4Q0OA

Crystal structure of the fifth bromodomain of human poly-bromodomain containing protein 1 (pb1) in complex with a hydroxyphenyl-propenone ligand
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein polybromo-1
publication title Crystal Structure of the fifth bromodomain of Human Poly-bromodomain containing protein 1 (PB1) in complex with a hydroxyphenyl-propenone ligand
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 36
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2014-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4q0oA00
3AADA 5D3HA 2NXBA 2DATA 5CQ7A 2DVQA 5F3AA 5DFBA 5JI8A 2N9GA 5EPBA 1ZS5A 4QSSA 4A9FA 5HQ7A 2R0VA 2RNWA 5E9KA 4YYDA 5BT5A 4Z6HA 4XUBA 5EWWA 2RI7A 4TU6A 1X0JA 4UYHA 5F36A 2R0SA 4YATA 2F6JA 5F2PA 5E3GA 2RO1A 3U5MA 2DWWA 5DKDA 3SVFA 5ENCA 2YYNA 4PKLA 5LJ1A 5EWVA 2YDWA 5E74A 4J0RA 4UYDA 5CUGA 5C85A 5HFRA 4UITA 4TT4A 4QSRA 5F63A 5K29A 4O77A 4N4HA 5D7XA 2D82A 4YH3A 5TCMA 4A9JA 3K2JA 5F61A 5LKUA 4QSQA 5F62A 5FFVA 3UVDA 4NR6A 5BT3A 5I86A 5COIA 4QEWA 5IGLA 4BW1A 1WUMA 4YAXA 4HBWA 3AQAA 5AD2A 4MR3A 5I88A 4PY6A 5EWCA 2YELA 4BHWA 4FLPA 3JVKA 4UIWA 1JM4B 3UVXA 5I80A 4HXKA 3MB3A 4YYJA 2DVRA 4QB3A 4NRAA 5KU3A 4DONA 4CL9A 5EPRA 2KTBB 5BT4A 5HRXA 5CUDA 5LJ2A 5DBMA 2E3KA 4WIVA 4KCXA 4UIUA 5II2A 4O71A 4XYAA 5ENHA 3QZTA 4NRBA 2R10A 4O75A 4O7AA 5L98A 5J0DA 3O33A 5FE3A 5KO4A 5L8TA 4MEPA 5A5SA 4QSTA 3S91A 4O72A 2OUOA 5E9YA 5E9VA 2GRCA 5FE8A 5FG6A 5E9MA 4QY4A 5DKCA 4WHUA 5I83A 2RNXA 2DVSA 5F60A 5HLSA 4YH4A 4HXPA 4QC1A 2RNYA 5F25A 3U5PA 5FE6A 3DAIA 4HXNA 5H1TA 5A81A 4NUEA 4QUUA 5HM0A 4UIYA 5D24A 5DYUA 5H85A 4OUFA 3IU6A 5A5NA 5CTLA 4KV1A 4YYNA 5HENA 4PS5A 3MULA 5EPSA 5E3DA 3UW9A 4YABA 2DVVA 2WP1A 4YBTA 2I7KA 4NRCA 5C4QA 4TTEA 4BW4A 5FFWA 4N4GA 4O78A 4J3IA 4LYWA 4QSPA 3HMFA 2FSAA 5DW1A 4UYFA 5TB6A 4NYXA 4C66A 3HMEA 4YK0A 3MB4A 3IU5A 5CUCA 4YADA 5ACYA 4YBMA 5EP7A 3NXBA 5LVRA 4UIVA 4CUSA 3LQHA 4HXSA 4Q0OA 4Q0NA 4QBMA 4QSVA 4A9KA 3P1EA 4J1PA 5CP5A 5FE4A 4NQNA 4BJXA 5HEMA 4YYGA 5A5QA 4GPJA 3QZVA 4QNSA 4IORA 4MR4A 4Z6IA 4HXMA 5IGMA 5CQ4A 4NR4A 3UV4A 5EU1A 2L84A 2OO1A 4IR4A 5G4SA 4QSUA 3U5OA 5CRZA 5KTUA 4BW3A 3FKMX 5LKZA 4PTBA 5L97A 3UV2A 5F1HA 4YYHA 1N72A 5HQ5A 4LDFA 4CLBA 3Q2FA 5CFWA 5F1LA 3GG3A 4QSWA 5E9LA 4LZ2A 4A9LA 4X2IA 5DW2A 4HBYA 3P1FA 5AMFA 2RS9B 4IR3A 5KTWA 5DX4A 4Z1QA 3G0LA 5C8GA 5KHMA 2YW5A 5CGPA 5E73A 5CQ3A 3MXFA 4CUQA 5CUEA 4NR5A 3O37A 4HXRA 5HCLA 3JVLA 5DY7A 5FE7A 5C89A 4MEQA 3ZYUA 4XY8A 5I29A 2G4AA 5E7DA 4LC2A 4O7EA 4NUCA 2L5EA 4QZSA 5HQ6A 4IR5A 4TQNA 1EQFA 5IG6A 5D3PA 1E6IA 5IIDA 4NS5A 5FG4A 2F6NA 4CUUA 2WP2A 3SVGA 3RCWA 4LRGA 5EVAA 5CQ6A 4TT2A 5ENJA 3O36A 2YEKA 5CZGA 5FE0A 5ENIA 5E0RA 5FFYA 4MR6A 5EK9A 5FE1A 4TS8A 5HJCA 5FE5A 5I7XA 4YY6A 4OGJA 5C87A 4NXJA 4YC9A 5A5RA 3UVWA 4F3IA 5ETDA 5LVQA 1F68A 5DLXA 3QZSA 4PCIA 4MEOA 4NR9A 4YYKA 5EV9A 5CQ5A 4QR5A 3TLPA 3S92A 4A9OA 5FE2A 4A9EA 5D25A 4CURA 5DYAA 3MQMA 5I7YA 3D7CA 5L8UA 5AD3A 4QEVA 5LJ0A 4LZSA 4IOOA 5HRVA 4LYSA 5I40A 5LKXA 3UVYA 5FB0A 3ONIA 3I3JA 3O35A 4Y03A 5CQTA 4Z1SA 5A7CA 5CPEA 5HRWA 3JVJA 4TYLA 5DFDA 5IGKA 4NYWA 4O76A 5A83A 5CUBA 4QR4A 5I1QA 5HELA 1WUGA 2L85A 4J0SA 4N3WA 5II1A 4C67A 4WHWA 3UV5A 4QC3A 2R0YA 5JWMA 5LKTA 5EI4A 5D3SA 5KTXA 4XUAA 2LSPB 3U5JA 5EWHA 5LUUA 5DFCA 3LQJA 5DKHA 5EM3A 5DYCA 4TU4A 5FB1A 3U5KA 4XY9A 4UYGA 4A9IA 4UYEA 5DYXA 5L96A 5EA1A 1JSPB 4O70A 2E7NA 2H60A 4NUDA 4YBSA 5G4RA 4A9NA 5H1VA 4HBVA 4IOQA 5FH8A 4RVRA 5EISA 2DKWA 5EICA 5FH7A 4KV4A 4QR3A 5FDZA 5CRMA 4MR5A 4UYFB 5A5PA 4HXOA 4PCEA 4ZC9A 5H1UA 3JVMA 5CS8A 4Z93A 4TT6A 5FBXA 4O74A 5E9IA 5I89A 4HBXA 5EGUA 5D3RA 4N4FA 3SVHA 5ENBA 5F5ZA 4LZRA 3Q2EA 4O7BA 4TZ8A 4ALHA 4CFLA 4NR7A 4OGIA 4QSXA 4O7FA 5L99A 4LR6A 4CUPA 5FE9A 2MJVB 4LYIA 2YEMA 5A85A 5DLZA 3LQIA 3LXJA 4AKNA 5D3JA 4A9MA 5CQAA 4NR8A 4IR6A 4QEUA 5CUAA 2OSSA 5CU8A 4YY4A 2RFJA 5ENGA 2I8NA 4QYDA 4BW2A 4E96A 5ETBA 3U5LA 4QUTA 5CQ8A 5HFQA 4CUTA 2D9EA 5EQ1A 5CY9A 4N4IA 4O7CA 5D3TA 5ENFA 3G0JA 4ALGA 5D0CA 3MUKA 4HXLA 2E7OA 4UIXA 4QYLA 5FG5A 3U5NA 5D26A 4NQMA 5C7NA 3P5OA 5A5OA 4ZQLA 5A82A 4YYMA 4YYIA 3O34A 4ZW1A 4A9HA 3DWYA 4MENA 4CFKA 3HMHA 5D3LA 5IGNA 5IBNA 5FH6A 5ENEA 3P1CA 3P1DA 5EWDA 4TZ2A 4UIZA 3LJWA 5D3NA 5AMEA 4NYVA 2YQDA
chains in the Genus database with same CATH superfamily
3AADA 5D3HA 2NXBA 2DATA 5CQ7A 3VKHA 2DVQA 5F3AA 5DFBA 5JI8A 2N9GA 5EPBA 1ZS5A 4QSSA 4A9FA 5HQ7A 2R0VA 2RNWA 2EJNA 5E9KA 4YYDA 5BT5A 4Z6HA 4XUBA 5EWWA 2RI7A 4TU6A 1X0JA 4UYHA 5F36A 2R0SA 4YATA 2F6JA 5F2PA 5E3GA 3VKGA 2RO1A 3U5MA 2DWWA 5DKDA 3SVFA 5ENCA 2YYNA 4PKLA 5LJ1A 5EWVA 2YDWA 5E74A 4J0RA 4UYDA 5CUGA 5C85A 5HFRA 4UITA 4TT4A 4QSRA 5F63A 5K29A 4O77A 4N4HA 5D7XA 2D82A 4YH3A 5TCMA 4A9JA 3K2JA 5F61A 5LKUA 4QSQA 5F62A 5FFVA 3UVDA 4NR6A 5BT3A 5I86A 5COIA 4QEWA 5IGLA 4BW1A 1WUMA 4YAXA 4HBWA 3AQAA 5AD2A 4MR3A 5I88A 4PY6A 5EWCA 2YELA 4BHWA 4FLPA 3JVKA 4UIWA 1JM4B 3UVXA 5I80A 4HXKA 3MB3A 4YYJA 2DVRA 4QB3A 4NRAA 5KU3A 4DONA 4CL9A 5EPRA 2KTBB 5BT4A 5HRXA 5CUDA 5LJ2A 5DBMA 2E3KA 4WIVA 4KCXA 4UIUA 5II2A 4O71A 4XYAA 5ENHA 3QZTA 4NRBA 2R10A 4O75A 4O7AA 5L98A 5J0DA 3O33A 5FE3A 5KO4A 5L8TA 4MEPA 5A5SA 4QSTA 3S91A 4O72A 2OUOA 5E9YA 5E9VA 2GRCA 5FE8A 5FG6A 5E9MA 4QY4A 5DKCA 4WHUA 5I83A 2RNXA 2DVSA 5F60A 5HLSA 4YH4A 4HXPA 4QC1A 2RNYA 5F25A 3U5PA 5FE6A 3DAIA 4HXNA 5H1TA 4AI6A 1PUOA 5A81A 4NUEA 4QUUA 5HM0A 4UIYA 5D24A 5DYUA 5H85A 4OUFA 3IU6A 5A5NA 5CTLA 4KV1A 4YYNA 5HENA 4PS5A 3MULA 5EPSA 5E3DA 3UW9A 4YABA 2DVVA 2WP1A 4YBTA 2I7KA 4NRCA 5C4QA 3D1BA 4TTEA 4BW4A 5FFWA 4N4GA 4O78A 4J3IA 4LYWA 4QSPA 3HMFA 2FSAA 5DW1A 4UYFA 5TB6A 4NYXA 4C66A 3HMEA 4YK0A 3MB4A 3IU5A 5CUCA 4YADA 5ACYA 4YBMA 5EP7A 3NXBA 5LVRA 4UIVA 4CUSA 3LQHA 4HXSA 4Q0OA 4Q0NA 4QBMA 4QSVA 4A9KA 3P1EA 4J1PA 5CP5A 5FE4A 4NQNA 4BJXA 5HEMA 4YYGA 5A5QA 4GPJA 3QZVA 4QNSA 4IORA 4MR4A 4Z6IA 4HXMA 5IGMA 5CQ4A 4NR4A 3UV4A 5EU1A 2L84A 2OO1A 4IR4A 5G4SA 4QSUA 3U5OA 5CRZA 5KTUA 4BW3A 3FKMX 5LKZA 4PTBA 5L97A 3UV2A 5F1HA 4YYHA 1N72A 5HQ5A 4LDFA 4CLBA 3Q2FA 5CFWA 5F1LA 3GG3A 4QSWA 5E9LA 4LZ2A 4A9LA 4X2IA 5DW2A 4HBYA 3P1FA 5AMFA 2RS9B 4IR3A 5KTWA 5DX4A 4Z1QA 3G0LA 5C8GA 5KHMA 2YW5A 5CGPA 5E73A 5CQ3A 4AKIA 3MXFA 4CUQA 5CUEA 4NR5A 3O37A 4HXRA 5HCLA 3JVLA 5DY7A 5FE7A 5C89A 4MEQA 3ZYUA 4XY8A 5I29A 2G4AA 5E7DA 4LC2A 4O7EA 4NUCA 2L5EA 4QZSA 5HQ6A 4IR5A 4TQNA 1EQFA 5IG6A 5D3PA 1E6IA 5IIDA 4NS5A 5FG4A 2F6NA 4CUUA 2WP2A 3SVGA 3RCWA 4LRGA 5EVAA 5CQ6A 4TT2A 5ENJA 3O36A 2YEKA 5CZGA 5FE0A 5ENIA 5E0RA 5FFYA 4MR6A 5EK9A 5FE1A 4TS8A 5HJCA 5FE5A 5I7XA 4YY6A 4OGJA 5C87A 4NXJA 4YC9A 5A5RA 3UVWA 4F3IA 5ETDA 5LVQA 1F68A 5DLXA 3QZSA 4PCIA 4MEOA 4NR9A 4YYKA 5EV9A 5CQ5A 4QR5A 3TLPA 3S92A 4A9OA 5FE2A 4A9EA 5D25A 4CURA 5DYAA 3MQMA 5I7YA 3ERRA 3D7CA 5L8UA 5AD3A 4QEVA 5LJ0A 4LZSA 4IOOA 5HRVA 4LYSA 5I40A 5LKXA 3UVYA 5FB0A 3ONIA 3I3JA 3O35A 4Y03A 5CQTA 4Z1SA 5A7CA 5CPEA 5HRWA 3JVJA 4TYLA 5DFDA 5IGKA 4NYWA 4O76A 5A83A 5CUBA 4QR4A 5I1QA 5HELA 1WUGA 2L85A 4J0SA 4N3WA 5II1A 4C67A 4WHWA 3UV5A 4QC3A 2R0YA 5JWMA 5LKTA 5EI4A 5D3SA 5KTXA 1ZKRA 4XUAA 2LSPB 3U5JA 5EWHA 5LUUA 5DFCA 3LQJA 5DKHA 5EM3A 5DYCA 4TU4A 5FB1A 3U5KA 4XY9A 4UYGA 4A9IA 4UYEA 5DYXA 5L96A 5EA1A 1JSPB 4O70A 2E7NA 2H60A 4NUDA 4YBSA 5G4RA 4A9NA 5H1VA 4HBVA 4IOQA 5FH8A 4RVRA 5EISA 2DKWA 5EICA 5FH7A 4KV4A 4QR3A 5FDZA 5CRMA 4MR5A 4UYFB 5A5PA 4HXOA 4PCEA 4ZC9A 5H1UA 3JVMA 5CS8A 4Z93A 4TT6A 5FBXA 4O74A 5E9IA 5I89A 4HBXA 5EGUA 5D3RA 4N4FA 3SVHA 5ENBA 5F5ZA 4LZRA 3Q2EA 4O7BA 4TZ8A 4ALHA 4CFLA 4NR7A 4OGIA 4QSXA 4O7FA 5L99A 4LR6A 4CUPA 5FE9A 2MJVB 4LYIA 2YEMA 5A85A 5DLZA 3LQIA 3LXJA 4AKNA 4AKHA 5D3JA 4A9MA 5CQAA 4NR8A 4IR6A 4QEUA 5CUAA 2OSSA 5CU8A 4YY4A 2RFJA 5ENGA 2I8NA 4QYDA 4BW2A 4E96A 5ETBA 3U5LA 4QUTA 5CQ8A 5HFQA 4CUTA 2D9EA 5EQ1A 5CY9A 4N4IA 4O7CA 5D3TA 5ENFA 3G0JA 4ALGA 3D1DA 5D0CA 3MUKA 4HXLA 2E7OA 4UIXA 4QYLA 5FG5A 3U5NA 5D26A 4NQMA 5C7NA 3P5OA 5A5OA 4ZQLA 5A82A 4YYMA 4YYIA 3O34A 4ZW1A 4A9HA 3DWYA 4MENA 4CFKA 3HMHA 5D3LA 5IGNA 5IBNA 5FH6A 5ENEA 3P1CA 4AKGA 3P1DA 5EWDA 4TZ2A 4UIZA 3LJWA 5D3NA 5AMEA 4NYVA 2YQDA
chains in the Genus database with same CATH topology
3AADA 5D3HA 2NXBA 2DATA 5CQ7A 2DVQA 5F3AA 5DFBA 5JI8A 2N9GA 5EPBA 1ZS5A 4QSSA 4A9FA 5HQ7A 2R0VA 2RNWA 5E9KA 4YYDA 5BT5A 4Z6HA 4XUBA 5EWWA 2RI7A 4TU6A 1X0JA 4UYHA 5F36A 2R0SA 4YATA 2F6JA 5F2PA 5E3GA 2RO1A 3U5MA 2DWWA 5DKDA 3SVFA 5ENCA 2YYNA 4PKLA 5LJ1A 5EWVA 2YDWA 5E74A 4J0RA 4UYDA 5CUGA 5C85A 5HFRA 4UITA 4TT4A 4QSRA 5F63A 5K29A 4O77A 4N4HA 5D7XA 2D82A 4YH3A 5TCMA 4A9JA 3K2JA 5F61A 5LKUA 4QSQA 5F62A 5FFVA 3UVDA 4NR6A 5BT3A 5I86A 5COIA 4QEWA 5IGLA 4BW1A 1WUMA 4YAXA 4HBWA 3AQAA 5AD2A 4MR3A 5I88A 4PY6A 5EWCA 2YELA 4BHWA 4FLPA 3JVKA 4UIWA 1JM4B 3UVXA 5I80A 4HXKA 3MB3A 4YYJA 2DVRA 4QB3A 4NRAA 5KU3A 4DONA 4CL9A 5EPRA 2KTBB 5BT4A 5HRXA 5CUDA 5LJ2A 5DBMA 2E3KA 4WIVA 4KCXA 4UIUA 5II2A 4O71A 4XYAA 5ENHA 3QZTA 4NRBA 2R10A 4O75A 4O7AA 5L98A 5J0DA 3O33A 5FE3A 5KO4A 5L8TA 4MEPA 5A5SA 4QSTA 3S91A 4O72A 2OUOA 5E9YA 5E9VA 2GRCA 5FE8A 5FG6A 5E9MA 4QY4A 5DKCA 4WHUA 5I83A 2RNXA 2DVSA 5F60A 5HLSA 4YH4A 4HXPA 4QC1A 2RNYA 5F25A 3U5PA 5FE6A 3DAIA 4HXNA 5H1TA 5A81A 4NUEA 4QUUA 5HM0A 4UIYA 5D24A 5DYUA 5H85A 4OUFA 3IU6A 5A5NA 5CTLA 4KV1A 4YYNA 5HENA 4PS5A 3MULA 5EPSA 5E3DA 3UW9A 4YABA 2DVVA 2WP1A 4YBTA 2I7KA 4NRCA 5C4QA 4TTEA 4BW4A 5FFWA 4N4GA 4O78A 4J3IA 4LYWA 4QSPA 3HMFA 2FSAA 5DW1A 4UYFA 5TB6A 4NYXA 4C66A 3HMEA 4YK0A 3MB4A 3IU5A 5CUCA 4YADA 5ACYA 4YBMA 5EP7A 3NXBA 5LVRA 4UIVA 4CUSA 3LQHA 4HXSA 4Q0OA 4Q0NA 4QBMA 4QSVA 4A9KA 3P1EA 4J1PA 5CP5A 5FE4A 4NQNA 4BJXA 5HEMA 4YYGA 5A5QA 4GPJA 3QZVA 4QNSA 4IORA 4MR4A 4Z6IA 4HXMA 5IGMA 5CQ4A 4NR4A 3UV4A 5EU1A 2L84A 2OO1A 4IR4A 5G4SA 4QSUA 3U5OA 5CRZA 5KTUA 4BW3A 3FKMX 5LKZA 4PTBA 5L97A 3UV2A 5F1HA 4YYHA 1N72A 5HQ5A 4LDFA 4CLBA 3Q2FA 5CFWA 5F1LA 3GG3A 4QSWA 5E9LA 4LZ2A 4A9LA 4X2IA 5DW2A 4HBYA 3P1FA 5AMFA 2RS9B 4IR3A 5KTWA 5DX4A 4Z1QA 3G0LA 5C8GA 5KHMA 2YW5A 5CGPA 5E73A 5CQ3A 3MXFA 4CUQA 5CUEA 4NR5A 3O37A 4HXRA 5HCLA 3JVLA 5DY7A 5FE7A 5C89A 4MEQA 3ZYUA 4XY8A 5I29A 2G4AA 5E7DA 4LC2A 4O7EA 4NUCA 2L5EA 4QZSA 5HQ6A 4IR5A 4TQNA 1EQFA 5IG6A 5D3PA 1E6IA 5IIDA 4NS5A 5FG4A 2F6NA 4CUUA 2WP2A 3SVGA 3RCWA 4LRGA 5EVAA 5CQ6A 4TT2A 5ENJA 3O36A 2YEKA 5CZGA 5FE0A 5ENIA 5E0RA 5FFYA 4MR6A 5EK9A 5FE1A 4TS8A 5HJCA 5FE5A 5I7XA 4YY6A 4OGJA 5C87A 4NXJA 4YC9A 5A5RA 3UVWA 4F3IA 5ETDA 5LVQA 1F68A 5DLXA 3QZSA 4PCIA 4MEOA 4NR9A 4YYKA 5EV9A 5CQ5A 4QR5A 3TLPA 3S92A 4A9OA 5FE2A 4A9EA 5D25A 4CURA 5DYAA 3MQMA 5I7YA 3D7CA 5L8UA 5AD3A 4QEVA 5LJ0A 4LZSA 4IOOA 5HRVA 4LYSA 5I40A 5LKXA 3UVYA 5FB0A 3ONIA 3I3JA 3O35A 4Y03A 5CQTA 4Z1SA 5A7CA 5CPEA 5HRWA 3JVJA 4TYLA 5DFDA 5IGKA 4NYWA 4O76A 5A83A 5CUBA 4QR4A 5I1QA 5HELA 1WUGA 2L85A 4J0SA 4N3WA 5II1A 4C67A 4WHWA 3UV5A 4QC3A 2R0YA 5JWMA 5LKTA 5EI4A 5D3SA 5KTXA 4XUAA 2LSPB 3U5JA 5EWHA 5LUUA 5DFCA 3LQJA 5DKHA 5EM3A 5DYCA 4TU4A 5FB1A 3U5KA 4XY9A 4UYGA 4A9IA 4UYEA 5DYXA 5L96A 5EA1A 1JSPB 4O70A 2E7NA 2H60A 4NUDA 4YBSA 5G4RA 4A9NA 5H1VA 4HBVA 4IOQA 5FH8A 4RVRA 5EISA 2DKWA 5EICA 5FH7A 4KV4A 4QR3A 5FDZA 5CRMA 4MR5A 4UYFB 5A5PA 4HXOA 4PCEA 4ZC9A 5H1UA 3JVMA 5CS8A 4Z93A 4TT6A 5FBXA 4O74A 5E9IA 5I89A 4HBXA 5EGUA 5D3RA 4N4FA 3SVHA 5ENBA 5F5ZA 4LZRA 3Q2EA 4O7BA 4TZ8A 4ALHA 4CFLA 4NR7A 4OGIA 4QSXA 4O7FA 5L99A 4LR6A 4CUPA 5FE9A 2MJVB 4LYIA 2YEMA 5A85A 5DLZA 3LQIA 3LXJA 4AKNA 5D3JA 4A9MA 5CQAA 4NR8A 4IR6A 4QEUA 5CUAA 2OSSA 5CU8A 4YY4A 2RFJA 5ENGA 2I8NA 4QYDA 4BW2A 4E96A 5ETBA 3U5LA 4QUTA 5CQ8A 5HFQA 4CUTA 2D9EA 5EQ1A 5CY9A 4N4IA 4O7CA 5D3TA 5ENFA 3G0JA 4ALGA 5D0CA 3MUKA 4HXLA 2E7OA 4UIXA 4QYLA 5FG5A 3U5NA 5D26A 4NQMA 5C7NA 3P5OA 5A5OA 4ZQLA 5A82A 4YYMA 4YYIA 3O34A 4ZW1A 4A9HA 3DWYA 4MENA 4CFKA 3HMHA 5D3LA 5IGNA 5IBNA 5FH6A 5ENEA 3P1CA 3P1DA 5EWDA 4TZ2A 4UIZA 3LJWA 5D3NA 5AMEA 4NYVA 2YQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAD A;  5D3H A;  2NXB A;  2DAT A;  5CQ7 A;  2DVQ A;  5F3A A;  5DFB A;  5JI8 A;  2N9G A;  5EPB A;  1ZS5 A;  4QSS A;  4A9F A;  5HQ7 A;  2R0V A;  2RNW A;  5E9K A;  4YYD A;  5BT5 A;  4Z6H A;  4XUB A;  5EWW A;  2RI7 A;  4TU6 A;  1X0J A;  4UYH A;  5F36 A;  2R0S A;  4YAT A;  2F6J A;  5F2P A;  5E3G A;  2RO1 A;  3U5M A;  2DWW A;  5DKD A;  3SVF A;  5ENC A;  2YYN A;  4PKL A;  5LJ1 A;  5EWV A;  2YDW A;  5E74 A;  4J0R A;  4UYD A;  5CUG A;  5C85 A;  5HFR A;  4UIT A;  4TT4 A;  4QSR A;  5F63 A;  5K29 A;  4O77 A;  4N4H A;  5D7X A;  2D82 A;  4YH3 A;  5TCM A;  4A9J A;  3K2J A;  5F61 A;  5LKU A;  4QSQ A;  5F62 A;  5FFV A;  3UVD A;  4NR6 A;  5BT3 A;  5I86 A;  5COI A;  4QEW A;  5IGL A;  4BW1 A;  1WUM A;  4YAX A;  4HBW A;  3AQA A;  5AD2 A;  4MR3 A;  5I88 A;  4PY6 A;  5EWC A;  2YEL A;  4BHW A;  4FLP A;  3JVK A;  4UIW A;  1JM4 B;  3UVX A;  5I80 A;  4HXK A;  3MB3 A;  4YYJ A;  2DVR A;  4QB3 A;  4NRA A;  5KU3 A;  4DON A;  4CL9 A;  5EPR A;  2KTB B;  5BT4 A;  5HRX A;  5CUD A;  5LJ2 A;  5DBM A;  2E3K A;  4WIV A;  4KCX A;  4UIU A;  5II2 A;  4O71 A;  4XYA A;  5ENH A;  3QZT A;  4NRB A;  2R10 A;  4O75 A;  4O7A A;  5L98 A;  5J0D A;  3O33 A;  5FE3 A;  5KO4 A;  5L8T A;  4MEP A;  5A5S A;  4QST A;  3S91 A;  4O72 A;  2OUO A;  5E9Y A;  5E9V A;  2GRC A;  5FE8 A;  5FG6 A;  5E9M A;  4QY4 A;  5DKC A;  4WHU A;  5I83 A;  2RNX A;  2DVS A;  5F60 A;  5HLS A;  4YH4 A;  4HXP A;  4QC1 A;  2RNY A;  5F25 A;  3U5P A;  5FE6 A;  3DAI A;  4HXN A;  5H1T A;  5A81 A;  4NUE A;  4QUU A;  5HM0 A;  4UIY A;  5D24 A;  5DYU A;  5H85 A;  4OUF A;  3IU6 A;  5A5N A;  5CTL A;  4KV1 A;  4YYN A;  5HEN A;  4PS5 A;  3MUL A;  5EPS A;  5E3D A;  3UW9 A;  4YAB A;  2DVV A;  2WP1 A;  4YBT A;  2I7K A;  4NRC A;  5C4Q A;  4TTE A;  4BW4 A;  5FFW A;  4N4G A;  4O78 A;  4J3I A;  4LYW A;  4QSP A;  3HMF A;  2FSA A;  5DW1 A;  4UYF A;  5TB6 A;  4NYX A;  4C66 A;  3HME A;  4YK0 A;  3MB4 A;  3IU5 A;  5CUC A;  4YAD A;  5ACY A;  4YBM A;  5EP7 A;  3NXB A;  5LVR A;  4UIV A;  4CUS A;  3LQH A;  4HXS A;  4Q0O A;  4Q0N A;  4QBM A;  4QSV A;  4A9K A;  3P1E A;  4J1P A;  5CP5 A;  5FE4 A;  4NQN A;  4BJX A;  5HEM A;  4YYG A;  5A5Q A;  4GPJ A;  3QZV A;  4QNS A;  4IOR A;  4MR4 A;  4Z6I A;  4HXM A;  5IGM A;  5CQ4 A;  4NR4 A;  3UV4 A;  5EU1 A;  2L84 A;  2OO1 A;  4IR4 A;  5G4S A;  4QSU A;  3U5O A;  5CRZ A;  5KTU A;  4BW3 A;  3FKM X;  5LKZ A;  4PTB A;  5L97 A;  3UV2 A;  5F1H A;  4YYH A;  1N72 A;  5HQ5 A;  4LDF A;  4CLB A;  3Q2F A;  5CFW A;  5F1L A;  3GG3 A;  4QSW A;  5E9L A;  4LZ2 A;  4A9L A;  4X2I A;  5DW2 A;  4HBY A;  3P1F A;  5AMF A;  2RS9 B;  4IR3 A;  5KTW A;  5DX4 A;  4Z1Q A;  3G0L A;  5C8G A;  5KHM A;  2YW5 A;  5CGP A;  5E73 A;  5CQ3 A;  3MXF A;  4CUQ A;  5CUE A;  4NR5 A;  3O37 A;  4HXR A;  5HCL A;  3JVL A;  5DY7 A;  5FE7 A;  5C89 A;  4MEQ A;  3ZYU A;  4XY8 A;  5I29 A;  2G4A A;  5E7D A;  4LC2 A;  4O7E A;  4NUC A;  2L5E A;  4QZS A;  5HQ6 A;  4IR5 A;  4TQN A;  1EQF A;  5IG6 A;  5D3P A;  1E6I A;  5IID A;  4NS5 A;  5FG4 A;  2F6N A;  4CUU A;  2WP2 A;  3SVG A;  3RCW A;  4LRG A;  5EVA A;  5CQ6 A;  4TT2 A;  5ENJ A;  3O36 A;  2YEK A;  5CZG A;  5FE0 A;  5ENI A;  5E0R A;  5FFY A;  4MR6 A;  5EK9 A;  5FE1 A;  4TS8 A;  5HJC A;  5FE5 A;  5I7X A;  4YY6 A;  4OGJ A;  5C87 A;  4NXJ A;  4YC9 A;  5A5R A;  3UVW A;  4F3I A;  5ETD A;  5LVQ A;  1F68 A;  5DLX A;  3QZS A;  4PCI A;  4MEO A;  4NR9 A;  4YYK A;  5EV9 A;  5CQ5 A;  4QR5 A;  3TLP A;  3S92 A;  4A9O A;  5FE2 A;  4A9E A;  5D25 A;  4CUR A;  5DYA A;  3MQM A;  5I7Y A;  3D7C A;  5L8U A;  5AD3 A;  4QEV A;  5LJ0 A;  4LZS A;  4IOO A;  5HRV A;  4LYS A;  5I40 A;  5LKX A;  3UVY A;  5FB0 A;  3ONI A;  3I3J A;  3O35 A;  4Y03 A;  5CQT A;  4Z1S A;  5A7C A;  5CPE A;  5HRW A;  3JVJ A;  4TYL A;  5DFD A;  5IGK A;  4NYW A;  4O76 A;  5A83 A;  5CUB A;  4QR4 A;  5I1Q A;  5HEL A;  1WUG A;  2L85 A;  4J0S A;  4N3W A;  5II1 A;  4C67 A;  4WHW A;  3UV5 A;  4QC3 A;  2R0Y A;  5JWM A;  5LKT A;  5EI4 A;  5D3S A;  5KTX A;  4XUA A;  2LSP B;  3U5J A;  5EWH A;  5LUU A;  5DFC A;  3LQJ A;  5DKH A;  5EM3 A;  5DYC A;  4TU4 A;  5FB1 A;  3U5K A;  4XY9 A;  4UYG A;  4A9I A;  4UYE A;  5DYX A;  5L96 A;  5EA1 A;  1JSP B;  4O70 A;  2E7N A;  2H60 A;  4NUD A;  4YBS A;  5G4R A;  4A9N A;  5H1V A;  4HBV A;  4IOQ A;  5FH8 A;  4RVR A;  5EIS A;  2DKW A;  5EIC A;  5FH7 A;  4KV4 A;  4QR3 A;  5FDZ A;  5CRM A;  4MR5 A;  4UYF B;  5A5P A;  4HXO A;  4PCE A;  4ZC9 A;  5H1U A;  3JVM A;  5CS8 A;  4Z93 A;  4TT6 A;  5FBX A;  4O74 A;  5E9I A;  5I89 A;  4HBX A;  5EGU A;  5D3R A;  4N4F A;  3SVH A;  5ENB A;  5F5Z A;  4LZR A;  3Q2E A;  4O7B A;  4TZ8 A;  4ALH A;  4CFL A;  4NR7 A;  4OGI A;  4QSX A;  4O7F A;  5L99 A;  4LR6 A;  4CUP A;  5FE9 A;  2MJV B;  4LYI A;  2YEM A;  5A85 A;  5DLZ A;  3LQI A;  3LXJ A;  4AKN A;  5D3J A;  4A9M A;  5CQA A;  4NR8 A;  4IR6 A;  4QEU A;  5CUA A;  2OSS A;  5CU8 A;  4YY4 A;  2RFJ A;  5ENG A;  2I8N A;  4QYD A;  4BW2 A;  4E96 A;  5ETB A;  3U5L A;  4QUT A;  5CQ8 A;  5HFQ A;  4CUT A;  2D9E A;  5EQ1 A;  5CY9 A;  4N4I A;  4O7C A;  5D3T A;  5ENF A;  3G0J A;  4ALG A;  5D0C A;  3MUK A;  4HXL A;  2E7O A;  4UIX A;  4QYL A;  5FG5 A;  3U5N A;  5D26 A;  4NQM A;  5C7N A;  3P5O A;  5A5O A;  4ZQL A;  5A82 A;  4YYM A;  4YYI A;  3O34 A;  4ZW1 A;  4A9H A;  3DWY A;  4MEN A;  4CFK A;  3HMH A;  5D3L A;  5IGN A;  5IBN A;  5FH6 A;  5ENE A;  3P1C A;  3P1D A;  5EWD A;  4TZ2 A;  4UIZ A;  3LJW A;  5D3N A;  5AME A;  4NYV A;  2YQD A; 
#chains in the Genus database with same CATH topology
 3AAD A;  5D3H A;  2NXB A;  2DAT A;  5CQ7 A;  3VKH A;  2DVQ A;  5F3A A;  5DFB A;  5JI8 A;  2N9G A;  5EPB A;  1ZS5 A;  4QSS A;  4A9F A;  5HQ7 A;  2R0V A;  2RNW A;  2EJN A;  5E9K A;  4YYD A;  5BT5 A;  4Z6H A;  4XUB A;  5EWW A;  2RI7 A;  4TU6 A;  1X0J A;  4UYH A;  5F36 A;  2R0S A;  4YAT A;  2F6J A;  5F2P A;  5E3G A;  3VKG A;  2RO1 A;  3U5M A;  2DWW A;  5DKD A;  3SVF A;  5ENC A;  2YYN A;  4PKL A;  5LJ1 A;  5EWV A;  2YDW A;  5E74 A;  4J0R A;  4UYD A;  5CUG A;  5C85 A;  5HFR A;  4UIT A;  4TT4 A;  4QSR A;  5F63 A;  5K29 A;  4O77 A;  4N4H A;  5D7X A;  2D82 A;  4YH3 A;  5TCM A;  4A9J A;  3K2J A;  5F61 A;  5LKU A;  4QSQ A;  5F62 A;  5FFV A;  3UVD A;  4NR6 A;  5BT3 A;  5I86 A;  5COI A;  4QEW A;  5IGL A;  4BW1 A;  1WUM A;  4YAX A;  4HBW A;  3AQA A;  5AD2 A;  4MR3 A;  5I88 A;  4PY6 A;  5EWC A;  2YEL A;  4BHW A;  4FLP A;  3JVK A;  4UIW A;  1JM4 B;  3UVX A;  5I80 A;  4HXK A;  3MB3 A;  4YYJ A;  2DVR A;  4QB3 A;  4NRA A;  5KU3 A;  4DON A;  4CL9 A;  5EPR A;  2KTB B;  5BT4 A;  5HRX A;  5CUD A;  5LJ2 A;  5DBM A;  2E3K A;  4WIV A;  4KCX A;  4UIU A;  5II2 A;  4O71 A;  4XYA A;  5ENH A;  3QZT A;  4NRB A;  2R10 A;  4O75 A;  4O7A A;  5L98 A;  5J0D A;  3O33 A;  5FE3 A;  5KO4 A;  5L8T A;  4MEP A;  5A5S A;  4QST A;  3S91 A;  4O72 A;  2OUO A;  5E9Y A;  5E9V A;  2GRC A;  5FE8 A;  5FG6 A;  5E9M A;  4QY4 A;  5DKC A;  4WHU A;  5I83 A;  2RNX A;  2DVS A;  5F60 A;  5HLS A;  4YH4 A;  4HXP A;  4QC1 A;  2RNY A;  5F25 A;  3U5P A;  5FE6 A;  3DAI A;  4HXN A;  5H1T A;  4AI6 A;  1PUO A;  5A81 A;  4NUE A;  4QUU A;  5HM0 A;  4UIY A;  5D24 A;  5DYU A;  5H85 A;  4OUF A;  3IU6 A;  5A5N A;  5CTL A;  4KV1 A;  4YYN A;  5HEN A;  4PS5 A;  3MUL A;  5EPS A;  5E3D A;  3UW9 A;  4YAB A;  2DVV A;  2WP1 A;  4YBT A;  2I7K A;  4NRC A;  5C4Q A;  3D1B A;  4TTE A;  4BW4 A;  5FFW A;  4N4G A;  4O78 A;  4J3I A;  4LYW A;  4QSP A;  3HMF A;  2FSA A;  5DW1 A;  4UYF A;  5TB6 A;  4NYX A;  4C66 A;  3HME A;  4YK0 A;  3MB4 A;  3IU5 A;  5CUC A;  4YAD A;  5ACY A;  4YBM A;  5EP7 A;  3NXB A;  5LVR A;  4UIV A;  4CUS A;  3LQH A;  4HXS A;  4Q0O A;  4Q0N A;  4QBM A;  4QSV A;  4A9K A;  3P1E A;  4J1P A;  5CP5 A;  5FE4 A;  4NQN A;  4BJX A;  5HEM A;  4YYG A;  5A5Q A;  4GPJ A;  3QZV A;  4QNS A;  4IOR A;  4MR4 A;  4Z6I A;  4HXM A;  5IGM A;  5CQ4 A;  4NR4 A;  3UV4 A;  5EU1 A;  2L84 A;  2OO1 A;  4IR4 A;  5G4S A;  4QSU A;  3U5O A;  5CRZ A;  5KTU A;  4BW3 A;  3FKM X;  5LKZ A;  4PTB A;  5L97 A;  3UV2 A;  5F1H A;  4YYH A;  1N72 A;  5HQ5 A;  4LDF A;  4CLB A;  3Q2F A;  5CFW A;  5F1L A;  3GG3 A;  4QSW A;  5E9L A;  4LZ2 A;  4A9L A;  4X2I A;  5DW2 A;  4HBY A;  3P1F A;  5AMF A;  2RS9 B;  4IR3 A;  5KTW A;  5DX4 A;  4Z1Q A;  3G0L A;  5C8G A;  5KHM A;  2YW5 A;  5CGP A;  5E73 A;  5CQ3 A;  4AKI A;  3MXF A;  4CUQ A;  5CUE A;  4NR5 A;  3O37 A;  4HXR A;  5HCL A;  3JVL A;  5DY7 A;  5FE7 A;  5C89 A;  4MEQ A;  3ZYU A;  4XY8 A;  5I29 A;  2G4A A;  5E7D A;  4LC2 A;  4O7E A;  4NUC A;  2L5E A;  4QZS A;  5HQ6 A;  4IR5 A;  4TQN A;  1EQF A;  5IG6 A;  5D3P A;  1E6I A;  5IID A;  4NS5 A;  5FG4 A;  2F6N A;  4CUU A;  2WP2 A;  3SVG A;  3RCW A;  4LRG A;  5EVA A;  5CQ6 A;  4TT2 A;  5ENJ A;  3O36 A;  2YEK A;  5CZG A;  5FE0 A;  5ENI A;  5E0R A;  5FFY A;  4MR6 A;  5EK9 A;  5FE1 A;  4TS8 A;  5HJC A;  5FE5 A;  5I7X A;  4YY6 A;  4OGJ A;  5C87 A;  4NXJ A;  4YC9 A;  5A5R A;  3UVW A;  4F3I A;  5ETD A;  5LVQ A;  1F68 A;  5DLX A;  3QZS A;  4PCI A;  4MEO A;  4NR9 A;  4YYK A;  5EV9 A;  5CQ5 A;  4QR5 A;  3TLP A;  3S92 A;  4A9O A;  5FE2 A;  4A9E A;  5D25 A;  4CUR A;  5DYA A;  3MQM A;  5I7Y A;  3ERR A;  3D7C A;  5L8U A;  5AD3 A;  4QEV A;  5LJ0 A;  4LZS A;  4IOO A;  5HRV A;  4LYS A;  5I40 A;  5LKX A;  3UVY A;  5FB0 A;  3ONI A;  3I3J A;  3O35 A;  4Y03 A;  5CQT A;  4Z1S A;  5A7C A;  5CPE A;  5HRW A;  3JVJ A;  4TYL A;  5DFD A;  5IGK A;  4NYW A;  4O76 A;  5A83 A;  5CUB A;  4QR4 A;  5I1Q A;  5HEL A;  1WUG A;  2L85 A;  4J0S A;  4N3W A;  5II1 A;  4C67 A;  4WHW A;  3UV5 A;  4QC3 A;  2R0Y A;  5JWM A;  5LKT A;  5EI4 A;  5D3S A;  5KTX A;  1ZKR A;  4XUA A;  2LSP B;  3U5J A;  5EWH A;  5LUU A;  5DFC A;  3LQJ A;  5DKH A;  5EM3 A;  5DYC A;  4TU4 A;  5FB1 A;  3U5K A;  4XY9 A;  4UYG A;  4A9I A;  4UYE A;  5DYX A;  5L96 A;  5EA1 A;  1JSP B;  4O70 A;  2E7N A;  2H60 A;  4NUD A;  4YBS A;  5G4R A;  4A9N A;  5H1V A;  4HBV A;  4IOQ A;  5FH8 A;  4RVR A;  5EIS A;  2DKW A;  5EIC A;  5FH7 A;  4KV4 A;  4QR3 A;  5FDZ A;  5CRM A;  4MR5 A;  4UYF B;  5A5P A;  4HXO A;  4PCE A;  4ZC9 A;  5H1U A;  3JVM A;  5CS8 A;  4Z93 A;  4TT6 A;  5FBX A;  4O74 A;  5E9I A;  5I89 A;  4HBX A;  5EGU A;  5D3R A;  4N4F A;  3SVH A;  5ENB A;  5F5Z A;  4LZR A;  3Q2E A;  4O7B A;  4TZ8 A;  4ALH A;  4CFL A;  4NR7 A;  4OGI A;  4QSX A;  4O7F A;  5L99 A;  4LR6 A;  4CUP A;  5FE9 A;  2MJV B;  4LYI A;  2YEM A;  5A85 A;  5DLZ A;  3LQI A;  3LXJ A;  4AKN A;  4AKH A;  5D3J A;  4A9M A;  5CQA A;  4NR8 A;  4IR6 A;  4QEU A;  5CUA A;  2OSS A;  5CU8 A;  4YY4 A;  2RFJ A;  5ENG A;  2I8N A;  4QYD A;  4BW2 A;  4E96 A;  5ETB A;  3U5L A;  4QUT A;  5CQ8 A;  5HFQ A;  4CUT A;  2D9E A;  5EQ1 A;  5CY9 A;  4N4I A;  4O7C A;  5D3T A;  5ENF A;  3G0J A;  4ALG A;  3D1D A;  5D0C A;  3MUK A;  4HXL A;  2E7O A;  4UIX A;  4QYL A;  5FG5 A;  3U5N A;  5D26 A;  4NQM A;  5C7N A;  3P5O A;  5A5O A;  4ZQL A;  5A82 A;  4YYM A;  4YYI A;  3O34 A;  4ZW1 A;  4A9H A;  3DWY A;  4MEN A;  4CFK A;  3HMH A;  5D3L A;  5IGN A;  5IBN A;  5FH6 A;  5ENE A;  3P1C A;  4AKG A;  3P1D A;  5EWD A;  4TZ2 A;  4UIZ A;  3LJW A;  5D3N A;  5AME A;  4NYV A;  2YQD A; 
#chains in the Genus database with same CATH homology
 3AAD A;  5D3H A;  2NXB A;  2DAT A;  5CQ7 A;  2DVQ A;  5F3A A;  5DFB A;  5JI8 A;  2N9G A;  5EPB A;  1ZS5 A;  4QSS A;  4A9F A;  5HQ7 A;  2R0V A;  2RNW A;  5E9K A;  4YYD A;  5BT5 A;  4Z6H A;  4XUB A;  5EWW A;  2RI7 A;  4TU6 A;  1X0J A;  4UYH A;  5F36 A;  2R0S A;  4YAT A;  2F6J A;  5F2P A;  5E3G A;  2RO1 A;  3U5M A;  2DWW A;  5DKD A;  3SVF A;  5ENC A;  2YYN A;  4PKL A;  5LJ1 A;  5EWV A;  2YDW A;  5E74 A;  4J0R A;  4UYD A;  5CUG A;  5C85 A;  5HFR A;  4UIT A;  4TT4 A;  4QSR A;  5F63 A;  5K29 A;  4O77 A;  4N4H A;  5D7X A;  2D82 A;  4YH3 A;  5TCM A;  4A9J A;  3K2J A;  5F61 A;  5LKU A;  4QSQ A;  5F62 A;  5FFV A;  3UVD A;  4NR6 A;  5BT3 A;  5I86 A;  5COI A;  4QEW A;  5IGL A;  4BW1 A;  1WUM A;  4YAX A;  4HBW A;  3AQA A;  5AD2 A;  4MR3 A;  5I88 A;  4PY6 A;  5EWC A;  2YEL A;  4BHW A;  4FLP A;  3JVK A;  4UIW A;  1JM4 B;  3UVX A;  5I80 A;  4HXK A;  3MB3 A;  4YYJ A;  2DVR A;  4QB3 A;  4NRA A;  5KU3 A;  4DON A;  4CL9 A;  5EPR A;  2KTB B;  5BT4 A;  5HRX A;  5CUD A;  5LJ2 A;  5DBM A;  2E3K A;  4WIV A;  4KCX A;  4UIU A;  5II2 A;  4O71 A;  4XYA A;  5ENH A;  3QZT A;  4NRB A;  2R10 A;  4O75 A;  4O7A A;  5L98 A;  5J0D A;  3O33 A;  5FE3 A;  5KO4 A;  5L8T A;  4MEP A;  5A5S A;  4QST A;  3S91 A;  4O72 A;  2OUO A;  5E9Y A;  5E9V A;  2GRC A;  5FE8 A;  5FG6 A;  5E9M A;  4QY4 A;  5DKC A;  4WHU A;  5I83 A;  2RNX A;  2DVS A;  5F60 A;  5HLS A;  4YH4 A;  4HXP A;  4QC1 A;  2RNY A;  5F25 A;  3U5P A;  5FE6 A;  3DAI A;  4HXN A;  5H1T A;  5A81 A;  4NUE A;  4QUU A;  5HM0 A;  4UIY A;  5D24 A;  5DYU A;  5H85 A;  4OUF A;  3IU6 A;  5A5N A;  5CTL A;  4KV1 A;  4YYN A;  5HEN A;  4PS5 A;  3MUL A;  5EPS A;  5E3D A;  3UW9 A;  4YAB A;  2DVV A;  2WP1 A;  4YBT A;  2I7K A;  4NRC A;  5C4Q A;  4TTE A;  4BW4 A;  5FFW A;  4N4G A;  4O78 A;  4J3I A;  4LYW A;  4QSP A;  3HMF A;  2FSA A;  5DW1 A;  4UYF A;  5TB6 A;  4NYX A;  4C66 A;  3HME A;  4YK0 A;  3MB4 A;  3IU5 A;  5CUC A;  4YAD A;  5ACY A;  4YBM A;  5EP7 A;  3NXB A;  5LVR A;  4UIV A;  4CUS A;  3LQH A;  4HXS A;  4Q0O A;  4Q0N A;  4QBM A;  4QSV A;  4A9K A;  3P1E A;  4J1P A;  5CP5 A;  5FE4 A;  4NQN A;  4BJX A;  5HEM A;  4YYG A;  5A5Q A;  4GPJ A;  3QZV A;  4QNS A;  4IOR A;  4MR4 A;  4Z6I A;  4HXM A;  5IGM A;  5CQ4 A;  4NR4 A;  3UV4 A;  5EU1 A;  2L84 A;  2OO1 A;  4IR4 A;  5G4S A;  4QSU A;  3U5O A;  5CRZ A;  5KTU A;  4BW3 A;  3FKM X;  5LKZ A;  4PTB A;  5L97 A;  3UV2 A;  5F1H A;  4YYH A;  1N72 A;  5HQ5 A;  4LDF A;  4CLB A;  3Q2F A;  5CFW A;  5F1L A;  3GG3 A;  4QSW A;  5E9L A;  4LZ2 A;  4A9L A;  4X2I A;  5DW2 A;  4HBY A;  3P1F A;  5AMF A;  2RS9 B;  4IR3 A;  5KTW A;  5DX4 A;  4Z1Q A;  3G0L A;  5C8G A;  5KHM A;  2YW5 A;  5CGP A;  5E73 A;  5CQ3 A;  3MXF A;  4CUQ A;  5CUE A;  4NR5 A;  3O37 A;  4HXR A;  5HCL A;  3JVL A;  5DY7 A;  5FE7 A;  5C89 A;  4MEQ A;  3ZYU A;  4XY8 A;  5I29 A;  2G4A A;  5E7D A;  4LC2 A;  4O7E A;  4NUC A;  2L5E A;  4QZS A;  5HQ6 A;  4IR5 A;  4TQN A;  1EQF A;  5IG6 A;  5D3P A;  1E6I A;  5IID A;  4NS5 A;  5FG4 A;  2F6N A;  4CUU A;  2WP2 A;  3SVG A;  3RCW A;  4LRG A;  5EVA A;  5CQ6 A;  4TT2 A;  5ENJ A;  3O36 A;  2YEK A;  5CZG A;  5FE0 A;  5ENI A;  5E0R A;  5FFY A;  4MR6 A;  5EK9 A;  5FE1 A;  4TS8 A;  5HJC A;  5FE5 A;  5I7X A;  4YY6 A;  4OGJ A;  5C87 A;  4NXJ A;  4YC9 A;  5A5R A;  3UVW A;  4F3I A;  5ETD A;  5LVQ A;  1F68 A;  5DLX A;  3QZS A;  4PCI A;  4MEO A;  4NR9 A;  4YYK A;  5EV9 A;  5CQ5 A;  4QR5 A;  3TLP A;  3S92 A;  4A9O A;  5FE2 A;  4A9E A;  5D25 A;  4CUR A;  5DYA A;  3MQM A;  5I7Y A;  3D7C A;  5L8U A;  5AD3 A;  4QEV A;  5LJ0 A;  4LZS A;  4IOO A;  5HRV A;  4LYS A;  5I40 A;  5LKX A;  3UVY A;  5FB0 A;  3ONI A;  3I3J A;  3O35 A;  4Y03 A;  5CQT A;  4Z1S A;  5A7C A;  5CPE A;  5HRW A;  3JVJ A;  4TYL A;  5DFD A;  5IGK A;  4NYW A;  4O76 A;  5A83 A;  5CUB A;  4QR4 A;  5I1Q A;  5HEL A;  1WUG A;  2L85 A;  4J0S A;  4N3W A;  5II1 A;  4C67 A;  4WHW A;  3UV5 A;  4QC3 A;  2R0Y A;  5JWM A;  5LKT A;  5EI4 A;  5D3S A;  5KTX A;  4XUA A;  2LSP B;  3U5J A;  5EWH A;  5LUU A;  5DFC A;  3LQJ A;  5DKH A;  5EM3 A;  5DYC A;  4TU4 A;  5FB1 A;  3U5K A;  4XY9 A;  4UYG A;  4A9I A;  4UYE A;  5DYX A;  5L96 A;  5EA1 A;  1JSP B;  4O70 A;  2E7N A;  2H60 A;  4NUD A;  4YBS A;  5G4R A;  4A9N A;  5H1V A;  4HBV A;  4IOQ A;  5FH8 A;  4RVR A;  5EIS A;  2DKW A;  5EIC A;  5FH7 A;  4KV4 A;  4QR3 A;  5FDZ A;  5CRM A;  4MR5 A;  4UYF B;  5A5P A;  4HXO A;  4PCE A;  4ZC9 A;  5H1U A;  3JVM A;  5CS8 A;  4Z93 A;  4TT6 A;  5FBX A;  4O74 A;  5E9I A;  5I89 A;  4HBX A;  5EGU A;  5D3R A;  4N4F A;  3SVH A;  5ENB A;  5F5Z A;  4LZR A;  3Q2E A;  4O7B A;  4TZ8 A;  4ALH A;  4CFL A;  4NR7 A;  4OGI A;  4QSX A;  4O7F A;  5L99 A;  4LR6 A;  4CUP A;  5FE9 A;  2MJV B;  4LYI A;  2YEM A;  5A85 A;  5DLZ A;  3LQI A;  3LXJ A;  4AKN A;  5D3J A;  4A9M A;  5CQA A;  4NR8 A;  4IR6 A;  4QEU A;  5CUA A;  2OSS A;  5CU8 A;  4YY4 A;  2RFJ A;  5ENG A;  2I8N A;  4QYD A;  4BW2 A;  4E96 A;  5ETB A;  3U5L A;  4QUT A;  5CQ8 A;  5HFQ A;  4CUT A;  2D9E A;  5EQ1 A;  5CY9 A;  4N4I A;  4O7C A;  5D3T A;  5ENF A;  3G0J A;  4ALG A;  5D0C A;  3MUK A;  4HXL A;  2E7O A;  4UIX A;  4QYL A;  5FG5 A;  3U5N A;  5D26 A;  4NQM A;  5C7N A;  3P5O A;  5A5O A;  4ZQL A;  5A82 A;  4YYM A;  4YYI A;  3O34 A;  4ZW1 A;  4A9H A;  3DWY A;  4MEN A;  4CFK A;  3HMH A;  5D3L A;  5IGN A;  5IBN A;  5FH6 A;  5ENE A;  3P1C A;  3P1D A;  5EWD A;  4TZ2 A;  4UIZ A;  3LJW A;  5D3N A;  5AME A;  4NYV A;  2YQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...