  4J3I A;  5C4Q A;  4YBS A;  1ZS5 A;  3I3J A;  5C87 A;  5CY9 A;  2R0Y A;  4MR4 A;  4LZ2 A;  5F1L A;  5LJ0 A;  5FE4 A;  4CFK A;  4UIV A;  5A5S A;  5E7D A;  3U5M A;  2DKW A;  4O77 A;  4CLB A;  5I1Q A;  3QZT A;  5G4R A;  4OGJ A;  4NS5 A;  4NUE A;  3LXJ A;  3Q2F A;  5EWW A;  4BJX A;  4HXR A;  5CS8 A;  5EVA A;  5FBX A;  5FG5 A;  5F25 A;  3UVW A;  4N4F A;  4IOQ A;  3FKM X;  5E9V A;  4Q0N A;  5IBN A;  2LSP B;  5LKX A;  5BT5 A;  2WP2 A;  4NYV A;  5A5O A;  5FB0 A;  4NR8 A;  5D3S A;  3MUL A;  4TS8 A;  4PTB A;  2D82 A;  5DX4 A;  2RNX A;  4N4I A;  4YYD A;  4GPJ A;  5D3T A;  4A9J A;  5A82 A;  3UVX A;  5AME A;  5KTU A;  5D24 A;  5LUU A;  4QSW A;  5KTW A;  4O70 A;  4CUS A;  4CUU A;  4QST A;  5CUE A;  1EQF A;  2GRC A;  2R10 A;  4QSP A;  5FE6 A;  4UIU A;  5HQ5 A;  3UV4 A;  5HLS A;  4A9L A;  4MEO A;  4QEV A;  4UIZ A;  5I7X A;  4CUR A;  4XY8 A;  3LQJ A;  5CRM A;  4C66 A;  4TTE A;  5I88 A;  4TT4 A;  2E7N A;  4BW2 A;  5FE3 A;  2D9E A;  5JI8 A;  3IU5 A;  3U5J A;  5L99 A;  5C89 A;  4X2I A;  4MR6 A;  3P1F A;  5D3R A;  4QBM A;  4UYH A;  5KU3 A;  4OGI A;  5TCM A;  2RFJ A;  4TU4 A;  5DKC A;  5LKU A;  5I89 A;  3U5L A;  3QZV A;  5E9K A;  4A9M A;  4NQN A;  4MEQ A;  2DVR A;  4MEN A;  5CQ5 A;  4NR6 A;  5FB1 A;  5G4S A;  3UW9 A;  4QC3 A;  5A85 A;  4UIT A;  5CQ3 A;  2RS9 B;  5FE5 A;  5D3P A;  4CL9 A;  4A9F A;  5I7Y A;  1N72 A;  5K29 A;  4N4G A;  5E3G A;  2F6N A;  5E3D A;  4TQN A;  4Y03 A;  4ALH A;  4LYI A;  4O71 A;  3JVJ A;  5C7N A;  5LJ1 A;  2RO1 A;  1WUG A;  4ALG A;  1WUM A;  4YYH A;  5DYA A;  4PS5 A;  4QZS A;  4TU6 A;  4NR5 A;  5ENG A;  5EA1 A;  3JVL A;  5ENE A;  4DON A;  2H60 A;  5EWH A;  4UYD A;  4UYF B;  4J0R A; 
#chains in the Genus database with same CATH topology
 5ENI A;  4NYX A;  5II1 A;  3VKG A;  3G0L A;  3UV2 A;  3MB4 A;  4WIV A;  4PCE A;  4TT2 A;  3UV5 A;  5TB6 A;  2L84 A;  5CQ8 A;  4LDF A;  2RNW A;  3MB3 A;  3DAI A;  4A9I A;  2OUO A;  4XYA A;  2OO1 A;  4QR4 A;  4F3I A;  3SVG A;  5EWD A;  4O7E A;  5IGN A;  4IOR A;  3UVD A;  4A9N A;  5DLX A;  3O35 A;  4YBT A;  4LRG A;  4AKN A;  1JSP B;  2YEK A;  5CUG A;  5FH8 A;  5ENF A;  4YK0 A;  3QZS A;  3D7C A;  4NXJ A;  5CU8 A;  3O34 A;  5ENH A;  4YC9 A;  5DW2 A;  2YW5 A;  4MEP A;  4QSU A;  5KHM A;  4NUD A;  3MXF A;  2YEM A;  4QR3 A;  4WHU A;  5HEL A;  5AD3 A;  4HXN A;  4UIY A;  5FDZ A;  5DYU A;  4C67 A;  4YH3 A;  5D25 A;  1JM4 B;  5EM3 A;  5CPE A;  5CRZ A;  4HBY A;  1E6I A;  5H1U A;  4O7C A;  4KCX A;  4Z93 A;  4QSX A;  4QSS A;  2L5E A;  5HM0 A;  5HRX A;  4Z1Q A;  3SVF A;  5IGL A;  2F6J A;  5C8G A;  4CUQ A;  5FFW A;  3O36 A;  5F60 A;  5CQ7 A;  5HFQ A;  4BW3 A;  4YYN A;  4YYI A;  3HME A;  5FG6 A;  2NXB A;  5EQ1 A;  4HXP A;  4WHW A;  5D7X A;  5DLZ A;  4AI6 A;  4NR4 A;  4BW1 A;  5CUB A;  5FH6 A;  5H1T A;  3JVM A;  4NUC A;  4A9K A;  4LYW A;  3P1D A;  5HRV A;  5LVR A;  4MR3 A;  2RI7 A;  5BT3 A;  5EWC A;  5CUD A;  5CZG A;  5I29 A;  4QEW A;  5HJC A;  5DKH A;  3O33 A;  4NR7 A;  4TZ2 A;  4UYE A;  5ETB A;  5HFR A;  4NRB A;  3AAD A;  4LZR A;  4QR5 A;  4LC2 A;  5A7C A;  5EK9 A;  4LR6 A;  4YAD A;  4IR6 A;  4QSR A;  3Q2E A;  2DWW A;  5E9M A;  4BHW A;  5HEM A;  5L8T A;  3TLP A;  4FLP A;  5E9Y A;  4RVR A;  5HQ6 A;  2RNY A;  5FH7 A;  5FE2 A;  5II2 A;  4OUF A;  3O37 A;  3UVY A;  4A9O A;  4O7F A;  5D3N A;  4QSV A;  4HBX A;  5CFW A;  5F62 A;  5DFB A;  5E74 A;  3K2J A;  5EGU A;  2YQD A;  4QSQ A;  5EPB A;  4YAB A;  5EIS A;  3U5N A;  4PKL A;  5IGK A;  4PY6 A;  3U5P A;  4TT6 A;  5I86 A;  4YY4 A;  4XY9 A;  4A9H A;  4YH4 A;  4UYF A;  4QNS A;  4AKI A;  5DY7 A;  5F63 A;  4HXL A;  4O72 A;  5F2P A;  5HRW A;  5DYC A;  2E7O A;  5H1V A;  4O78 A;  4O75 A;  5I80 A;  4CFL A;  4ZQL A;  4CUP A;  4E96 A;  2G4A A;  5EP7 A;  3MUK A;  4TZ8 A;  5A5P A;  3P1C A;  5CQA A;  5IGM A;  4O74 A;  5FE1 A;  4QYL A;  4HXO A;  5CQT A;  5BT4 A;  3HMH A;  2DVS A;  5A83 A;  4Z6H A;  5CTL A;  5D26 A;  4YY6 A;  3RCW A;  2E3K A;  5A81 A;  4HBV A;  5FG4 A;  5LVQ A;  4N4H A;  5FE8 A;  2WP1 A;  5EPR A;  3G0J A;  5CGP A;  5C85 A;  5J0D A;  4HXS A;  4QC1 A;  5DFC A;  4YBM A;  1ZKR A;  4NRA A;  5D3H A;  5FFV A;  5ENJ A;  4IOO A;  5CUC A;  5FE9 A;  4KV4 A;  5FFY A;  5A5N A;  4HBW A;  4LYS A;  5E73 A;  5EIC A;  3SVH A;  3U5O A;  4XUA A;  2R0S A;  3U5K A;  5LKZ A;  5D0C A;  4O7B A;  4Q0O A;  2MJV B;  5FE7 A;  2L85 A;  3D1D A;  4TYL A;  5I40 A;  5ACY A;  4Z1S A;  5D3J A;  4NYW A;  5CUA A;  4QUU A;  5L98 A;  5HEN A;  5DFD A;  5F61 A;  2FSA A;  5H85 A;  5JWM A;  3DWY A;  4YYG A;  5DW1 A;  3HMF A;  5EI4 A;  5A5R A;  5DKD A;  4NR9 A;  5LJ2 A;  2YYN A;  5AMF A;  5EU1 A;  2YEL A;  4O76 A;  3VKH A;  2EJN A;  3NXB A;  4HXM A;  5IG6 A;  5E9L A;  4Z6I A;  4AKG A;  4CUT A;  3P1E A;  2KTB B;  5A5Q A;  4QYD A;  5L97 A;  5IID A;  4YAX A;  4UYG A;  5EWV A;  5ENB A;  5E9I A;  5COI A;  2OSS A;  5F36 A;  4QEU A;  4BW4 A;  4UIW A;  3P5O A;  3MQM A;  5ETD A;  3GG3 A;  4QB3 A;  3ZYU A;  5KO4 A;  4IR5 A;  5CP5 A;  5LKT A;  5D3L A;  3S92 A;  5DYX A;  4YYK A;  5CQ4 A;  4YYJ A;  5F1H A;  5HCL A;  5E0R A;  5EPS A;  4QY4 A;  1X0J A;  3LQI A;  4HXK A;  4IR4 A;  5DBM A;  4O7A A;  3S91 A;  5EV9 A;  4KV1 A;  3IU6 A;  1F68 A;  5F5Z A;  5F3A A;  2I7K A;  3LJW A;  4XUB A;  5FE0 A;  5CQ6 A;  4J1P A;  4J0S A;  4N3W A;  2DVQ A;  4NRC A;  2R0V A;  4A9E A;  3AQA A;  3LQH A;  2DAT A;  4ZW1 A;  5L96 A;  2I8N A;  2YDW A;  4QUT A;  4LZS A;  2N9G A;  5I83 A;  5AD2 A;  5KTX A;  4YAT A;  5L8U A;  3JVK A;  5HQ7 A;  4YYM A;  2DVV A;  4UIX A;  4ZC9 A;  5ENC A;  4PCI A;  4UYF B;  4NQM A;  4MR5 A;  4IR3 A;  4J3I A;  5C4Q A;  4YBS A;  1ZS5 A;  3I3J A;  5C87 A;  5CY9 A;  2R0Y A;  4MR4 A;  4LZ2 A;  5F1L A;  5LJ0 A;  5FE4 A;  4CFK A;  4UIV A;  5A5S A;  5E7D A;  3U5M A;  2DKW A;  4O77 A;  4CLB A;  5I1Q A;  3QZT A;  5G4R A;  4OGJ A;  4NS5 A;  4NUE A;  3LXJ A;  3Q2F A;  5EWW A;  4BJX A;  4HXR A;  5CS8 A;  5EVA A;  5FBX A;  5FG5 A;  5F25 A;  3UVW A;  4N4F A;  4IOQ A;  1PUO A;  3FKM X;  5E9V A;  4Q0N A;  5IBN A;  2LSP B;  5LKX A;  5BT5 A;  2WP2 A;  4NYV A;  5A5O A;  5FB0 A;  4NR8 A;  5D3S A;  3MUL A;  4TS8 A;  4PTB A;  2D82 A;  5DX4 A;  2RNX A;  4N4I A;  4YYD A;  4GPJ A;  5D3T A;  4A9J A;  5A82 A;  3UVX A;  5AME A;  5KTU A;  5D24 A;  5LUU A;  3ERR A;  4QSW A;  5KTW A;  4O70 A;  4CUS A;  4CUU A;  4QST A;  5CUE A;  1EQF A;  2GRC A;  2R10 A;  4QSP A;  5FE6 A;  4UIU A;  5HQ5 A;  3UV4 A;  5HLS A;  4A9L A;  4MEO A;  4QEV A;  4UIZ A;  5I7X A;  4CUR A;  3D1B A;  4XY8 A;  3LQJ A;  5CRM A;  4C66 A;  4TTE A;  5I88 A;  4TT4 A;  2E7N A;  4BW2 A;  5FE3 A;  2D9E A;  5JI8 A;  3IU5 A;  3U5J A;  5L99 A;  5C89 A;  4X2I A;  4MR6 A;  3P1F A;  5D3R A;  4QBM A;  4UYH A;  5KU3 A;  4OGI A;  5TCM A;  2RFJ A;  4TU4 A;  5DKC A;  5LKU A;  5I89 A;  3U5L A;  3QZV A;  5E9K A;  4A9M A;  4NQN A;  4MEQ A;  2DVR A;  4MEN A;  5CQ5 A;  4NR6 A;  5FB1 A;  5G4S A;  3UW9 A;  4QC3 A;  5A85 A;  4UIT A;  5CQ3 A;  2RS9 B;  5FE5 A;  5D3P A;  4CL9 A;  4A9F A;  5I7Y A;  1N72 A;  5K29 A;  4N4G A;  5E3G A;  2F6N A;  5E3D A;  4TQN A;  4Y03 A;  4ALH A;  4LYI A;  4O71 A;  3JVJ A;  5C7N A;  5LJ1 A;  4AKH A;  2RO1 A;  1WUG A;  4ALG A;  1WUM A;  4YYH A;  5DYA A;  4PS5 A;  4QZS A;  4TU6 A;  4NR5 A;  5ENG A;  5EA1 A;  3JVL A;  5ENE A;  4DON A;  2H60 A;  5EWH A;  4UYD A;  3ONI A;  4J0R A; 
#chains in the Genus database with same CATH homology
 5ENI A;  4NYX A;  5II1 A;  3G0L A;  3UV2 A;  3MB4 A;  4WIV A;  4PCE A;  3ONI A;  4TT2 A;  3UV5 A;  5TB6 A;  2L84 A;  5CQ8 A;  4LDF A;  2RNW A;  3MB3 A;  3DAI A;  4A9I A;  2OUO A;  4XYA A;  2OO1 A;  4QR4 A;  4F3I A;  3SVG A;  5EWD A;  4O7E A;  5IGN A;  4IOR A;  3UVD A;  4A9N A;  5DLX A;  3O35 A;  4YBT A;  4LRG A;  4AKN A;  1JSP B;  2YEK A;  5CUG A;  5FH8 A;  5ENF A;  4YK0 A;  3QZS A;  3D7C A;  4NXJ A;  5CU8 A;  3O34 A;  5ENH A;  4YC9 A;  5DW2 A;  2YW5 A;  4MEP A;  4QSU A;  5KHM A;  4NUD A;  3MXF A;  2YEM A;  4QR3 A;  4WHU A;  5HEL A;  5AD3 A;  4HXN A;  4UIY A;  5FDZ A;  5DYU A;  4C67 A;  4YH3 A;  5D25 A;  1JM4 B;  5EM3 A;  5CPE A;  5CRZ A;  4HBY A;  1E6I A;  5H1U A;  4O7C A;  4KCX A;  4Z93 A;  4QSX A;  4QSS A;  2L5E A;  5HM0 A;  5HRX A;  4Z1Q A;  3SVF A;  5IGL A;  2F6J A;  5C8G A;  4CUQ A;  5FFW A;  3O36 A;  5F60 A;  5CQ7 A;  5HFQ A;  4BW3 A;  4YYN A;  4YYI A;  3HME A;  5FG6 A;  2NXB A;  5EQ1 A;  4HXP A;  4WHW A;  5D7X A;  5DLZ A;  4NR4 A;  4BW1 A;  5CUB A;  5FH6 A;  5H1T A;  3JVM A;  4NUC A;  4A9K A;  4LYW A;  3P1D A;  5HRV A;  5LVR A;  4MR3 A;  2RI7 A;  5BT3 A;  5EWC A;  5CUD A;  5CZG A;  5I29 A;  4QEW A;  5HJC A;  5DKH A;  3O33 A;  4NR7 A;  4TZ2 A;  4UYE A;  5ETB A;  5HFR A;  4NRB A;  3AAD A;  4LZR A;  4QR5 A;  4LC2 A;  5A7C A;  5EK9 A;  4LR6 A;  4YAD A;  4IR6 A;  4QSR A;  3Q2E A;  2DWW A;  5E9M A;  4BHW A;  5HEM A;  5L8T A;  3TLP A;  4FLP A;  5E9Y A;  4RVR A;  5HQ6 A;  2RNY A;  5FH7 A;  5FE2 A;  5II2 A;  4OUF A;  3O37 A;  3UVY A;  4A9O A;  4O7F A;  5D3N A;  4QSV A;  4HBX A;  5CFW A;  5F62 A;  5DFB A;  5E74 A;  3K2J A;  5EGU A;  2YQD A;  4QSQ A;  5EPB A;  4YAB A;  5EIS A;  3U5N A;  4PKL A;  5IGK A;  4PY6 A;  3U5P A;  4TT6 A;  5I86 A;  4YY4 A;  4XY9 A;  4A9H A;  4YH4 A;  4UYF A;  4QNS A;  5DY7 A;  5F63 A;  4HXL A;  4O72 A;  5F2P A;  5HRW A;  5DYC A;  2E7O A;  5H1V A;  4O78 A;  4O75 A;  5I80 A;  4CFL A;  4ZQL A;  4CUP A;  4E96 A;  2G4A A;  5EP7 A;  3MUK A;  4TZ8 A;  5A5P A;  3P1C A;  5CQA A;  5IGM A;  4O74 A;  5FE1 A;  4QYL A;  4HXO A;  5CQT A;  5BT4 A;  3HMH A;  2DVS A;  5A83 A;  4Z6H A;  5CTL A;  5D26 A;  4YY6 A;  3RCW A;  2E3K A;  5A81 A;  4HBV A;  5FG4 A;  5LVQ A;  4N4H A;  5FE8 A;  2WP1 A;  5EPR A;  3G0J A;  5CGP A;  5C85 A;  5J0D A;  4HXS A;  4QC1 A;  5DFC A;  4YBM A;  4NRA A;  5D3H A;  5FFV A;  5ENJ A;  4IOO A;  5CUC A;  5FE9 A;  4KV4 A;  5FFY A;  5A5N A;  4HBW A;  4LYS A;  5E73 A;  5EIC A;  3SVH A;  3U5O A;  4XUA A;  2R0S A;  3U5K A;  5LKZ A;  5D0C A;  4O7B A;  4Q0O A;  2MJV B;  5FE7 A;  2L85 A;  4TYL A;  5I40 A;  5ACY A;  4Z1S A;  5D3J A;  4NYW A;  5CUA A;  4QUU A;  5L98 A;  5HEN A;  5DFD A;  5F61 A;  2FSA A;  5H85 A;  5JWM A;  3DWY A;  4YYG A;  5DW1 A;  3HMF A;  5EI4 A;  5A5R A;  5DKD A;  4NR9 A;  5LJ2 A;  2YYN A;  5AMF A;  5EU1 A;  2YEL A;  4O76 A;  3NXB A;  4HXM A;  5IG6 A;  5E9L A;  4Z6I A;  4CUT A;  3P1E A;  2KTB B;  5A5Q A;  4QYD A;  5L97 A;  5IID A;  4YAX A;  4UYG A;  5EWV A;  5ENB A;  5E9I A;  5COI A;  2OSS A;  5F36 A;  4QEU A;  4BW4 A;  4UIW A;  3P5O A;  3MQM A;  5ETD A;  3GG3 A;  4QB3 A;  3ZYU A;  5KO4 A;  4IR5 A;  5CP5 A;  5LKT A;  5D3L A;  3S92 A;  5DYX A;  4YYK A;  5CQ4 A;  4YYJ A;  5F1H A;  5HCL A;  5E0R A;  5EPS A;  4QY4 A;  1X0J A;  3LQI A;  4HXK A;  4IR4 A;  5DBM A;  4O7A A;  3S91 A;  5EV9 A;  4KV1 A;  3IU6 A;  1F68 A;  5F5Z A;  5F3A A;  2I7K A;  3LJW A;  4XUB A;  5FE0 A;  5CQ6 A;  4J1P A;  4J0S A;  4N3W A;  2DVQ A;  4NRC A;  2R0V A;  4A9E A;  3AQA A;  3LQH A;  2DAT A;  4ZW1 A;  5L96 A;  2I8N A;  2YDW A;  4QUT A;  4LZS A;  2N9G A;  5I83 A;  5AD2 A;  5KTX A;  4YAT A;  5L8U A;  3JVK A;  5HQ7 A;  4YYM A;  2DVV A;  4UIX A;  4ZC9 A;  5ENC A;  4PCI A;  4NQM A;  4MR5 A;  4IR3 A;  4J3I A;  5C4Q A;  4YBS A;  1ZS5 A;  3I3J A;  5C87 A;  5CY9 A;  2R0Y A;  4MR4 A;  4LZ2 A;  5F1L A;  5LJ0 A;  5FE4 A;  4CFK A;  4UIV A;  5A5S A;  5E7D A;  3U5M A;  2DKW A;  4O77 A;  4CLB A;  5I1Q A;  3QZT A;  5G4R A;  4OGJ A;  4NS5 A;  4NUE A;  3LXJ A;  3Q2F A;  5EWW A;  4BJX A;  4HXR A;  5CS8 A;  5EVA A;  5FBX A;  5FG5 A;  5F25 A;  3UVW A;  4N4F A;  4IOQ A;  3FKM X;  5E9V A;  4Q0N A;  5IBN A;  2LSP B;  5LKX A;  5BT5 A;  2WP2 A;  4NYV A;  5A5O A;  5FB0 A;  4NR8 A;  5D3S A;  3MUL A;  4TS8 A;  4PTB A;  2D82 A;  5DX4 A;  2RNX A;  4N4I A;  4YYD A;  4GPJ A;  5D3T A;  4A9J A;  5A82 A;  3UVX A;  5AME A;  5KTU A;  5D24 A;  5LUU A;  4QSW A;  5KTW A;  4O70 A;  4CUS A;  4CUU A;  4QST A;  5CUE A;  1EQF A;  2GRC A;  2R10 A;  4QSP A;  5FE6 A;  4UIU A;  5HQ5 A;  3UV4 A;  5HLS A;  4A9L A;  4MEO A;  4QEV A;  4UIZ A;  5I7X A;  4CUR A;  4XY8 A;  3LQJ A;  5CRM A;  4C66 A;  4TTE A;  5I88 A;  4TT4 A;  2E7N A;  4BW2 A;  5FE3 A;  2D9E A;  5JI8 A;  3IU5 A;  3U5J A;  5L99 A;  5C89 A;  4X2I A;  4MR6 A;  3P1F A;  5D3R A;  4QBM A;  4UYH A;  5KU3 A;  4OGI A;  5TCM A;  2RFJ A;  4TU4 A;  5DKC A;  5LKU A;  5I89 A;  3U5L A;  3QZV A;  5E9K A;  4A9M A;  4NQN A;  4MEQ A;  2DVR A;  4MEN A;  5CQ5 A;  4NR6 A;  5FB1 A;  5G4S A;  3UW9 A;  4QC3 A;  5A85 A;  4UIT A;  5CQ3 A;  2RS9 B;  5FE5 A;  5D3P A;  4CL9 A;  4A9F A;  5I7Y A;  1N72 A;  5K29 A;  4N4G A;  5E3G A;  2F6N A;  5E3D A;  4TQN A;  4Y03 A;  4ALH A;  4LYI A;  4O71 A;  3JVJ A;  5C7N A;  5LJ1 A;  2RO1 A;  1WUG A;  4ALG A;  1WUM A;  4YYH A;  5DYA A;  4PS5 A;  4QZS A;  4TU6 A;  4NR5 A;  5ENG A;  5EA1 A;  3JVL A;  5ENE A;  4DON A;  2H60 A;  5EWH A;  4UYD A;  4UYF B;  4J0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...