5EM3A

Crystal structure of the human brpf1 bromodomain in complex with seed9
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
SMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5em3A00
4CUSA 5FE5A 4XYAA 4NR5A 4Y03A 4BJXA 3Q2EA 5I88A 4NR4A 5EK9A 3G0JA 5TB6A 4IR5A 4KV4A 2YEKA 4Q0NA 5CRZA 4UYEA 3IU5A 3O36A 4ALGA 2YELA 4LRGA 5ACYA 5ENBA 3ZYUA 5E9KA 5DLZA 5H1UA 4O7CA 4TT4A 3HMHA 2RFJA 4O77A 5DW2A 4BW2A 3D7CA 4GPJA 4UITA 4YK0A 5EM3A 5FB1A 4XY9A 5DW1A 5CQ6A 2D82A 5E73A 2L84A 4UIZA 5C4QA 5ENCA 5LUUA 4QEWA 3U5PA 5E9IA 2E7OA 3O34A 4ZQLA 5FB0A 5LJ1A 3O35A 4IR6A 4J0SA 4QR5A 4QUTA 5C8GA 4UIXA 5CUGA 4A9EA 5CQ7A 2R10A 5L98A 5F25A 4YATA 5FH7A 4YYIA 4O74A 5E9VA 4QSWA 5EWCA 5FE1A 3K2JA 4QC1A 5EGUA 1N72A 5KU3A 4HXLA 4QYLA 5FE2A 4CUPA 4Z1SA 5F63A 5IBNA 2I8NA 3UVWA 4YAXA 5LKUA 4XY8A 4A9MA 5F5ZA 4BW3A 4NXJA 5F2PA 2RNXA 5CRMA 4O76A 5D26A 4KCXA 4YH4A 5CGPA 2RNYA 4TT6A 4IR4A 5HM0A 5CU8A 5ETBA 5II2A 5DYUA 4YYHA 4UIWA 2R0YA 4ALHA 5I86A 2N9GA 4QC3A 3MUKA 1EQFA 4UIYA 2RS9B 4QR4A 2F6JA 4TTEA 4NYVA 1X0JA 5D25A 5L97A 5CPEA 5BT4A 4HXKA 4A9NA 4CUUA 4MEPA 2YYNA 2DVSA 5CTLA 3MULA 5A5NA 5KTXA 5LJ0A 5IGKA 4MR5A 5D3HA 5AD2A 2L5EA 5A5PA 3DWYA 2E7NA 3TLPA 2WP1A 2YW5A 5A7CA 5KTWA 2R0SA 4QEUA 5L96A 2NXBA 4YBSA 5HFRA 3G0LA 5DX4A 4UYFB 5FFWA 5I7YA 4IOOA 2H60A 5I1QA 5DFBA 4PCEA 5D3LA 4WHUA 4LZSA 5E9LA 4QZSA 3HMEA 4O7BA 5EA1A 5I29A 4TZ2A 5HQ6A 5FE8A 4YH3A 3GG3A 5DKHA 4OUFA 5LKXA 5HENA 4N4FA 3AADA 4TT2A 5HJCA 4NUDA 5FE6A 3QZTA 3O33A 5DY7A 4NRAA 5II1A 5CUDA 5KO4A 5CUBA 5FE4A 3IU6A 4MR6A 5G4RA 3UVDA 3UVYA 3S91A 5EVAA 4MENA 4IR3A 5ENJA 3QZVA 4Z93A 4OGIA 3ONIA 5DLXA 5FFYA 4J3IA 4QBMA 5CQ3A 5EWDA 5EPBA 4UIVA 4CFLA 4E96A 5JWMA 5I89A 3NXBA 4NR9A 4QB3A 4MR4A 4Q0OA 4RVRA 4YYKA 5HQ7A 2KTBB 4BHWA 1JM4B 4QSSA 4O7AA 4YY4A 4IOQA 4PCIA 5FE7A 5L8TA 5ENEA 1WUGA 5E3GA 5I80A 4LZ2A 5CQ8A 5D3TA 5E74A 5A5QA 4NQMA 5EPRA 5KHMA 3P1CA 5CQ5A 4YYJA 5JI8A 5IGMA 2RO1A 5F3AA 4YYMA 4A9IA 4QR3A 5HCLA 4HXMA 5CY9A 4BW4A 4NR8A 4C67A 5CUCA 4CUTA 2WP2A 4TQNA 5FH6A 3QZSA 5A5SA 5IIDA 5F60A 5EWVA 4A9OA 4AKNA 4YBTA 5DBMA 5AD3A 5CQAA 5HELA 4QY4A 5ENGA 3JVJA 5E9YA 4PS5A 3HMFA 4ZW1A 5CUAA 3MB3A 5BT5A 5HRWA 4LC2A 5E3DA 4YYNA 4O72A 3U5MA 5FE9A 5HEMA 4HBWA 3JVKA 5KTUA 5EISA 5FG4A 4NUEA 3LQIA 4MEOA 5D7XA 4UYDA 1F68A 4UYFA 5BT3A 3UV5A 4DONA 5EQ1A 5EICA 4J0RA 5EU1A 4QNSA 5DFDA 5EPSA 5G4SA 4J1PA 4TU4A 3O37A 4O78A 5HLSA 4NYWA 2YEMA 5HRVA 2R0VA 2DVVA 4QSRA 3S92A 5LKZA 3LQJA 2E3KA 5CFWA 4LYWA 5AMFA 5CQTA 4UYHA 4A9LA 4PKLA 4X2IA 5L8UA 5IGNA 5TCMA 4QYDA 4NS5A 4N4HA 4NR6A 5FE0A 5HRXA 4YYGA 4A9KA 4N4IA 4FLPA 5D3SA 5COIA 3P1FA 3SVFA 5FG6A 4A9JA 4N3WA 5CP5A 4UYGA 4PTBA 2OUOA 4QSPA 4CLBA 4NQNA 3P1EA 4KV1A 4F3IA 2YDWA 3MQMA 5DKDA 4CFKA 3U5JA 5HQ5A 5K29A 4YC9A 4BW1A 5E9MA 5ENFA 2DKWA 4UIUA 5H1TA 4O75A 5DYCA 5FH8A 4XUAA 4LYIA 3I3JA 5LKTA 4O70A 4CL9A 4OGJA 5D24A 5C85A 5AMEA 5C7NA 5LVRA 4TZ8A 4WHWA 3UVXA 5CZGA 5ETDA 4NUCA 5FDZA 4QSTA 3AQAA 5HFQA 4Z1QA 2RNWA 3P5OA 4YYDA 5A82A 5FFVA 5F36A 3MXFA 4NRBA 3JVLA 4ZC9A 3LXJA 5EWHA 5I83A 5LVQA 1E6IA 4TYLA 3U5NA 4CUQA 5A5RA 4TU6A 4A9HA 5I40A 2DWWA 4HBYA 3MB4A 4HXSA 4YADA 2MJVB 5DYAA 2FSAA 2DATA 4LZRA 3Q2FA 3U5LA 4NR7A 2GRCA 3RCWA 5ENHA 5CS8A 4HXOA 5F1HA 4XUBA 4NYXA 1WUMA 4YBMA 2OO1A 4O7EA 4QSVA 4N4GA 3U5KA 3DAIA 3FKMX 4HXRA 4HBVA 5IG6A 4MR3A 5DFCA 4LR6A 4WIVA 2D9EA 4QSXA 2F6NA 3UV4A 4HXNA 5A5OA 4HBXA 4QSQA 2G4AA 4QEVA 4CURA 3UW9A 5FG5A 1JSPB 5D3PA 4PY6A 4O7FA 2DVRA 4NRCA 5D3RA 4HXPA 4O71A 5H85A 2LSPB 5F1LA 5FBXA 5FE3A 5F62A 5D3NA 2OSSA 4YY6A 4Z6IA 4MEQA 5DKCA 5CQ4A 5A81A 4C66A 5EP7A 5D3JA 5L99A 5E7DA 5EI4A 5EWWA 3UV2A 1ZS5A 2YQDA 3JVMA 4YABA 5D0CA 4Z6HA 2RI7A 5ENIA 2DVQA 5E0RA 4IORA 5A83A 3SVGA 2L85A 4LDFA 5I7XA 5C89A 3LQHA 5LJ2A 5DYXA 4QSUA 5EV9A 5J0DA 5CUEA 3U5OA 4A9FA 4TS8A 3LJWA 5IGLA 5F61A 5C87A 5H1VA 3P1DA 4QUUA 3SVHA 5A85A 2I7KA 4LYSA
chains in the Genus database with same CATH superfamily
4CUSA 5FE5A 4XYAA 4NR5A 4Y03A 4BJXA 3Q2EA 5I88A 4NR4A 5EK9A 3G0JA 5TB6A 4IR5A 4KV4A 2YEKA 4Q0NA 5CRZA 4UYEA 3IU5A 3O36A 4ALGA 2YELA 4LRGA 5ACYA 5ENBA 3ZYUA 5E9KA 5DLZA 5H1UA 4O7CA 4TT4A 3HMHA 2RFJA 4O77A 5DW2A 4BW2A 3D7CA 4GPJA 4UITA 4YK0A 5EM3A 5FB1A 4XY9A 5DW1A 5CQ6A 2D82A 5E73A 1ZKRA 2L84A 4UIZA 5C4QA 5ENCA 5LUUA 4QEWA 3U5PA 5E9IA 2E7OA 3O34A 4ZQLA 5FB0A 5LJ1A 3O35A 4IR6A 4J0SA 4QR5A 4QUTA 5C8GA 4UIXA 5CUGA 4A9EA 5CQ7A 2R10A 5L98A 5F25A 4YATA 5FH7A 4YYIA 4O74A 5E9VA 4QSWA 5EWCA 5FE1A 3K2JA 4QC1A 5EGUA 1N72A 5KU3A 4HXLA 4QYLA 5FE2A 4CUPA 4Z1SA 5F63A 5IBNA 2I8NA 3UVWA 4YAXA 5LKUA 4XY8A 4A9MA 5F5ZA 4BW3A 4NXJA 5F2PA 2RNXA 5CRMA 4O76A 5D26A 4KCXA 4YH4A 4AKIA 5CGPA 4AKGA 2RNYA 4TT6A 4IR4A 5HM0A 5CU8A 5ETBA 5II2A 5DYUA 4YYHA 4UIWA 2R0YA 4ALHA 5I86A 2N9GA 4QC3A 3MUKA 1EQFA 4UIYA 2RS9B 4QR4A 2F6JA 4TTEA 4NYVA 1X0JA 5D25A 5L97A 5CPEA 5BT4A 4HXKA 4A9NA 4CUUA 4MEPA 2YYNA 2DVSA 5CTLA 3MULA 5A5NA 5KTXA 5LJ0A 5IGKA 4MR5A 5D3HA 5AD2A 2L5EA 5A5PA 3DWYA 2E7NA 3TLPA 2WP1A 2YW5A 5A7CA 5KTWA 2R0SA 4QEUA 5L96A 2NXBA 4YBSA 5HFRA 3G0LA 5DX4A 4UYFB 5FFWA 5I7YA 4IOOA 2H60A 5I1QA 5DFBA 4PCEA 5D3LA 4WHUA 4LZSA 5E9LA 4QZSA 3HMEA 4O7BA 5EA1A 5I29A 4TZ2A 5HQ6A 5FE8A 4YH3A 3GG3A 5DKHA 4OUFA 5LKXA 5HENA 4N4FA 3AADA 4TT2A 5HJCA 4NUDA 5FE6A 3QZTA 3O33A 3VKHA 5DY7A 4NRAA 5II1A 5CUDA 5KO4A 5CUBA 5FE4A 3IU6A 4MR6A 5G4RA 3UVDA 3UVYA 3S91A 5EVAA 4MENA 4IR3A 5ENJA 3QZVA 4Z93A 4OGIA 3ONIA 5DLXA 5FFYA 4J3IA 4QBMA 5CQ3A 5EWDA 5EPBA 4UIVA 4CFLA 4E96A 5JWMA 5I89A 3NXBA 4NR9A 4QB3A 4MR4A 4Q0OA 4RVRA 4YYKA 5HQ7A 2KTBB 4BHWA 2EJNA 1JM4B 4QSSA 4O7AA 4YY4A 4IOQA 4PCIA 5FE7A 5L8TA 5ENEA 1WUGA 5E3GA 5I80A 4LZ2A 5CQ8A 5D3TA 5E74A 5A5QA 4NQMA 5EPRA 5KHMA 3P1CA 5CQ5A 4YYJA 5JI8A 5IGMA 2RO1A 5F3AA 4YYMA 4A9IA 4QR3A 5HCLA 4HXMA 5CY9A 4BW4A 4NR8A 4C67A 5CUCA 4CUTA 2WP2A 4TQNA 5FH6A 3QZSA 5A5SA 5IIDA 5F60A 5EWVA 4A9OA 4AKNA 4YBTA 5DBMA 5AD3A 5CQAA 5HELA 4QY4A 5ENGA 3JVJA 4AKHA 5E9YA 4PS5A 3HMFA 4ZW1A 5CUAA 3MB3A 5BT5A 5HRWA 4LC2A 5E3DA 4YYNA 4O72A 3U5MA 5FE9A 5HEMA 4HBWA 3JVKA 5KTUA 5EISA 5FG4A 4NUEA 3LQIA 4MEOA 3D1BA 5D7XA 4UYDA 1F68A 4UYFA 5BT3A 3UV5A 4DONA 5EQ1A 5EICA 4J0RA 5EU1A 4QNSA 5DFDA 5EPSA 5G4SA 4J1PA 4TU4A 3O37A 4O78A 5HLSA 4NYWA 2YEMA 5HRVA 2R0VA 2DVVA 4QSRA 3S92A 5LKZA 3LQJA 2E3KA 5CFWA 4LYWA 5AMFA 5CQTA 4UYHA 4A9LA 4PKLA 4X2IA 5L8UA 5IGNA 5TCMA 4QYDA 4NS5A 4N4HA 4NR6A 5FE0A 5HRXA 4YYGA 4A9KA 4N4IA 4FLPA 5D3SA 5COIA 3P1FA 3SVFA 5FG6A 4A9JA 4N3WA 5CP5A 4UYGA 4PTBA 2OUOA 4QSPA 4CLBA 4NQNA 3P1EA 4KV1A 4F3IA 2YDWA 3MQMA 5DKDA 4CFKA 3U5JA 5HQ5A 5K29A 4YC9A 4BW1A 5E9MA 5ENFA 2DKWA 4UIUA 5H1TA 4O75A 5DYCA 5FH8A 4XUAA 4LYIA 3I3JA 5LKTA 4O70A 4AI6A 4CL9A 4OGJA 5D24A 5C85A 5AMEA 5C7NA 5LVRA 4TZ8A 4WHWA 3UVXA 5CZGA 5ETDA 4NUCA 5FDZA 4QSTA 3AQAA 5HFQA 4Z1QA 2RNWA 3P5OA 4YYDA 5A82A 5FFVA 5F36A 3MXFA 4NRBA 3JVLA 4ZC9A 3LXJA 5EWHA 5I83A 5LVQA 1E6IA 4TYLA 3U5NA 4CUQA 5A5RA 4TU6A 4A9HA 5I40A 2DWWA 4HBYA 3MB4A 4HXSA 4YADA 2MJVB 5DYAA 2FSAA 2DATA 4LZRA 3Q2FA 3U5LA 4NR7A 2GRCA 3RCWA 5ENHA 5CS8A 4HXOA 5F1HA 4XUBA 4NYXA 1WUMA 4YBMA 2OO1A 4O7EA 4QSVA 4N4GA 3U5KA 3DAIA 3FKMX 1PUOA 4HXRA 4HBVA 5IG6A 4MR3A 5DFCA 4LR6A 4WIVA 2D9EA 4QSXA 2F6NA 3UV4A 4HXNA 5A5OA 4HBXA 4QSQA 2G4AA 4QEVA 4CURA 3UW9A 5FG5A 3VKGA 1JSPB 3D1DA 4PY6A 4O7FA 2DVRA 4NRCA 5D3PA 4HXPA 4O71A 5D3RA 2LSPB 5H85A 5F1LA 5FBXA 5FE3A 5F62A 5D3NA 2OSSA 4YY6A 4Z6IA 4MEQA 5DKCA 5CQ4A 5A81A 4C66A 5EP7A 5D3JA 5L99A 5E7DA 5EI4A 5EWWA 3UV2A 1ZS5A 2YQDA 3JVMA 4YABA 5D0CA 4Z6HA 2RI7A 5ENIA 2DVQA 5E0RA 4IORA 5A83A 3SVGA 2L85A 4LDFA 5I7XA 5C89A 3LQHA 5LJ2A 5DYXA 4QSUA 5EV9A 5J0DA 5CUEA 3U5OA 4A9FA 4TS8A 3ERRA 3LJWA 5IGLA 5F61A 5C87A 5H1VA 3P1DA 4QUUA 3SVHA 5A85A 2I7KA 4LYSA
chains in the Genus database with same CATH topology
4CUSA 5FE5A 4XYAA 4NR5A 4Y03A 4BJXA 3Q2EA 5I88A 4NR4A 5EK9A 3G0JA 5TB6A 4IR5A 4KV4A 2YEKA 4Q0NA 5CRZA 4UYEA 3IU5A 3O36A 4ALGA 2YELA 4LRGA 5ACYA 5ENBA 3ZYUA 5E9KA 5DLZA 5H1UA 4O7CA 4TT4A 3HMHA 2RFJA 4O77A 5DW2A 4BW2A 3D7CA 4GPJA 4UITA 4YK0A 5EM3A 5FB1A 4XY9A 5DW1A 5CQ6A 2D82A 5E73A 2L84A 4UIZA 5C4QA 5ENCA 5LUUA 4QEWA 3U5PA 5E9IA 2E7OA 3O34A 4ZQLA 5FB0A 5LJ1A 3O35A 4IR6A 4J0SA 4QR5A 4QUTA 5C8GA 4UIXA 5CUGA 4A9EA 5CQ7A 2R10A 5L98A 5F25A 4YATA 5FH7A 4YYIA 4O74A 5E9VA 4QSWA 5EWCA 5FE1A 3K2JA 4QC1A 5EGUA 1N72A 5KU3A 4HXLA 4QYLA 5FE2A 4CUPA 4Z1SA 5F63A 5IBNA 2I8NA 3UVWA 4YAXA 5LKUA 4XY8A 4A9MA 5F5ZA 4BW3A 4NXJA 5F2PA 2RNXA 5CRMA 4O76A 5D26A 4KCXA 4YH4A 5CGPA 2RNYA 4TT6A 4IR4A 5HM0A 5CU8A 5ETBA 5II2A 5DYUA 4YYHA 4UIWA 2R0YA 4ALHA 5I86A 2N9GA 4QC3A 3MUKA 1EQFA 4UIYA 2RS9B 4QR4A 2F6JA 4TTEA 4NYVA 1X0JA 5D25A 5L97A 5CPEA 5BT4A 4HXKA 4A9NA 4CUUA 4MEPA 2YYNA 2DVSA 5CTLA 3MULA 5A5NA 5KTXA 5LJ0A 5IGKA 4MR5A 5D3HA 5AD2A 2L5EA 5A5PA 3DWYA 2E7NA 3TLPA 2WP1A 2YW5A 5A7CA 5KTWA 2R0SA 4QEUA 5L96A 2NXBA 4YBSA 5HFRA 3G0LA 5DX4A 4UYFB 5FFWA 5I7YA 4IOOA 2H60A 5I1QA 5DFBA 4PCEA 5D3LA 4WHUA 4LZSA 5E9LA 4QZSA 3HMEA 4O7BA 5EA1A 5I29A 4TZ2A 5HQ6A 5FE8A 4YH3A 3GG3A 5DKHA 4OUFA 5LKXA 5HENA 4N4FA 3AADA 4TT2A 5HJCA 4NUDA 5FE6A 3QZTA 3O33A 5DY7A 4NRAA 5II1A 5CUDA 5KO4A 5CUBA 5FE4A 3IU6A 4MR6A 5G4RA 3UVDA 3UVYA 3S91A 5EVAA 4MENA 4IR3A 5ENJA 3QZVA 4Z93A 4OGIA 3ONIA 5DLXA 5FFYA 4J3IA 4QBMA 5CQ3A 5EWDA 5EPBA 4UIVA 4CFLA 4E96A 5JWMA 5I89A 3NXBA 4NR9A 4QB3A 4MR4A 4Q0OA 4RVRA 4YYKA 5HQ7A 2KTBB 4BHWA 1JM4B 4QSSA 4O7AA 4YY4A 4IOQA 4PCIA 5FE7A 5L8TA 5ENEA 1WUGA 5E3GA 5I80A 4LZ2A 5CQ8A 5D3TA 5E74A 5A5QA 4NQMA 5EPRA 5KHMA 3P1CA 5CQ5A 4YYJA 5JI8A 5IGMA 2RO1A 5F3AA 4YYMA 4A9IA 4QR3A 5HCLA 4HXMA 5CY9A 4BW4A 4NR8A 4C67A 5CUCA 4CUTA 2WP2A 4TQNA 5FH6A 3QZSA 5A5SA 5IIDA 5F60A 5EWVA 4A9OA 4AKNA 4YBTA 5DBMA 5AD3A 5CQAA 5HELA 4QY4A 5ENGA 3JVJA 5E9YA 4PS5A 3HMFA 4ZW1A 5CUAA 3MB3A 5BT5A 5HRWA 4LC2A 5E3DA 4YYNA 4O72A 3U5MA 5FE9A 5HEMA 4HBWA 3JVKA 5KTUA 5EISA 5FG4A 4NUEA 3LQIA 4MEOA 5D7XA 4UYDA 1F68A 4UYFA 5BT3A 3UV5A 4DONA 5EQ1A 5EICA 4J0RA 5EU1A 4QNSA 5DFDA 5EPSA 5G4SA 4J1PA 4TU4A 3O37A 4O78A 5HLSA 4NYWA 2YEMA 5HRVA 2R0VA 2DVVA 4QSRA 3S92A 5LKZA 3LQJA 2E3KA 5CFWA 4LYWA 5AMFA 5CQTA 4UYHA 4A9LA 4PKLA 4X2IA 5L8UA 5IGNA 5TCMA 4QYDA 4NS5A 4N4HA 4NR6A 5FE0A 5HRXA 4YYGA 4A9KA 4N4IA 4FLPA 5D3SA 5COIA 3P1FA 3SVFA 5FG6A 4A9JA 4N3WA 5CP5A 4UYGA 4PTBA 2OUOA 4QSPA 4CLBA 4NQNA 3P1EA 4KV1A 4F3IA 2YDWA 3MQMA 5DKDA 4CFKA 3U5JA 5HQ5A 5K29A 4YC9A 4BW1A 5E9MA 5ENFA 2DKWA 4UIUA 5H1TA 4O75A 5DYCA 5FH8A 4XUAA 4LYIA 3I3JA 5LKTA 4O70A 4CL9A 4OGJA 5D24A 5C85A 5AMEA 5C7NA 5LVRA 4TZ8A 4WHWA 3UVXA 5CZGA 5ETDA 4NUCA 5FDZA 4QSTA 3AQAA 5HFQA 4Z1QA 2RNWA 3P5OA 4YYDA 5A82A 5FFVA 5F36A 3MXFA 4NRBA 3JVLA 4ZC9A 3LXJA 5EWHA 5I83A 5LVQA 1E6IA 4TYLA 3U5NA 4CUQA 5A5RA 4TU6A 4A9HA 5I40A 2DWWA 4HBYA 3MB4A 4HXSA 4YADA 2MJVB 5DYAA 2FSAA 2DATA 4LZRA 3Q2FA 3U5LA 4NR7A 2GRCA 3RCWA 5ENHA 5CS8A 4HXOA 5F1HA 4XUBA 4NYXA 1WUMA 4YBMA 2OO1A 4O7EA 4QSVA 4N4GA 3U5KA 3DAIA 3FKMX 4HXRA 4HBVA 5IG6A 4MR3A 5DFCA 4LR6A 4WIVA 2D9EA 4QSXA 2F6NA 3UV4A 4HXNA 5A5OA 4HBXA 4QSQA 2G4AA 4QEVA 4CURA 3UW9A 5FG5A 1JSPB 5D3PA 4PY6A 4O7FA 2DVRA 4NRCA 5D3RA 4HXPA 4O71A 5H85A 2LSPB 5F1LA 5FBXA 5FE3A 5F62A 5D3NA 2OSSA 4YY6A 4Z6IA 4MEQA 5DKCA 5CQ4A 5A81A 4C66A 5EP7A 5D3JA 5L99A 5E7DA 5EI4A 5EWWA 3UV2A 1ZS5A 2YQDA 3JVMA 4YABA 5D0CA 4Z6HA 2RI7A 5ENIA 2DVQA 5E0RA 4IORA 5A83A 3SVGA 2L85A 4LDFA 5I7XA 5C89A 3LQHA 5LJ2A 5DYXA 4QSUA 5EV9A 5J0DA 5CUEA 3U5OA 4A9FA 4TS8A 3LJWA 5IGLA 5F61A 5C87A 5H1VA 3P1DA 4QUUA 3SVHA 5A85A 2I7KA 4LYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CUS A;  5FE5 A;  4XYA A;  4NR5 A;  4Y03 A;  4BJX A;  3Q2E A;  5I88 A;  4NR4 A;  5EK9 A;  3G0J A;  5TB6 A;  4IR5 A;  4KV4 A;  2YEK A;  4Q0N A;  5CRZ A;  4UYE A;  3IU5 A;  3O36 A;  4ALG A;  2YEL A;  4LRG A;  5ACY A;  5ENB A;  3ZYU A;  5E9K A;  5DLZ A;  5H1U A;  4O7C A;  4TT4 A;  3HMH A;  2RFJ A;  4O77 A;  5DW2 A;  4BW2 A;  3D7C A;  4GPJ A;  4UIT A;  4YK0 A;  5EM3 A;  5FB1 A;  4XY9 A;  5DW1 A;  5CQ6 A;  2D82 A;  5E73 A;  2L84 A;  4UIZ A;  5C4Q A;  5ENC A;  5LUU A;  4QEW A;  3U5P A;  5E9I A;  2E7O A;  3O34 A;  4ZQL A;  5FB0 A;  5LJ1 A;  3O35 A;  4IR6 A;  4J0S A;  4QR5 A;  4QUT A;  5C8G A;  4UIX A;  5CUG A;  4A9E A;  5CQ7 A;  2R10 A;  5L98 A;  5F25 A;  4YAT A;  5FH7 A;  4YYI A;  4O74 A;  5E9V A;  4QSW A;  5EWC A;  5FE1 A;  3K2J A;  4QC1 A;  5EGU A;  1N72 A;  5KU3 A;  4HXL A;  4QYL A;  5FE2 A;  4CUP A;  4Z1S A;  5F63 A;  5IBN A;  2I8N A;  3UVW A;  4YAX A;  5LKU A;  4XY8 A;  4A9M A;  5F5Z A;  4BW3 A;  4NXJ A;  5F2P A;  2RNX A;  5CRM A;  4O76 A;  5D26 A;  4KCX A;  4YH4 A;  5CGP A;  2RNY A;  4TT6 A;  4IR4 A;  5HM0 A;  5CU8 A;  5ETB A;  5II2 A;  5DYU A;  4YYH A;  4UIW A;  2R0Y A;  4ALH A;  5I86 A;  2N9G A;  4QC3 A;  3MUK A;  1EQF A;  4UIY A;  2RS9 B;  4QR4 A;  2F6J A;  4TTE A;  4NYV A;  1X0J A;  5D25 A;  5L97 A;  5CPE A;  5BT4 A;  4HXK A;  4A9N A;  4CUU A;  4MEP A;  2YYN A;  2DVS A;  5CTL A;  3MUL A;  5A5N A;  5KTX A;  5LJ0 A;  5IGK A;  4MR5 A;  5D3H A;  5AD2 A;  2L5E A;  5A5P A;  3DWY A;  2E7N A;  3TLP A;  2WP1 A;  2YW5 A;  5A7C A;  5KTW A;  2R0S A;  4QEU A;  5L96 A;  2NXB A;  4YBS A;  5HFR A;  3G0L A;  5DX4 A;  4UYF B;  5FFW A;  5I7Y A;  4IOO A;  2H60 A;  5I1Q A;  5DFB A;  4PCE A;  5D3L A;  4WHU A;  4LZS A;  5E9L A;  4QZS A;  3HME A;  4O7B A;  5EA1 A;  5I29 A;  4TZ2 A;  5HQ6 A;  5FE8 A;  4YH3 A;  3GG3 A;  5DKH A;  4OUF A;  5LKX A;  5HEN A;  4N4F A;  3AAD A;  4TT2 A;  5HJC A;  4NUD A;  5FE6 A;  3QZT A;  3O33 A;  5DY7 A;  4NRA A;  5II1 A;  5CUD A;  5KO4 A;  5CUB A;  5FE4 A;  3IU6 A;  4MR6 A;  5G4R A;  3UVD A;  3UVY A;  3S91 A;  5EVA A;  4MEN A;  4IR3 A;  5ENJ A;  3QZV A;  4Z93 A;  4OGI A;  3ONI A;  5DLX A;  5FFY A;  4J3I A;  4QBM A;  5CQ3 A;  5EWD A;  5EPB A;  4UIV A;  4CFL A;  4E96 A;  5JWM A;  5I89 A;  3NXB A;  4NR9 A;  4QB3 A;  4MR4 A;  4Q0O A;  4RVR A;  4YYK A;  5HQ7 A;  2KTB B;  4BHW A;  1JM4 B;  4QSS A;  4O7A A;  4YY4 A;  4IOQ A;  4PCI A;  5FE7 A;  5L8T A;  5ENE A;  1WUG A;  5E3G A;  5I80 A;  4LZ2 A;  5CQ8 A;  5D3T A;  5E74 A;  5A5Q A;  4NQM A;  5EPR A;  5KHM A;  3P1C A;  5CQ5 A;  4YYJ A;  5JI8 A;  5IGM A;  2RO1 A;  5F3A A;  4YYM A;  4A9I A;  4QR3 A;  5HCL A;  4HXM A;  5CY9 A;  4BW4 A;  4NR8 A;  4C67 A;  5CUC A;  4CUT A;  2WP2 A;  4TQN A;  5FH6 A;  3QZS A;  5A5S A;  5IID A;  5F60 A;  5EWV A;  4A9O A;  4AKN A;  4YBT A;  5DBM A;  5AD3 A;  5CQA A;  5HEL A;  4QY4 A;  5ENG A;  3JVJ A;  5E9Y A;  4PS5 A;  3HMF A;  4ZW1 A;  5CUA A;  3MB3 A;  5BT5 A;  5HRW A;  4LC2 A;  5E3D A;  4YYN A;  4O72 A;  3U5M A;  5FE9 A;  5HEM A;  4HBW A;  3JVK A;  5KTU A;  5EIS A;  5FG4 A;  4NUE A;  3LQI A;  4MEO A;  5D7X A;  4UYD A;  1F68 A;  4UYF A;  5BT3 A;  3UV5 A;  4DON A;  5EQ1 A;  5EIC A;  4J0R A;  5EU1 A;  4QNS A;  5DFD A;  5EPS A;  5G4S A;  4J1P A;  4TU4 A;  3O37 A;  4O78 A;  5HLS A;  4NYW A;  2YEM A;  5HRV A;  2R0V A;  2DVV A;  4QSR A;  3S92 A;  5LKZ A;  3LQJ A;  2E3K A;  5CFW A;  4LYW A;  5AMF A;  5CQT A;  4UYH A;  4A9L A;  4PKL A;  4X2I A;  5L8U A;  5IGN A;  5TCM A;  4QYD A;  4NS5 A;  4N4H A;  4NR6 A;  5FE0 A;  5HRX A;  4YYG A;  4A9K A;  4N4I A;  4FLP A;  5D3S A;  5COI A;  3P1F A;  3SVF A;  5FG6 A;  4A9J A;  4N3W A;  5CP5 A;  4UYG A;  4PTB A;  2OUO A;  4QSP A;  4CLB A;  4NQN A;  3P1E A;  4KV1 A;  4F3I A;  2YDW A;  3MQM A;  5DKD A;  4CFK A;  3U5J A;  5HQ5 A;  5K29 A;  4YC9 A;  4BW1 A;  5E9M A;  5ENF A;  2DKW A;  4UIU A;  5H1T A;  4O75 A;  5DYC A;  5FH8 A;  4XUA A;  4LYI A;  3I3J A;  5LKT A;  4O70 A;  4CL9 A;  4OGJ A;  5D24 A;  5C85 A;  5AME A;  5C7N A;  5LVR A;  4TZ8 A;  4WHW A;  3UVX A;  5CZG A;  5ETD A;  4NUC A;  5FDZ A;  4QST A;  3AQA A;  5HFQ A;  4Z1Q A;  2RNW A;  3P5O A;  4YYD A;  5A82 A;  5FFV A;  5F36 A;  3MXF A;  4NRB A;  3JVL A;  4ZC9 A;  3LXJ A;  5EWH A;  5I83 A;  5LVQ A;  1E6I A;  4TYL A;  3U5N A;  4CUQ A;  5A5R A;  4TU6 A;  4A9H A;  5I40 A;  2DWW A;  4HBY A;  3MB4 A;  4HXS A;  4YAD A;  2MJV B;  5DYA A;  2FSA A;  2DAT A;  4LZR A;  3Q2F A;  3U5L A;  4NR7 A;  2GRC A;  3RCW A;  5ENH A;  5CS8 A;  4HXO A;  5F1H A;  4XUB A;  4NYX A;  1WUM A;  4YBM A;  2OO1 A;  4O7E A;  4QSV A;  4N4G A;  3U5K A;  3DAI A;  3FKM X;  4HXR A;  4HBV A;  5IG6 A;  4MR3 A;  5DFC A;  4LR6 A;  4WIV A;  2D9E A;  4QSX A;  2F6N A;  3UV4 A;  4HXN A;  5A5O A;  4HBX A;  4QSQ A;  2G4A A;  4QEV A;  4CUR A;  3UW9 A;  5FG5 A;  1JSP B;  5D3P A;  4PY6 A;  4O7F A;  2DVR A;  4NRC A;  5D3R A;  4HXP A;  4O71 A;  5H85 A;  2LSP B;  5F1L A;  5FBX A;  5FE3 A;  5F62 A;  5D3N A;  2OSS A;  4YY6 A;  4Z6I A;  4MEQ A;  5DKC A;  5CQ4 A;  5A81 A;  4C66 A;  5EP7 A;  5D3J A;  5L99 A;  5E7D A;  5EI4 A;  5EWW A;  3UV2 A;  1ZS5 A;  2YQD A;  3JVM A;  4YAB A;  5D0C A;  4Z6H A;  2RI7 A;  5ENI A;  2DVQ A;  5E0R A;  4IOR A;  5A83 A;  3SVG A;  2L85 A;  4LDF A;  5I7X A;  5C89 A;  3LQH A;  5LJ2 A;  5DYX A;  4QSU A;  5EV9 A;  5J0D A;  5CUE A;  3U5O A;  4A9F A;  4TS8 A;  3LJW A;  5IGL A;  5F61 A;  5C87 A;  5H1V A;  3P1D A;  4QUU A;  3SVH A;  5A85 A;  2I7K A;  4LYS A; 
#chains in the Genus database with same CATH topology
 4CUS A;  5FE5 A;  4XYA A;  4NR5 A;  4Y03 A;  4BJX A;  3Q2E A;  5I88 A;  4NR4 A;  5EK9 A;  3G0J A;  5TB6 A;  4IR5 A;  4KV4 A;  2YEK A;  4Q0N A;  5CRZ A;  4UYE A;  3IU5 A;  3O36 A;  4ALG A;  2YEL A;  4LRG A;  5ACY A;  5ENB A;  3ZYU A;  5E9K A;  5DLZ A;  5H1U A;  4O7C A;  4TT4 A;  3HMH A;  2RFJ A;  4O77 A;  5DW2 A;  4BW2 A;  3D7C A;  4GPJ A;  4UIT A;  4YK0 A;  5EM3 A;  5FB1 A;  4XY9 A;  5DW1 A;  5CQ6 A;  2D82 A;  5E73 A;  1ZKR A;  2L84 A;  4UIZ A;  5C4Q A;  5ENC A;  5LUU A;  4QEW A;  3U5P A;  5E9I A;  2E7O A;  3O34 A;  4ZQL A;  5FB0 A;  5LJ1 A;  3O35 A;  4IR6 A;  4J0S A;  4QR5 A;  4QUT A;  5C8G A;  4UIX A;  5CUG A;  4A9E A;  5CQ7 A;  2R10 A;  5L98 A;  5F25 A;  4YAT A;  5FH7 A;  4YYI A;  4O74 A;  5E9V A;  4QSW A;  5EWC A;  5FE1 A;  3K2J A;  4QC1 A;  5EGU A;  1N72 A;  5KU3 A;  4HXL A;  4QYL A;  5FE2 A;  4CUP A;  4Z1S A;  5F63 A;  5IBN A;  2I8N A;  3UVW A;  4YAX A;  5LKU A;  4XY8 A;  4A9M A;  5F5Z A;  4BW3 A;  4NXJ A;  5F2P A;  2RNX A;  5CRM A;  4O76 A;  5D26 A;  4KCX A;  4YH4 A;  4AKI A;  5CGP A;  4AKG A;  2RNY A;  4TT6 A;  4IR4 A;  5HM0 A;  5CU8 A;  5ETB A;  5II2 A;  5DYU A;  4YYH A;  4UIW A;  2R0Y A;  4ALH A;  5I86 A;  2N9G A;  4QC3 A;  3MUK A;  1EQF A;  4UIY A;  2RS9 B;  4QR4 A;  2F6J A;  4TTE A;  4NYV A;  1X0J A;  5D25 A;  5L97 A;  5CPE A;  5BT4 A;  4HXK A;  4A9N A;  4CUU A;  4MEP A;  2YYN A;  2DVS A;  5CTL A;  3MUL A;  5A5N A;  5KTX A;  5LJ0 A;  5IGK A;  4MR5 A;  5D3H A;  5AD2 A;  2L5E A;  5A5P A;  3DWY A;  2E7N A;  3TLP A;  2WP1 A;  2YW5 A;  5A7C A;  5KTW A;  2R0S A;  4QEU A;  5L96 A;  2NXB A;  4YBS A;  5HFR A;  3G0L A;  5DX4 A;  4UYF B;  5FFW A;  5I7Y A;  4IOO A;  2H60 A;  5I1Q A;  5DFB A;  4PCE A;  5D3L A;  4WHU A;  4LZS A;  5E9L A;  4QZS A;  3HME A;  4O7B A;  5EA1 A;  5I29 A;  4TZ2 A;  5HQ6 A;  5FE8 A;  4YH3 A;  3GG3 A;  5DKH A;  4OUF A;  5LKX A;  5HEN A;  4N4F A;  3AAD A;  4TT2 A;  5HJC A;  4NUD A;  5FE6 A;  3QZT A;  3O33 A;  3VKH A;  5DY7 A;  4NRA A;  5II1 A;  5CUD A;  5KO4 A;  5CUB A;  5FE4 A;  3IU6 A;  4MR6 A;  5G4R A;  3UVD A;  3UVY A;  3S91 A;  5EVA A;  4MEN A;  4IR3 A;  5ENJ A;  3QZV A;  4Z93 A;  4OGI A;  3ONI A;  5DLX A;  5FFY A;  4J3I A;  4QBM A;  5CQ3 A;  5EWD A;  5EPB A;  4UIV A;  4CFL A;  4E96 A;  5JWM A;  5I89 A;  3NXB A;  4NR9 A;  4QB3 A;  4MR4 A;  4Q0O A;  4RVR A;  4YYK A;  5HQ7 A;  2KTB B;  4BHW A;  2EJN A;  1JM4 B;  4QSS A;  4O7A A;  4YY4 A;  4IOQ A;  4PCI A;  5FE7 A;  5L8T A;  5ENE A;  1WUG A;  5E3G A;  5I80 A;  4LZ2 A;  5CQ8 A;  5D3T A;  5E74 A;  5A5Q A;  4NQM A;  5EPR A;  5KHM A;  3P1C A;  5CQ5 A;  4YYJ A;  5JI8 A;  5IGM A;  2RO1 A;  5F3A A;  4YYM A;  4A9I A;  4QR3 A;  5HCL A;  4HXM A;  5CY9 A;  4BW4 A;  4NR8 A;  4C67 A;  5CUC A;  4CUT A;  2WP2 A;  4TQN A;  5FH6 A;  3QZS A;  5A5S A;  5IID A;  5F60 A;  5EWV A;  4A9O A;  4AKN A;  4YBT A;  5DBM A;  5AD3 A;  5CQA A;  5HEL A;  4QY4 A;  5ENG A;  3JVJ A;  4AKH A;  5E9Y A;  4PS5 A;  3HMF A;  4ZW1 A;  5CUA A;  3MB3 A;  5BT5 A;  5HRW A;  4LC2 A;  5E3D A;  4YYN A;  4O72 A;  3U5M A;  5FE9 A;  5HEM A;  4HBW A;  3JVK A;  5KTU A;  5EIS A;  5FG4 A;  4NUE A;  3LQI A;  4MEO A;  3D1B A;  5D7X A;  4UYD A;  1F68 A;  4UYF A;  5BT3 A;  3UV5 A;  4DON A;  5EQ1 A;  5EIC A;  4J0R A;  5EU1 A;  4QNS A;  5DFD A;  5EPS A;  5G4S A;  4J1P A;  4TU4 A;  3O37 A;  4O78 A;  5HLS A;  4NYW A;  2YEM A;  5HRV A;  2R0V A;  2DVV A;  4QSR A;  3S92 A;  5LKZ A;  3LQJ A;  2E3K A;  5CFW A;  4LYW A;  5AMF A;  5CQT A;  4UYH A;  4A9L A;  4PKL A;  4X2I A;  5L8U A;  5IGN A;  5TCM A;  4QYD A;  4NS5 A;  4N4H A;  4NR6 A;  5FE0 A;  5HRX A;  4YYG A;  4A9K A;  4N4I A;  4FLP A;  5D3S A;  5COI A;  3P1F A;  3SVF A;  5FG6 A;  4A9J A;  4N3W A;  5CP5 A;  4UYG A;  4PTB A;  2OUO A;  4QSP A;  4CLB A;  4NQN A;  3P1E A;  4KV1 A;  4F3I A;  2YDW A;  3MQM A;  5DKD A;  4CFK A;  3U5J A;  5HQ5 A;  5K29 A;  4YC9 A;  4BW1 A;  5E9M A;  5ENF A;  2DKW A;  4UIU A;  5H1T A;  4O75 A;  5DYC A;  5FH8 A;  4XUA A;  4LYI A;  3I3J A;  5LKT A;  4O70 A;  4AI6 A;  4CL9 A;  4OGJ A;  5D24 A;  5C85 A;  5AME A;  5C7N A;  5LVR A;  4TZ8 A;  4WHW A;  3UVX A;  5CZG A;  5ETD A;  4NUC A;  5FDZ A;  4QST A;  3AQA A;  5HFQ A;  4Z1Q A;  2RNW A;  3P5O A;  4YYD A;  5A82 A;  5FFV A;  5F36 A;  3MXF A;  4NRB A;  3JVL A;  4ZC9 A;  3LXJ A;  5EWH A;  5I83 A;  5LVQ A;  1E6I A;  4TYL A;  3U5N A;  4CUQ A;  5A5R A;  4TU6 A;  4A9H A;  5I40 A;  2DWW A;  4HBY A;  3MB4 A;  4HXS A;  4YAD A;  2MJV B;  5DYA A;  2FSA A;  2DAT A;  4LZR A;  3Q2F A;  3U5L A;  4NR7 A;  2GRC A;  3RCW A;  5ENH A;  5CS8 A;  4HXO A;  5F1H A;  4XUB A;  4NYX A;  1WUM A;  4YBM A;  2OO1 A;  4O7E A;  4QSV A;  4N4G A;  3U5K A;  3DAI A;  3FKM X;  1PUO A;  4HXR A;  4HBV A;  5IG6 A;  4MR3 A;  5DFC A;  4LR6 A;  4WIV A;  2D9E A;  4QSX A;  2F6N A;  3UV4 A;  4HXN A;  5A5O A;  4HBX A;  4QSQ A;  2G4A A;  4QEV A;  4CUR A;  3UW9 A;  5FG5 A;  3VKG A;  1JSP B;  3D1D A;  4PY6 A;  4O7F A;  2DVR A;  4NRC A;  5D3P A;  4HXP A;  4O71 A;  5D3R A;  2LSP B;  5H85 A;  5F1L A;  5FBX A;  5FE3 A;  5F62 A;  5D3N A;  2OSS A;  4YY6 A;  4Z6I A;  4MEQ A;  5DKC A;  5CQ4 A;  5A81 A;  4C66 A;  5EP7 A;  5D3J A;  5L99 A;  5E7D A;  5EI4 A;  5EWW A;  3UV2 A;  1ZS5 A;  2YQD A;  3JVM A;  4YAB A;  5D0C A;  4Z6H A;  2RI7 A;  5ENI A;  2DVQ A;  5E0R A;  4IOR A;  5A83 A;  3SVG A;  2L85 A;  4LDF A;  5I7X A;  5C89 A;  3LQH A;  5LJ2 A;  5DYX A;  4QSU A;  5EV9 A;  5J0D A;  5CUE A;  3U5O A;  4A9F A;  4TS8 A;  3ERR A;  3LJW A;  5IGL A;  5F61 A;  5C87 A;  5H1V A;  3P1D A;  4QUU A;  3SVH A;  5A85 A;  2I7K A;  4LYS A; 
#chains in the Genus database with same CATH homology
 4CUS A;  5FE5 A;  4XYA A;  4NR5 A;  4Y03 A;  4BJX A;  3Q2E A;  5I88 A;  4NR4 A;  5EK9 A;  3G0J A;  5TB6 A;  4IR5 A;  4KV4 A;  2YEK A;  4Q0N A;  5CRZ A;  4UYE A;  3IU5 A;  3O36 A;  4ALG A;  2YEL A;  4LRG A;  5ACY A;  5ENB A;  3ZYU A;  5E9K A;  5DLZ A;  5H1U A;  4O7C A;  4TT4 A;  3HMH A;  2RFJ A;  4O77 A;  5DW2 A;  4BW2 A;  3D7C A;  4GPJ A;  4UIT A;  4YK0 A;  5EM3 A;  5FB1 A;  4XY9 A;  5DW1 A;  5CQ6 A;  2D82 A;  5E73 A;  2L84 A;  4UIZ A;  5C4Q A;  5ENC A;  5LUU A;  4QEW A;  3U5P A;  5E9I A;  2E7O A;  3O34 A;  4ZQL A;  5FB0 A;  5LJ1 A;  3O35 A;  4IR6 A;  4J0S A;  4QR5 A;  4QUT A;  5C8G A;  4UIX A;  5CUG A;  4A9E A;  5CQ7 A;  2R10 A;  5L98 A;  5F25 A;  4YAT A;  5FH7 A;  4YYI A;  4O74 A;  5E9V A;  4QSW A;  5EWC A;  5FE1 A;  3K2J A;  4QC1 A;  5EGU A;  1N72 A;  5KU3 A;  4HXL A;  4QYL A;  5FE2 A;  4CUP A;  4Z1S A;  5F63 A;  5IBN A;  2I8N A;  3UVW A;  4YAX A;  5LKU A;  4XY8 A;  4A9M A;  5F5Z A;  4BW3 A;  4NXJ A;  5F2P A;  2RNX A;  5CRM A;  4O76 A;  5D26 A;  4KCX A;  4YH4 A;  5CGP A;  2RNY A;  4TT6 A;  4IR4 A;  5HM0 A;  5CU8 A;  5ETB A;  5II2 A;  5DYU A;  4YYH A;  4UIW A;  2R0Y A;  4ALH A;  5I86 A;  2N9G A;  4QC3 A;  3MUK A;  1EQF A;  4UIY A;  2RS9 B;  4QR4 A;  2F6J A;  4TTE A;  4NYV A;  1X0J A;  5D25 A;  5L97 A;  5CPE A;  5BT4 A;  4HXK A;  4A9N A;  4CUU A;  4MEP A;  2YYN A;  2DVS A;  5CTL A;  3MUL A;  5A5N A;  5KTX A;  5LJ0 A;  5IGK A;  4MR5 A;  5D3H A;  5AD2 A;  2L5E A;  5A5P A;  3DWY A;  2E7N A;  3TLP A;  2WP1 A;  2YW5 A;  5A7C A;  5KTW A;  2R0S A;  4QEU A;  5L96 A;  2NXB A;  4YBS A;  5HFR A;  3G0L A;  5DX4 A;  4UYF B;  5FFW A;  5I7Y A;  4IOO A;  2H60 A;  5I1Q A;  5DFB A;  4PCE A;  5D3L A;  4WHU A;  4LZS A;  5E9L A;  4QZS A;  3HME A;  4O7B A;  5EA1 A;  5I29 A;  4TZ2 A;  5HQ6 A;  5FE8 A;  4YH3 A;  3GG3 A;  5DKH A;  4OUF A;  5LKX A;  5HEN A;  4N4F A;  3AAD A;  4TT2 A;  5HJC A;  4NUD A;  5FE6 A;  3QZT A;  3O33 A;  5DY7 A;  4NRA A;  5II1 A;  5CUD A;  5KO4 A;  5CUB A;  5FE4 A;  3IU6 A;  4MR6 A;  5G4R A;  3UVD A;  3UVY A;  3S91 A;  5EVA A;  4MEN A;  4IR3 A;  5ENJ A;  3QZV A;  4Z93 A;  4OGI A;  3ONI A;  5DLX A;  5FFY A;  4J3I A;  4QBM A;  5CQ3 A;  5EWD A;  5EPB A;  4UIV A;  4CFL A;  4E96 A;  5JWM A;  5I89 A;  3NXB A;  4NR9 A;  4QB3 A;  4MR4 A;  4Q0O A;  4RVR A;  4YYK A;  5HQ7 A;  2KTB B;  4BHW A;  1JM4 B;  4QSS A;  4O7A A;  4YY4 A;  4IOQ A;  4PCI A;  5FE7 A;  5L8T A;  5ENE A;  1WUG A;  5E3G A;  5I80 A;  4LZ2 A;  5CQ8 A;  5D3T A;  5E74 A;  5A5Q A;  4NQM A;  5EPR A;  5KHM A;  3P1C A;  5CQ5 A;  4YYJ A;  5JI8 A;  5IGM A;  2RO1 A;  5F3A A;  4YYM A;  4A9I A;  4QR3 A;  5HCL A;  4HXM A;  5CY9 A;  4BW4 A;  4NR8 A;  4C67 A;  5CUC A;  4CUT A;  2WP2 A;  4TQN A;  5FH6 A;  3QZS A;  5A5S A;  5IID A;  5F60 A;  5EWV A;  4A9O A;  4AKN A;  4YBT A;  5DBM A;  5AD3 A;  5CQA A;  5HEL A;  4QY4 A;  5ENG A;  3JVJ A;  5E9Y A;  4PS5 A;  3HMF A;  4ZW1 A;  5CUA A;  3MB3 A;  5BT5 A;  5HRW A;  4LC2 A;  5E3D A;  4YYN A;  4O72 A;  3U5M A;  5FE9 A;  5HEM A;  4HBW A;  3JVK A;  5KTU A;  5EIS A;  5FG4 A;  4NUE A;  3LQI A;  4MEO A;  5D7X A;  4UYD A;  1F68 A;  4UYF A;  5BT3 A;  3UV5 A;  4DON A;  5EQ1 A;  5EIC A;  4J0R A;  5EU1 A;  4QNS A;  5DFD A;  5EPS A;  5G4S A;  4J1P A;  4TU4 A;  3O37 A;  4O78 A;  5HLS A;  4NYW A;  2YEM A;  5HRV A;  2R0V A;  2DVV A;  4QSR A;  3S92 A;  5LKZ A;  3LQJ A;  2E3K A;  5CFW A;  4LYW A;  5AMF A;  5CQT A;  4UYH A;  4A9L A;  4PKL A;  4X2I A;  5L8U A;  5IGN A;  5TCM A;  4QYD A;  4NS5 A;  4N4H A;  4NR6 A;  5FE0 A;  5HRX A;  4YYG A;  4A9K A;  4N4I A;  4FLP A;  5D3S A;  5COI A;  3P1F A;  3SVF A;  5FG6 A;  4A9J A;  4N3W A;  5CP5 A;  4UYG A;  4PTB A;  2OUO A;  4QSP A;  4CLB A;  4NQN A;  3P1E A;  4KV1 A;  4F3I A;  2YDW A;  3MQM A;  5DKD A;  4CFK A;  3U5J A;  5HQ5 A;  5K29 A;  4YC9 A;  4BW1 A;  5E9M A;  5ENF A;  2DKW A;  4UIU A;  5H1T A;  4O75 A;  5DYC A;  5FH8 A;  4XUA A;  4LYI A;  3I3J A;  5LKT A;  4O70 A;  4CL9 A;  4OGJ A;  5D24 A;  5C85 A;  5AME A;  5C7N A;  5LVR A;  4TZ8 A;  4WHW A;  3UVX A;  5CZG A;  5ETD A;  4NUC A;  5FDZ A;  4QST A;  3AQA A;  5HFQ A;  4Z1Q A;  2RNW A;  3P5O A;  4YYD A;  5A82 A;  5FFV A;  5F36 A;  3MXF A;  4NRB A;  3JVL A;  4ZC9 A;  3LXJ A;  5EWH A;  5I83 A;  5LVQ A;  1E6I A;  4TYL A;  3U5N A;  4CUQ A;  5A5R A;  4TU6 A;  4A9H A;  5I40 A;  2DWW A;  4HBY A;  3MB4 A;  4HXS A;  4YAD A;  2MJV B;  5DYA A;  2FSA A;  2DAT A;  4LZR A;  3Q2F A;  3U5L A;  4NR7 A;  2GRC A;  3RCW A;  5ENH A;  5CS8 A;  4HXO A;  5F1H A;  4XUB A;  4NYX A;  1WUM A;  4YBM A;  2OO1 A;  4O7E A;  4QSV A;  4N4G A;  3U5K A;  3DAI A;  3FKM X;  4HXR A;  4HBV A;  5IG6 A;  4MR3 A;  5DFC A;  4LR6 A;  4WIV A;  2D9E A;  4QSX A;  2F6N A;  3UV4 A;  4HXN A;  5A5O A;  4HBX A;  4QSQ A;  2G4A A;  4QEV A;  4CUR A;  3UW9 A;  5FG5 A;  1JSP B;  5D3P A;  4PY6 A;  4O7F A;  2DVR A;  4NRC A;  5D3R A;  4HXP A;  4O71 A;  5H85 A;  2LSP B;  5F1L A;  5FBX A;  5FE3 A;  5F62 A;  5D3N A;  2OSS A;  4YY6 A;  4Z6I A;  4MEQ A;  5DKC A;  5CQ4 A;  5A81 A;  4C66 A;  5EP7 A;  5D3J A;  5L99 A;  5E7D A;  5EI4 A;  5EWW A;  3UV2 A;  1ZS5 A;  2YQD A;  3JVM A;  4YAB A;  5D0C A;  4Z6H A;  2RI7 A;  5ENI A;  2DVQ A;  5E0R A;  4IOR A;  5A83 A;  3SVG A;  2L85 A;  4LDF A;  5I7X A;  5C89 A;  3LQH A;  5LJ2 A;  5DYX A;  4QSU A;  5EV9 A;  5J0D A;  5CUE A;  3U5O A;  4A9F A;  4TS8 A;  3LJW A;  5IGL A;  5F61 A;  5C87 A;  5H1V A;  3P1D A;  4QUU A;  3SVH A;  5A85 A;  2I7K A;  4LYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...