4Q0OA

Crystal structure of the fifth bromodomain of human poly-bromodomain containing protein 1 (pb1) in complex with a hydroxyphenyl-propenone ligand
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Crystal Structure of the fifth bromodomain of Human Poly-bromodomain containing protein 1 (PB1) in complex with a hydroxyphenyl-propenone ligand
rcsb
source organism Homo sapiens
total genus 36
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2014-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4q0oA00
5ENIA 4A9LA 4HXKA 4NR9A 4LYSA 3DAIA 4J0SA 5IIDA 5FG6A 4TT4A 3DWYA 4YYGA 4NR4A 4NS5A 5FE8A 3MB4A 5CUCA 5LKTA 4OGIA 5AD3A 2DVSA 4ZQLA 5EP7A 4UIXA 4MENA 5C8GA 4YBTA 2R0VA 4MR4A 4XY8A 4YABA 3LQHA 4QR3A 5DYXA 4WIVA 4NRAA 5LJ1A 3U5JA 4IR6A 5EGUA 1E6IA 4QSUA 5G4RA 3MXFA 2OO1A 3UVYA 4QUUA 5CQ3A 4Q0NA 5ACYA 2R0YA 3IU6A 5A82A 4NUEA 4TQNA 5A5NA 5F60A 4O77A 5K29A 5G4SA 5D26A 1JM4B 4LZ2A 5D3TA 4MEPA 4MR3A 4CUQA 4UYDA 5DX4A 5A7CA 4QBMA 5HQ5A 4YAXA 4MEQA 5D3PA 5HRXA 4O76A 5CRZA 4QY4A 5D3RA 5EWHA 5DYCA 5DFDA 2LSPB 5ENEA 4NXJA 5FE0A 4CLBA 4HBYA 2R10A 4XUAA 4Q0OA 5KTWA 4QYDA 3U5PA 5FE4A 5CGPA 5CTLA 5ETBA 2L85A 4LZRA 4UIUA 5IGKA 2DKWA 5CFWA 4MEOA 4UIYA 4TU6A 4WHUA 4BW1A 4QSWA 4CUPA 5LUUA 4IOOA 5L97A 2D82A 3LQIA 5E9IA 3GG3A 4O70A 5FBXA 5FH7A 5DLZA 5ENCA 4QSPA 4BW4A 4N4HA 4XY9A 4YATA 4BW3A 3MULA 5DFBA 4DONA 3UV5A 3AADA 5EV9A 5LVRA 4Z1SA 5HFRA 3JVLA 3LJWA 4HBVA 3QZSA 4CL9A 2RFJA 3O35A 5E3DA 5EU1A 4A9HA 4PCEA 5KHMA 4UYFA 2E3KA 4TZ8A 4QC3A 3AQAA 4XUBA 5E7DA 4IORA 4QSTA 5AMEA 4FLPA 5EPRA 4QB3A 4IR4A 4WHWA 5ENHA 5HRVA 5F36A 4O7CA 4O72A 5DBMA 5HELA 5CUEA 2YEMA 4CURA 4C67A 4A9IA 4HXRA 4HXOA 2E7NA 5FE3A 5I86A 1ZS5A 5DKCA 5CS8A 5FE9A 4BW2A 5CUAA 4YH4A 4QSSA 5DFCA 4IR3A 2DATA 3FKMX 5EISA 5JWMA 5EWVA 5A81A 5EWDA 4A9MA 5F62A 4Z6IA 2H60A 3HMFA 5FE7A 5DW1A 4O78A 5E9VA 4NRCA 5L98A 4ZW1A 5EA1A 3O33A 5EPSA 4QUTA 2DWWA 4NR6A 5E74A 4IOQA 2F6NA 2RS9B 4LC2A 5H1TA 5C85A 4NQMA 4TU4A 4TTEA 4XYAA 2DVVA 3HMHA 4MR5A 5CUDA 5FE5A 3U5KA 5DW2A 4QNSA 2NXBA 5LKUA 4NRBA 5IBNA 4HBWA 4GPJA 5E9LA 3Q2EA 4O71A 2GRCA 4YYNA 4QSRA 4CFKA 4J3IA 3S91A 4O7AA 4YYHA 5LVQA 5EPBA 4NYVA 4PS5A 4TZ2A 5CRMA 4LDFA 5CQ8A 5DYAA 4QEUA 5EQ1A 5ENGA 5EWCA 5HQ6A 4N4GA 5FFYA 2WP2A 4NUCA 2G4AA 4UYHA 5E73A 4BJXA 5D3NA 4BHWA 4MR6A 4QEWA 2OSSA 5CUBA 3TLPA 3P1CA 5DYUA 5HCLA 5FH8A 4ALGA 4RVRA 2YELA 2I8NA 4AKNA 5L8TA 4YADA 3U5MA 5F2PA 3JVJA 5HLSA 5F25A 5C87A 4NYXA 5BT3A 2MJVB 3Q2FA 4Z93A 5A83A 4CUSA 4NR8A 5CQ4A 2YYNA 5L99A 5CU8A 4UIWA 5L96A 4A9NA 4CUUA 5F61A 4OGJA 5CQTA 4NR5A 3RCWA 4HXNA 1WUGA 5BT5A 1WUMA 3P1EA 4CFLA 4YY6A 5IGMA 4NYWA 3JVMA 4O7BA 5IGLA 3ONIA 4A9EA 3O37A 5I88A 5E9YA 4YBMA 2RNXA 4LZSA 5ENJA 5EK9A 5F63A 5HM0A 4YC9A 5CQAA 5FE6A 5F1HA 5FB1A 4C66A 4QYLA 5C89A 3P5OA 5A5QA 2F6JA 5I7XA 4LR6A 4ALHA 5II1A 5KTUA 4TYLA 2I7KA 5I83A 5HQ7A 4X2IA 2RO1A 4UITA 3MB3A 5AMFA 4F3IA 5D3SA 5FG4A 4KCXA 1F68A 2FSAA 4HXSA 4A9KA 3G0LA 5BT4A 5D3HA 5H1UA 3QZVA 5D25A 5HFQA 5ENFA 2RNYA 5EI4A 5A85A 4A9OA 5L8UA 5A5PA 5LKXA 2YDWA 5FH6A 2RNWA 5D7XA 5FG5A 3S92A 4O75A 5FDZA 5DKHA 3IU5A 4QR4A 4HBXA 5EWWA 5EVAA 5A5OA 4UYGA 5COIA 4NUDA 4YYDA 3P1FA 5JI8A 5D3LA 4IR5A 2N9GA 4ZC9A 4HXPA 3ZYUA 3MQMA 4QZSA 5HEMA 5HJCA 5I89A 5DLXA 3NXBA 4J0RA 3LQJA 5ENBA 4HXLA 4YK0A 3U5NA 5CPEA 5IGNA 4A9FA 4LYIA 2DVQA 4O7FA 4A9JA 4KV4A 3MUKA 2WP1A 4QSVA 5E9MA 2RI7A 3U5OA 4YBSA 4O74A 4UYFB 5D3JA 4LYWA 4YYKA 2R0SA 5CUGA 5F1LA 3UVDA 2L5EA 4KV1A 5FE1A 5CP5A 5LJ0A 5F5ZA 4YYIA 3I3JA 5E9KA 5FFWA 4UIZA 3SVGA 3UVWA 1N72A 2D9EA 4TS8A 5CQ6A 3D7CA 4Z6HA 5I7YA 5J0DA 5FB0A 4YY4A 5H1VA 5CQ7A 4TT2A 5C7NA 1EQFA 5KTXA 4PCIA 5II2A 5D0CA 5KU3A 4N4IA 4QR5A 4UIVA 5I40A 3K2JA 3O36A 3UVXA 4TT6A 3P1DA 5FE2A 4QSQA 5H85A 5I80A 4Z1QA 2L84A 4UYEA 5AD2A 3O34A 3JVKA 5TCMA 2YW5A 5A5RA 2KTBB 2DVRA 3SVFA 2OUOA 4N4FA 4QSXA 5EM3A 5TB6A 4PY6A 5E3GA 4PTBA 5IG6A 2YEKA 5C4QA 5LJ2A 4Y03A 4YH3A 2E7OA 5A5SA 3G0JA 5LKZA 5CY9A 4YYJA 3UW9A 1X0JA 3UV2A 3HMEA 4CUTA 3U5LA 4YYMA 5HRWA 5I29A 3SVHA 4N3WA 4E96A 5I1QA 5EICA 5KO4A 4HXMA 5CZGA 1JSPB 4QEVA 5F3AA 4QC1A 4NQNA 4OUFA 3LXJA 5DY7A 4O7EA 4LRGA 2YQDA 5CQ5A 4NR7A 5E0RA 5D24A 4PKLA 5FFVA 5DKDA 5ETDA 3UV4A 3QZTA 4J1PA 5HENA
chains in the Genus database with same CATH superfamily
5ENIA 4A9LA 4HXKA 4NR9A 4LYSA 3DAIA 4J0SA 5IIDA 5FG6A 4TT4A 3DWYA 4YYGA 4NR4A 4NS5A 5FE8A 3MB4A 5CUCA 5LKTA 4OGIA 3VKGA 5AD3A 2DVSA 4ZQLA 5EP7A 4UIXA 4MENA 5C8GA 4YBTA 2R0VA 4MR4A 4XY8A 4YABA 3LQHA 4QR3A 5DYXA 4WIVA 4NRAA 5LJ1A 3U5JA 4IR6A 5EGUA 1E6IA 4QSUA 5G4RA 3MXFA 2OO1A 3UVYA 4QUUA 5CQ3A 4Q0NA 5ACYA 2R0YA 3IU6A 5A82A 4NUEA 4TQNA 5A5NA 5F60A 4O77A 5K29A 5G4SA 5D26A 1JM4B 4LZ2A 5D3TA 4MEPA 4MR3A 4CUQA 4UYDA 5DX4A 5A7CA 4QBMA 5HQ5A 4YAXA 4MEQA 5D3PA 5HRXA 4O76A 5CRZA 4QY4A 5D3RA 5EWHA 5DYCA 5DFDA 2LSPB 5ENEA 4NXJA 5FE0A 4CLBA 4HBYA 2R10A 4AKHA 4XUAA 4Q0OA 5KTWA 4QYDA 3U5PA 5FE4A 5CGPA 5CTLA 5ETBA 2L85A 4LZRA 4UIUA 5IGKA 2DKWA 5CFWA 4MEOA 4UIYA 4TU6A 4WHUA 4BW1A 4QSWA 4CUPA 5LUUA 4IOOA 5L97A 2D82A 3LQIA 5E9IA 3GG3A 4O70A 5FBXA 5FH7A 5DLZA 5ENCA 4QSPA 4BW4A 4N4HA 4XY9A 4YATA 4BW3A 3MULA 5DFBA 4DONA 3UV5A 3AADA 5EV9A 5LVRA 4Z1SA 5HFRA 3JVLA 3LJWA 4HBVA 3QZSA 4CL9A 2RFJA 3O35A 5E3DA 5EU1A 4A9HA 4PCEA 5KHMA 4UYFA 4TZ8A 2E3KA 4QC3A 3AQAA 4XUBA 5E7DA 4IORA 4QSTA 5AMEA 4FLPA 5EPRA 4QB3A 4IR4A 4WHWA 5ENHA 5HRVA 5F36A 4O7CA 4O72A 5DBMA 3D1DA 5HELA 5CUEA 2YEMA 4CURA 4C67A 4A9IA 4HXRA 4HXOA 2E7NA 5FE3A 5I86A 1ZS5A 5DKCA 5CS8A 5FE9A 4BW2A 5CUAA 4YH4A 4QSSA 5DFCA 4IR3A 2DATA 3FKMX 5EISA 5JWMA 5EWVA 5A81A 5EWDA 4A9MA 5F62A 4Z6IA 2H60A 3HMFA 5FE7A 5DW1A 4O78A 5E9VA 4NRCA 5L98A 4ZW1A 5EA1A 3O33A 5EPSA 4QUTA 2DWWA 4NR6A 5E74A 4IOQA 2F6NA 2RS9B 4LC2A 5H1TA 5C85A 4NQMA 4TU4A 4TTEA 4AI6A 4XYAA 2DVVA 3HMHA 4MR5A 5CUDA 5FE5A 3U5KA 5DW2A 4QNSA 2NXBA 5LKUA 4NRBA 5IBNA 4HBWA 4GPJA 5E9LA 3Q2EA 4O71A 2GRCA 4YYNA 4QSRA 4CFKA 4J3IA 3S91A 4O7AA 4YYHA 5LVQA 5EPBA 4NYVA 4PS5A 4TZ2A 5CRMA 4LDFA 5CQ8A 5DYAA 4QEUA 5EQ1A 5ENGA 5EWCA 5HQ6A 4N4GA 5FFYA 2WP2A 4NUCA 2G4AA 4UYHA 5E73A 4BJXA 5D3NA 4BHWA 4MR6A 4QEWA 2OSSA 5CUBA 3TLPA 3P1CA 5DYUA 5HCLA 5FH8A 4ALGA 4RVRA 2YELA 2I8NA 4AKNA 5L8TA 4YADA 3U5MA 5F2PA 3JVJA 5HLSA 5F25A 5C87A 4NYXA 5BT3A 2MJVB 3Q2FA 4Z93A 5A83A 4CUSA 4NR8A 5CQ4A 2YYNA 5L99A 5CU8A 4UIWA 5L96A 4A9NA 4CUUA 5F61A 4OGJA 5CQTA 4NR5A 3RCWA 4HXNA 1WUGA 5BT5A 1WUMA 3P1EA 4CFLA 4YY6A 5IGMA 4NYWA 3JVMA 4O7BA 5IGLA 3ONIA 4A9EA 3O37A 5I88A 5E9YA 4YBMA 2RNXA 4LZSA 5ENJA 5EK9A 5F63A 5HM0A 4YC9A 5CQAA 5FE6A 5F1HA 5FB1A 4C66A 4QYLA 5C89A 3P5OA 5A5QA 2F6JA 5I7XA 4LR6A 4ALHA 5II1A 5KTUA 4TYLA 2I7KA 5I83A 5HQ7A 4X2IA 2RO1A 4UITA 3MB3A 5AMFA 4F3IA 5D3SA 5FG4A 4KCXA 1F68A 2FSAA 3ERRA 4HXSA 4A9KA 3G0LA 5BT4A 5D3HA 5H1UA 3QZVA 5D25A 5HFQA 5ENFA 2RNYA 5EI4A 5A85A 4A9OA 5L8UA 5A5PA 5LKXA 2YDWA 5FH6A 2RNWA 5D7XA 5FG5A 3S92A 4O75A 4AKIA 5FDZA 5DKHA 3IU5A 4QR4A 4HBXA 5EWWA 1ZKRA 5EVAA 5A5OA 4UYGA 5COIA 4NUDA 4YYDA 3P1FA 3VKHA 5JI8A 5D3LA 4IR5A 2N9GA 4ZC9A 4HXPA 3ZYUA 3MQMA 4QZSA 5HEMA 5HJCA 5I89A 5DLXA 3NXBA 4J0RA 3LQJA 5ENBA 4HXLA 4YK0A 3U5NA 5CPEA 2EJNA 5IGNA 4A9FA 4LYIA 2DVQA 4O7FA 4A9JA 4KV4A 3MUKA 2WP1A 4QSVA 5E9MA 2RI7A 3U5OA 4YBSA 4O74A 4UYFB 5D3JA 4LYWA 4YYKA 2R0SA 5CUGA 5F1LA 3UVDA 2L5EA 4KV1A 5FE1A 5CP5A 5LJ0A 5F5ZA 4YYIA 3I3JA 5E9KA 5FFWA 4UIZA 3SVGA 3UVWA 1N72A 2D9EA 4TS8A 5CQ6A 3D7CA 4Z6HA 5I7YA 5J0DA 5FB0A 4YY4A 5H1VA 5CQ7A 4TT2A 5C7NA 1EQFA 5KTXA 4PCIA 5II2A 5D0CA 5KU3A 4N4IA 4QR5A 4UIVA 5I40A 3K2JA 3O36A 3UVXA 4TT6A 3P1DA 5FE2A 4QSQA 5H85A 5I80A 4Z1QA 2L84A 4UYEA 5AD2A 3O34A 3JVKA 5TCMA 2YW5A 5A5RA 2KTBB 2DVRA 3SVFA 2OUOA 4N4FA 4QSXA 5EM3A 5TB6A 4PY6A 5E3GA 4PTBA 5IG6A 2YEKA 5C4QA 5LJ2A 4Y03A 4YH3A 2E7OA 5A5SA 3G0JA 5LKZA 5CY9A 1PUOA 4YYJA 3UW9A 1X0JA 3UV2A 3HMEA 4CUTA 3U5LA 4YYMA 5HRWA 5I29A 3SVHA 4N3WA 4E96A 5I1QA 5EICA 5KO4A 4HXMA 5CZGA 1JSPB 4QEVA 5F3AA 4QC1A 4NQNA 4OUFA 3LXJA 5DY7A 4O7EA 4LRGA 4AKGA 2YQDA 5CQ5A 4NR7A 5E0RA 5D24A 4PKLA 5FFVA 5DKDA 5ETDA 3UV4A 3QZTA 4J1PA 3D1BA 5HENA
chains in the Genus database with same CATH topology
5ENIA 4A9LA 4HXKA 4NR9A 4LYSA 3DAIA 4J0SA 5IIDA 5FG6A 4TT4A 3DWYA 4YYGA 4NR4A 4NS5A 5FE8A 3MB4A 5CUCA 5LKTA 4OGIA 5AD3A 2DVSA 4ZQLA 5EP7A 4UIXA 4MENA 5C8GA 4YBTA 2R0VA 4MR4A 4XY8A 4YABA 3LQHA 4QR3A 5DYXA 4WIVA 4NRAA 5LJ1A 3U5JA 4IR6A 5EGUA 1E6IA 4QSUA 5G4RA 3MXFA 2OO1A 3UVYA 4QUUA 5CQ3A 4Q0NA 5ACYA 2R0YA 3IU6A 5A82A 4NUEA 4TQNA 5A5NA 5F60A 4O77A 5K29A 5G4SA 5D26A 1JM4B 4LZ2A 5D3TA 4MEPA 4MR3A 4CUQA 4UYDA 5DX4A 5A7CA 4QBMA 5HQ5A 4YAXA 4MEQA 5D3PA 5HRXA 4O76A 5CRZA 4QY4A 5D3RA 5EWHA 5DYCA 5DFDA 2LSPB 5ENEA 4NXJA 5FE0A 4CLBA 4HBYA 2R10A 4XUAA 4Q0OA 5KTWA 4QYDA 3U5PA 5FE4A 5CGPA 5CTLA 5ETBA 2L85A 4LZRA 4UIUA 5IGKA 2DKWA 5CFWA 4MEOA 4UIYA 4TU6A 4WHUA 4BW1A 4QSWA 4CUPA 5LUUA 4IOOA 5L97A 2D82A 3LQIA 5E9IA 3GG3A 4O70A 5FBXA 5FH7A 5DLZA 5ENCA 4QSPA 4BW4A 4N4HA 4XY9A 4YATA 4BW3A 3MULA 5DFBA 4DONA 3UV5A 3AADA 5EV9A 5LVRA 4Z1SA 5HFRA 3JVLA 3LJWA 4HBVA 3QZSA 4CL9A 2RFJA 3O35A 5E3DA 5EU1A 4A9HA 4PCEA 5KHMA 4UYFA 2E3KA 4TZ8A 4QC3A 3AQAA 4XUBA 5E7DA 4IORA 4QSTA 5AMEA 4FLPA 5EPRA 4QB3A 4IR4A 4WHWA 5ENHA 5HRVA 5F36A 4O7CA 4O72A 5DBMA 5HELA 5CUEA 2YEMA 4CURA 4C67A 4A9IA 4HXRA 4HXOA 2E7NA 5FE3A 5I86A 1ZS5A 5DKCA 5CS8A 5FE9A 4BW2A 5CUAA 4YH4A 4QSSA 5DFCA 4IR3A 2DATA 3FKMX 5EISA 5JWMA 5EWVA 5A81A 5EWDA 4A9MA 5F62A 4Z6IA 2H60A 3HMFA 5FE7A 5DW1A 4O78A 5E9VA 4NRCA 5L98A 4ZW1A 5EA1A 3O33A 5EPSA 4QUTA 2DWWA 4NR6A 5E74A 4IOQA 2F6NA 2RS9B 4LC2A 5H1TA 5C85A 4NQMA 4TU4A 4TTEA 4XYAA 2DVVA 3HMHA 4MR5A 5CUDA 5FE5A 3U5KA 5DW2A 4QNSA 2NXBA 5LKUA 4NRBA 5IBNA 4HBWA 4GPJA 5E9LA 3Q2EA 4O71A 2GRCA 4YYNA 4QSRA 4CFKA 4J3IA 3S91A 4O7AA 4YYHA 5LVQA 5EPBA 4NYVA 4PS5A 4TZ2A 5CRMA 4LDFA 5CQ8A 5DYAA 4QEUA 5EQ1A 5ENGA 5EWCA 5HQ6A 4N4GA 5FFYA 2WP2A 4NUCA 2G4AA 4UYHA 5E73A 4BJXA 5D3NA 4BHWA 4MR6A 4QEWA 2OSSA 5CUBA 3TLPA 3P1CA 5DYUA 5HCLA 5FH8A 4ALGA 4RVRA 2YELA 2I8NA 4AKNA 5L8TA 4YADA 3U5MA 5F2PA 3JVJA 5HLSA 5F25A 5C87A 4NYXA 5BT3A 2MJVB 3Q2FA 4Z93A 5A83A 4CUSA 4NR8A 5CQ4A 2YYNA 5L99A 5CU8A 4UIWA 5L96A 4A9NA 4CUUA 5F61A 4OGJA 5CQTA 4NR5A 3RCWA 4HXNA 1WUGA 5BT5A 1WUMA 3P1EA 4CFLA 4YY6A 5IGMA 4NYWA 3JVMA 4O7BA 5IGLA 3ONIA 4A9EA 3O37A 5I88A 5E9YA 4YBMA 2RNXA 4LZSA 5ENJA 5EK9A 5F63A 5HM0A 4YC9A 5CQAA 5FE6A 5F1HA 5FB1A 4C66A 4QYLA 5C89A 3P5OA 5A5QA 2F6JA 5I7XA 4LR6A 4ALHA 5II1A 5KTUA 4TYLA 2I7KA 5I83A 5HQ7A 4X2IA 2RO1A 4UITA 3MB3A 5AMFA 4F3IA 5D3SA 5FG4A 4KCXA 1F68A 2FSAA 4HXSA 4A9KA 3G0LA 5BT4A 5D3HA 5H1UA 3QZVA 5D25A 5HFQA 5ENFA 2RNYA 5EI4A 5A85A 4A9OA 5L8UA 5A5PA 5LKXA 2YDWA 5FH6A 2RNWA 5D7XA 5FG5A 3S92A 4O75A 5FDZA 5DKHA 3IU5A 4QR4A 4HBXA 5EWWA 5EVAA 5A5OA 4UYGA 5COIA 4NUDA 4YYDA 3P1FA 5JI8A 5D3LA 4IR5A 2N9GA 4ZC9A 4HXPA 3ZYUA 3MQMA 4QZSA 5HEMA 5HJCA 5I89A 5DLXA 3NXBA 4J0RA 3LQJA 5ENBA 4HXLA 4YK0A 3U5NA 5CPEA 5IGNA 4A9FA 4LYIA 2DVQA 4O7FA 4A9JA 4KV4A 3MUKA 2WP1A 4QSVA 5E9MA 2RI7A 3U5OA 4YBSA 4O74A 4UYFB 5D3JA 4LYWA 4YYKA 2R0SA 5CUGA 5F1LA 3UVDA 2L5EA 4KV1A 5FE1A 5CP5A 5LJ0A 5F5ZA 4YYIA 3I3JA 5E9KA 5FFWA 4UIZA 3SVGA 3UVWA 1N72A 2D9EA 4TS8A 5CQ6A 3D7CA 4Z6HA 5I7YA 5J0DA 5FB0A 4YY4A 5H1VA 5CQ7A 4TT2A 5C7NA 1EQFA 5KTXA 4PCIA 5II2A 5D0CA 5KU3A 4N4IA 4QR5A 4UIVA 5I40A 3K2JA 3O36A 3UVXA 4TT6A 3P1DA 5FE2A 4QSQA 5H85A 5I80A 4Z1QA 2L84A 4UYEA 5AD2A 3O34A 3JVKA 5TCMA 2YW5A 5A5RA 2KTBB 2DVRA 3SVFA 2OUOA 4N4FA 4QSXA 5EM3A 5TB6A 4PY6A 5E3GA 4PTBA 5IG6A 2YEKA 5C4QA 5LJ2A 4Y03A 4YH3A 2E7OA 5A5SA 3G0JA 5LKZA 5CY9A 4YYJA 3UW9A 1X0JA 3UV2A 3HMEA 4CUTA 3U5LA 4YYMA 5HRWA 5I29A 3SVHA 4N3WA 4E96A 5I1QA 5EICA 5KO4A 4HXMA 5CZGA 1JSPB 4QEVA 5F3AA 4QC1A 4NQNA 4OUFA 3LXJA 5DY7A 4O7EA 4LRGA 2YQDA 5CQ5A 4NR7A 5E0RA 5D24A 4PKLA 5FFVA 5DKDA 5ETDA 3UV4A 3QZTA 4J1PA 5HENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENI A;  4A9L A;  4HXK A;  4NR9 A;  4LYS A;  3DAI A;  4J0S A;  5IID A;  5FG6 A;  4TT4 A;  3DWY A;  4YYG A;  4NR4 A;  4NS5 A;  5FE8 A;  3MB4 A;  5CUC A;  5LKT A;  4OGI A;  5AD3 A;  2DVS A;  4ZQL A;  5EP7 A;  4UIX A;  4MEN A;  5C8G A;  4YBT A;  2R0V A;  4MR4 A;  4XY8 A;  4YAB A;  3LQH A;  4QR3 A;  5DYX A;  4WIV A;  4NRA A;  5LJ1 A;  3U5J A;  4IR6 A;  5EGU A;  1E6I A;  4QSU A;  5G4R A;  3MXF A;  2OO1 A;  3UVY A;  4QUU A;  5CQ3 A;  4Q0N A;  5ACY A;  2R0Y A;  3IU6 A;  5A82 A;  4NUE A;  4TQN A;  5A5N A;  5F60 A;  4O77 A;  5K29 A;  5G4S A;  5D26 A;  1JM4 B;  4LZ2 A;  5D3T A;  4MEP A;  4MR3 A;  4CUQ A;  4UYD A;  5DX4 A;  5A7C A;  4QBM A;  5HQ5 A;  4YAX A;  4MEQ A;  5D3P A;  5HRX A;  4O76 A;  5CRZ A;  4QY4 A;  5D3R A;  5EWH A;  5DYC A;  5DFD A;  2LSP B;  5ENE A;  4NXJ A;  5FE0 A;  4CLB A;  4HBY A;  2R10 A;  4XUA A;  4Q0O A;  5KTW A;  4QYD A;  3U5P A;  5FE4 A;  5CGP A;  5CTL A;  5ETB A;  2L85 A;  4LZR A;  4UIU A;  5IGK A;  2DKW A;  5CFW A;  4MEO A;  4UIY A;  4TU6 A;  4WHU A;  4BW1 A;  4QSW A;  4CUP A;  5LUU A;  4IOO A;  5L97 A;  2D82 A;  3LQI A;  5E9I A;  3GG3 A;  4O70 A;  5FBX A;  5FH7 A;  5DLZ A;  5ENC A;  4QSP A;  4BW4 A;  4N4H A;  4XY9 A;  4YAT A;  4BW3 A;  3MUL A;  5DFB A;  4DON A;  3UV5 A;  3AAD A;  5EV9 A;  5LVR A;  4Z1S A;  5HFR A;  3JVL A;  3LJW A;  4HBV A;  3QZS A;  4CL9 A;  2RFJ A;  3O35 A;  5E3D A;  5EU1 A;  4A9H A;  4PCE A;  5KHM A;  4UYF A;  2E3K A;  4TZ8 A;  4QC3 A;  3AQA A;  4XUB A;  5E7D A;  4IOR A;  4QST A;  5AME A;  4FLP A;  5EPR A;  4QB3 A;  4IR4 A;  4WHW A;  5ENH A;  5HRV A;  5F36 A;  4O7C A;  4O72 A;  5DBM A;  5HEL A;  5CUE A;  2YEM A;  4CUR A;  4C67 A;  4A9I A;  4HXR A;  4HXO A;  2E7N A;  5FE3 A;  5I86 A;  1ZS5 A;  5DKC A;  5CS8 A;  5FE9 A;  4BW2 A;  5CUA A;  4YH4 A;  4QSS A;  5DFC A;  4IR3 A;  2DAT A;  3FKM X;  5EIS A;  5JWM A;  5EWV A;  5A81 A;  5EWD A;  4A9M A;  5F62 A;  4Z6I A;  2H60 A;  3HMF A;  5FE7 A;  5DW1 A;  4O78 A;  5E9V A;  4NRC A;  5L98 A;  4ZW1 A;  5EA1 A;  3O33 A;  5EPS A;  4QUT A;  2DWW A;  4NR6 A;  5E74 A;  4IOQ A;  2F6N A;  2RS9 B;  4LC2 A;  5H1T A;  5C85 A;  4NQM A;  4TU4 A;  4TTE A;  4XYA A;  2DVV A;  3HMH A;  4MR5 A;  5CUD A;  5FE5 A;  3U5K A;  5DW2 A;  4QNS A;  2NXB A;  5LKU A;  4NRB A;  5IBN A;  4HBW A;  4GPJ A;  5E9L A;  3Q2E A;  4O71 A;  2GRC A;  4YYN A;  4QSR A;  4CFK A;  4J3I A;  3S91 A;  4O7A A;  4YYH A;  5LVQ A;  5EPB A;  4NYV A;  4PS5 A;  4TZ2 A;  5CRM A;  4LDF A;  5CQ8 A;  5DYA A;  4QEU A;  5EQ1 A;  5ENG A;  5EWC A;  5HQ6 A;  4N4G A;  5FFY A;  2WP2 A;  4NUC A;  2G4A A;  4UYH A;  5E73 A;  4BJX A;  5D3N A;  4BHW A;  4MR6 A;  4QEW A;  2OSS A;  5CUB A;  3TLP A;  3P1C A;  5DYU A;  5HCL A;  5FH8 A;  4ALG A;  4RVR A;  2YEL A;  2I8N A;  4AKN A;  5L8T A;  4YAD A;  3U5M A;  5F2P A;  3JVJ A;  5HLS A;  5F25 A;  5C87 A;  4NYX A;  5BT3 A;  2MJV B;  3Q2F A;  4Z93 A;  5A83 A;  4CUS A;  4NR8 A;  5CQ4 A;  2YYN A;  5L99 A;  5CU8 A;  4UIW A;  5L96 A;  4A9N A;  4CUU A;  5F61 A;  4OGJ A;  5CQT A;  4NR5 A;  3RCW A;  4HXN A;  1WUG A;  5BT5 A;  1WUM A;  3P1E A;  4CFL A;  4YY6 A;  5IGM A;  4NYW A;  3JVM A;  4O7B A;  5IGL A;  3ONI A;  4A9E A;  3O37 A;  5I88 A;  5E9Y A;  4YBM A;  2RNX A;  4LZS A;  5ENJ A;  5EK9 A;  5F63 A;  5HM0 A;  4YC9 A;  5CQA A;  5FE6 A;  5F1H A;  5FB1 A;  4C66 A;  4QYL A;  5C89 A;  3P5O A;  5A5Q A;  2F6J A;  5I7X A;  4LR6 A;  4ALH A;  5II1 A;  5KTU A;  4TYL A;  2I7K A;  5I83 A;  5HQ7 A;  4X2I A;  2RO1 A;  4UIT A;  3MB3 A;  5AMF A;  4F3I A;  5D3S A;  5FG4 A;  4KCX A;  1F68 A;  2FSA A;  4HXS A;  4A9K A;  3G0L A;  5BT4 A;  5D3H A;  5H1U A;  3QZV A;  5D25 A;  5HFQ A;  5ENF A;  2RNY A;  5EI4 A;  5A85 A;  4A9O A;  5L8U A;  5A5P A;  5LKX A;  2YDW A;  5FH6 A;  2RNW A;  5D7X A;  5FG5 A;  3S92 A;  4O75 A;  5FDZ A;  5DKH A;  3IU5 A;  4QR4 A;  4HBX A;  5EWW A;  5EVA A;  5A5O A;  4UYG A;  5COI A;  4NUD A;  4YYD A;  3P1F A;  5JI8 A;  5D3L A;  4IR5 A;  2N9G A;  4ZC9 A;  4HXP A;  3ZYU A;  3MQM A;  4QZS A;  5HEM A;  5HJC A;  5I89 A;  5DLX A;  3NXB A;  4J0R A;  3LQJ A;  5ENB A;  4HXL A;  4YK0 A;  3U5N A;  5CPE A;  5IGN A;  4A9F A;  4LYI A;  2DVQ A;  4O7F A;  4A9J A;  4KV4 A;  3MUK A;  2WP1 A;  4QSV A;  5E9M A;  2RI7 A;  3U5O A;  4YBS A;  4O74 A;  4UYF B;  5D3J A;  4LYW A;  4YYK A;  2R0S A;  5CUG A;  5F1L A;  3UVD A;  2L5E A;  4KV1 A;  5FE1 A;  5CP5 A;  5LJ0 A;  5F5Z A;  4YYI A;  3I3J A;  5E9K A;  5FFW A;  4UIZ A;  3SVG A;  3UVW A;  1N72 A;  2D9E A;  4TS8 A;  5CQ6 A;  3D7C A;  4Z6H A;  5I7Y A;  5J0D A;  5FB0 A;  4YY4 A;  5H1V A;  5CQ7 A;  4TT2 A;  5C7N A;  1EQF A;  5KTX A;  4PCI A;  5II2 A;  5D0C A;  5KU3 A;  4N4I A;  4QR5 A;  4UIV A;  5I40 A;  3K2J A;  3O36 A;  3UVX A;  4TT6 A;  3P1D A;  5FE2 A;  4QSQ A;  5H85 A;  5I80 A;  4Z1Q A;  2L84 A;  4UYE A;  5AD2 A;  3O34 A;  3JVK A;  5TCM A;  2YW5 A;  5A5R A;  2KTB B;  2DVR A;  3SVF A;  2OUO A;  4N4F A;  4QSX A;  5EM3 A;  5TB6 A;  4PY6 A;  5E3G A;  4PTB A;  5IG6 A;  2YEK A;  5C4Q A;  5LJ2 A;  4Y03 A;  4YH3 A;  2E7O A;  5A5S A;  3G0J A;  5LKZ A;  5CY9 A;  4YYJ A;  3UW9 A;  1X0J A;  3UV2 A;  3HME A;  4CUT A;  3U5L A;  4YYM A;  5HRW A;  5I29 A;  3SVH A;  4N3W A;  4E96 A;  5I1Q A;  5EIC A;  5KO4 A;  4HXM A;  5CZG A;  1JSP B;  4QEV A;  5F3A A;  4QC1 A;  4NQN A;  4OUF A;  3LXJ A;  5DY7 A;  4O7E A;  4LRG A;  2YQD A;  5CQ5 A;  4NR7 A;  5E0R A;  5D24 A;  4PKL A;  5FFV A;  5DKD A;  5ETD A;  3UV4 A;  3QZT A;  4J1P A;  5HEN A; 
#chains in the Genus database with same CATH topology
 5ENI A;  4A9L A;  4HXK A;  4NR9 A;  4LYS A;  3DAI A;  4J0S A;  5IID A;  5FG6 A;  4TT4 A;  3DWY A;  4YYG A;  4NR4 A;  4NS5 A;  5FE8 A;  3MB4 A;  5CUC A;  5LKT A;  4OGI A;  3VKG A;  5AD3 A;  2DVS A;  4ZQL A;  5EP7 A;  4UIX A;  4MEN A;  5C8G A;  4YBT A;  2R0V A;  4MR4 A;  4XY8 A;  4YAB A;  3LQH A;  4QR3 A;  5DYX A;  4WIV A;  4NRA A;  5LJ1 A;  3U5J A;  4IR6 A;  5EGU A;  1E6I A;  4QSU A;  5G4R A;  3MXF A;  2OO1 A;  3UVY A;  4QUU A;  5CQ3 A;  4Q0N A;  5ACY A;  2R0Y A;  3IU6 A;  5A82 A;  4NUE A;  4TQN A;  5A5N A;  5F60 A;  4O77 A;  5K29 A;  5G4S A;  5D26 A;  1JM4 B;  4LZ2 A;  5D3T A;  4MEP A;  4MR3 A;  4CUQ A;  4UYD A;  5DX4 A;  5A7C A;  4QBM A;  5HQ5 A;  4YAX A;  4MEQ A;  5D3P A;  5HRX A;  4O76 A;  5CRZ A;  4QY4 A;  5D3R A;  5EWH A;  5DYC A;  5DFD A;  2LSP B;  5ENE A;  4NXJ A;  5FE0 A;  4CLB A;  4HBY A;  2R10 A;  4AKH A;  4XUA A;  4Q0O A;  5KTW A;  4QYD A;  3U5P A;  5FE4 A;  5CGP A;  5CTL A;  5ETB A;  2L85 A;  4LZR A;  4UIU A;  5IGK A;  2DKW A;  5CFW A;  4MEO A;  4UIY A;  4TU6 A;  4WHU A;  4BW1 A;  4QSW A;  4CUP A;  5LUU A;  4IOO A;  5L97 A;  2D82 A;  3LQI A;  5E9I A;  3GG3 A;  4O70 A;  5FBX A;  5FH7 A;  5DLZ A;  5ENC A;  4QSP A;  4BW4 A;  4N4H A;  4XY9 A;  4YAT A;  4BW3 A;  3MUL A;  5DFB A;  4DON A;  3UV5 A;  3AAD A;  5EV9 A;  5LVR A;  4Z1S A;  5HFR A;  3JVL A;  3LJW A;  4HBV A;  3QZS A;  4CL9 A;  2RFJ A;  3O35 A;  5E3D A;  5EU1 A;  4A9H A;  4PCE A;  5KHM A;  4UYF A;  4TZ8 A;  2E3K A;  4QC3 A;  3AQA A;  4XUB A;  5E7D A;  4IOR A;  4QST A;  5AME A;  4FLP A;  5EPR A;  4QB3 A;  4IR4 A;  4WHW A;  5ENH A;  5HRV A;  5F36 A;  4O7C A;  4O72 A;  5DBM A;  3D1D A;  5HEL A;  5CUE A;  2YEM A;  4CUR A;  4C67 A;  4A9I A;  4HXR A;  4HXO A;  2E7N A;  5FE3 A;  5I86 A;  1ZS5 A;  5DKC A;  5CS8 A;  5FE9 A;  4BW2 A;  5CUA A;  4YH4 A;  4QSS A;  5DFC A;  4IR3 A;  2DAT A;  3FKM X;  5EIS A;  5JWM A;  5EWV A;  5A81 A;  5EWD A;  4A9M A;  5F62 A;  4Z6I A;  2H60 A;  3HMF A;  5FE7 A;  5DW1 A;  4O78 A;  5E9V A;  4NRC A;  5L98 A;  4ZW1 A;  5EA1 A;  3O33 A;  5EPS A;  4QUT A;  2DWW A;  4NR6 A;  5E74 A;  4IOQ A;  2F6N A;  2RS9 B;  4LC2 A;  5H1T A;  5C85 A;  4NQM A;  4TU4 A;  4TTE A;  4AI6 A;  4XYA A;  2DVV A;  3HMH A;  4MR5 A;  5CUD A;  5FE5 A;  3U5K A;  5DW2 A;  4QNS A;  2NXB A;  5LKU A;  4NRB A;  5IBN A;  4HBW A;  4GPJ A;  5E9L A;  3Q2E A;  4O71 A;  2GRC A;  4YYN A;  4QSR A;  4CFK A;  4J3I A;  3S91 A;  4O7A A;  4YYH A;  5LVQ A;  5EPB A;  4NYV A;  4PS5 A;  4TZ2 A;  5CRM A;  4LDF A;  5CQ8 A;  5DYA A;  4QEU A;  5EQ1 A;  5ENG A;  5EWC A;  5HQ6 A;  4N4G A;  5FFY A;  2WP2 A;  4NUC A;  2G4A A;  4UYH A;  5E73 A;  4BJX A;  5D3N A;  4BHW A;  4MR6 A;  4QEW A;  2OSS A;  5CUB A;  3TLP A;  3P1C A;  5DYU A;  5HCL A;  5FH8 A;  4ALG A;  4RVR A;  2YEL A;  2I8N A;  4AKN A;  5L8T A;  4YAD A;  3U5M A;  5F2P A;  3JVJ A;  5HLS A;  5F25 A;  5C87 A;  4NYX A;  5BT3 A;  2MJV B;  3Q2F A;  4Z93 A;  5A83 A;  4CUS A;  4NR8 A;  5CQ4 A;  2YYN A;  5L99 A;  5CU8 A;  4UIW A;  5L96 A;  4A9N A;  4CUU A;  5F61 A;  4OGJ A;  5CQT A;  4NR5 A;  3RCW A;  4HXN A;  1WUG A;  5BT5 A;  1WUM A;  3P1E A;  4CFL A;  4YY6 A;  5IGM A;  4NYW A;  3JVM A;  4O7B A;  5IGL A;  3ONI A;  4A9E A;  3O37 A;  5I88 A;  5E9Y A;  4YBM A;  2RNX A;  4LZS A;  5ENJ A;  5EK9 A;  5F63 A;  5HM0 A;  4YC9 A;  5CQA A;  5FE6 A;  5F1H A;  5FB1 A;  4C66 A;  4QYL A;  5C89 A;  3P5O A;  5A5Q A;  2F6J A;  5I7X A;  4LR6 A;  4ALH A;  5II1 A;  5KTU A;  4TYL A;  2I7K A;  5I83 A;  5HQ7 A;  4X2I A;  2RO1 A;  4UIT A;  3MB3 A;  5AMF A;  4F3I A;  5D3S A;  5FG4 A;  4KCX A;  1F68 A;  2FSA A;  3ERR A;  4HXS A;  4A9K A;  3G0L A;  5BT4 A;  5D3H A;  5H1U A;  3QZV A;  5D25 A;  5HFQ A;  5ENF A;  2RNY A;  5EI4 A;  5A85 A;  4A9O A;  5L8U A;  5A5P A;  5LKX A;  2YDW A;  5FH6 A;  2RNW A;  5D7X A;  5FG5 A;  3S92 A;  4O75 A;  4AKI A;  5FDZ A;  5DKH A;  3IU5 A;  4QR4 A;  4HBX A;  5EWW A;  1ZKR A;  5EVA A;  5A5O A;  4UYG A;  5COI A;  4NUD A;  4YYD A;  3P1F A;  3VKH A;  5JI8 A;  5D3L A;  4IR5 A;  2N9G A;  4ZC9 A;  4HXP A;  3ZYU A;  3MQM A;  4QZS A;  5HEM A;  5HJC A;  5I89 A;  5DLX A;  3NXB A;  4J0R A;  3LQJ A;  5ENB A;  4HXL A;  4YK0 A;  3U5N A;  5CPE A;  2EJN A;  5IGN A;  4A9F A;  4LYI A;  2DVQ A;  4O7F A;  4A9J A;  4KV4 A;  3MUK A;  2WP1 A;  4QSV A;  5E9M A;  2RI7 A;  3U5O A;  4YBS A;  4O74 A;  4UYF B;  5D3J A;  4LYW A;  4YYK A;  2R0S A;  5CUG A;  5F1L A;  3UVD A;  2L5E A;  4KV1 A;  5FE1 A;  5CP5 A;  5LJ0 A;  5F5Z A;  4YYI A;  3I3J A;  5E9K A;  5FFW A;  4UIZ A;  3SVG A;  3UVW A;  1N72 A;  2D9E A;  4TS8 A;  5CQ6 A;  3D7C A;  4Z6H A;  5I7Y A;  5J0D A;  5FB0 A;  4YY4 A;  5H1V A;  5CQ7 A;  4TT2 A;  5C7N A;  1EQF A;  5KTX A;  4PCI A;  5II2 A;  5D0C A;  5KU3 A;  4N4I A;  4QR5 A;  4UIV A;  5I40 A;  3K2J A;  3O36 A;  3UVX A;  4TT6 A;  3P1D A;  5FE2 A;  4QSQ A;  5H85 A;  5I80 A;  4Z1Q A;  2L84 A;  4UYE A;  5AD2 A;  3O34 A;  3JVK A;  5TCM A;  2YW5 A;  5A5R A;  2KTB B;  2DVR A;  3SVF A;  2OUO A;  4N4F A;  4QSX A;  5EM3 A;  5TB6 A;  4PY6 A;  5E3G A;  4PTB A;  5IG6 A;  2YEK A;  5C4Q A;  5LJ2 A;  4Y03 A;  4YH3 A;  2E7O A;  5A5S A;  3G0J A;  5LKZ A;  5CY9 A;  1PUO A;  4YYJ A;  3UW9 A;  1X0J A;  3UV2 A;  3HME A;  4CUT A;  3U5L A;  4YYM A;  5HRW A;  5I29 A;  3SVH A;  4N3W A;  4E96 A;  5I1Q A;  5EIC A;  5KO4 A;  4HXM A;  5CZG A;  1JSP B;  4QEV A;  5F3A A;  4QC1 A;  4NQN A;  4OUF A;  3LXJ A;  5DY7 A;  4O7E A;  4LRG A;  4AKG A;  2YQD A;  5CQ5 A;  4NR7 A;  5E0R A;  5D24 A;  4PKL A;  5FFV A;  5DKD A;  5ETD A;  3UV4 A;  3QZT A;  4J1P A;  3D1B A;  5HEN A; 
#chains in the Genus database with same CATH homology
 5ENI A;  4A9L A;  4HXK A;  4NR9 A;  4LYS A;  3DAI A;  4J0S A;  5IID A;  5FG6 A;  4TT4 A;  3DWY A;  4YYG A;  4NR4 A;  4NS5 A;  5FE8 A;  3MB4 A;  5CUC A;  5LKT A;  4OGI A;  5AD3 A;  2DVS A;  4ZQL A;  5EP7 A;  4UIX A;  4MEN A;  5C8G A;  4YBT A;  2R0V A;  4MR4 A;  4XY8 A;  4YAB A;  3LQH A;  4QR3 A;  5DYX A;  4WIV A;  4NRA A;  5LJ1 A;  3U5J A;  4IR6 A;  5EGU A;  1E6I A;  4QSU A;  5G4R A;  3MXF A;  2OO1 A;  3UVY A;  4QUU A;  5CQ3 A;  4Q0N A;  5ACY A;  2R0Y A;  3IU6 A;  5A82 A;  4NUE A;  4TQN A;  5A5N A;  5F60 A;  4O77 A;  5K29 A;  5G4S A;  5D26 A;  1JM4 B;  4LZ2 A;  5D3T A;  4MEP A;  4MR3 A;  4CUQ A;  4UYD A;  5DX4 A;  5A7C A;  4QBM A;  5HQ5 A;  4YAX A;  4MEQ A;  5D3P A;  5HRX A;  4O76 A;  5CRZ A;  4QY4 A;  5D3R A;  5EWH A;  5DYC A;  5DFD A;  2LSP B;  5ENE A;  4NXJ A;  5FE0 A;  4CLB A;  4HBY A;  2R10 A;  4XUA A;  4Q0O A;  5KTW A;  4QYD A;  3U5P A;  5FE4 A;  5CGP A;  5CTL A;  5ETB A;  2L85 A;  4LZR A;  4UIU A;  5IGK A;  2DKW A;  5CFW A;  4MEO A;  4UIY A;  4TU6 A;  4WHU A;  4BW1 A;  4QSW A;  4CUP A;  5LUU A;  4IOO A;  5L97 A;  2D82 A;  3LQI A;  5E9I A;  3GG3 A;  4O70 A;  5FBX A;  5FH7 A;  5DLZ A;  5ENC A;  4QSP A;  4BW4 A;  4N4H A;  4XY9 A;  4YAT A;  4BW3 A;  3MUL A;  5DFB A;  4DON A;  3UV5 A;  3AAD A;  5EV9 A;  5LVR A;  4Z1S A;  5HFR A;  3JVL A;  3LJW A;  4HBV A;  3QZS A;  4CL9 A;  2RFJ A;  3O35 A;  5E3D A;  5EU1 A;  4A9H A;  4PCE A;  5KHM A;  4UYF A;  2E3K A;  4TZ8 A;  4QC3 A;  3AQA A;  4XUB A;  5E7D A;  4IOR A;  4QST A;  5AME A;  4FLP A;  5EPR A;  4QB3 A;  4IR4 A;  4WHW A;  5ENH A;  5HRV A;  5F36 A;  4O7C A;  4O72 A;  5DBM A;  5HEL A;  5CUE A;  2YEM A;  4CUR A;  4C67 A;  4A9I A;  4HXR A;  4HXO A;  2E7N A;  5FE3 A;  5I86 A;  1ZS5 A;  5DKC A;  5CS8 A;  5FE9 A;  4BW2 A;  5CUA A;  4YH4 A;  4QSS A;  5DFC A;  4IR3 A;  2DAT A;  3FKM X;  5EIS A;  5JWM A;  5EWV A;  5A81 A;  5EWD A;  4A9M A;  5F62 A;  4Z6I A;  2H60 A;  3HMF A;  5FE7 A;  5DW1 A;  4O78 A;  5E9V A;  4NRC A;  5L98 A;  4ZW1 A;  5EA1 A;  3O33 A;  5EPS A;  4QUT A;  2DWW A;  4NR6 A;  5E74 A;  4IOQ A;  2F6N A;  2RS9 B;  4LC2 A;  5H1T A;  5C85 A;  4NQM A;  4TU4 A;  4TTE A;  4XYA A;  2DVV A;  3HMH A;  4MR5 A;  5CUD A;  5FE5 A;  3U5K A;  5DW2 A;  4QNS A;  2NXB A;  5LKU A;  4NRB A;  5IBN A;  4HBW A;  4GPJ A;  5E9L A;  3Q2E A;  4O71 A;  2GRC A;  4YYN A;  4QSR A;  4CFK A;  4J3I A;  3S91 A;  4O7A A;  4YYH A;  5LVQ A;  5EPB A;  4NYV A;  4PS5 A;  4TZ2 A;  5CRM A;  4LDF A;  5CQ8 A;  5DYA A;  4QEU A;  5EQ1 A;  5ENG A;  5EWC A;  5HQ6 A;  4N4G A;  5FFY A;  2WP2 A;  4NUC A;  2G4A A;  4UYH A;  5E73 A;  4BJX A;  5D3N A;  4BHW A;  4MR6 A;  4QEW A;  2OSS A;  5CUB A;  3TLP A;  3P1C A;  5DYU A;  5HCL A;  5FH8 A;  4ALG A;  4RVR A;  2YEL A;  2I8N A;  4AKN A;  5L8T A;  4YAD A;  3U5M A;  5F2P A;  3JVJ A;  5HLS A;  5F25 A;  5C87 A;  4NYX A;  5BT3 A;  2MJV B;  3Q2F A;  4Z93 A;  5A83 A;  4CUS A;  4NR8 A;  5CQ4 A;  2YYN A;  5L99 A;  5CU8 A;  4UIW A;  5L96 A;  4A9N A;  4CUU A;  5F61 A;  4OGJ A;  5CQT A;  4NR5 A;  3RCW A;  4HXN A;  1WUG A;  5BT5 A;  1WUM A;  3P1E A;  4CFL A;  4YY6 A;  5IGM A;  4NYW A;  3JVM A;  4O7B A;  5IGL A;  3ONI A;  4A9E A;  3O37 A;  5I88 A;  5E9Y A;  4YBM A;  2RNX A;  4LZS A;  5ENJ A;  5EK9 A;  5F63 A;  5HM0 A;  4YC9 A;  5CQA A;  5FE6 A;  5F1H A;  5FB1 A;  4C66 A;  4QYL A;  5C89 A;  3P5O A;  5A5Q A;  2F6J A;  5I7X A;  4LR6 A;  4ALH A;  5II1 A;  5KTU A;  4TYL A;  2I7K A;  5I83 A;  5HQ7 A;  4X2I A;  2RO1 A;  4UIT A;  3MB3 A;  5AMF A;  4F3I A;  5D3S A;  5FG4 A;  4KCX A;  1F68 A;  2FSA A;  4HXS A;  4A9K A;  3G0L A;  5BT4 A;  5D3H A;  5H1U A;  3QZV A;  5D25 A;  5HFQ A;  5ENF A;  2RNY A;  5EI4 A;  5A85 A;  4A9O A;  5L8U A;  5A5P A;  5LKX A;  2YDW A;  5FH6 A;  2RNW A;  5D7X A;  5FG5 A;  3S92 A;  4O75 A;  5FDZ A;  5DKH A;  3IU5 A;  4QR4 A;  4HBX A;  5EWW A;  5EVA A;  5A5O A;  4UYG A;  5COI A;  4NUD A;  4YYD A;  3P1F A;  5JI8 A;  5D3L A;  4IR5 A;  2N9G A;  4ZC9 A;  4HXP A;  3ZYU A;  3MQM A;  4QZS A;  5HEM A;  5HJC A;  5I89 A;  5DLX A;  3NXB A;  4J0R A;  3LQJ A;  5ENB A;  4HXL A;  4YK0 A;  3U5N A;  5CPE A;  5IGN A;  4A9F A;  4LYI A;  2DVQ A;  4O7F A;  4A9J A;  4KV4 A;  3MUK A;  2WP1 A;  4QSV A;  5E9M A;  2RI7 A;  3U5O A;  4YBS A;  4O74 A;  4UYF B;  5D3J A;  4LYW A;  4YYK A;  2R0S A;  5CUG A;  5F1L A;  3UVD A;  2L5E A;  4KV1 A;  5FE1 A;  5CP5 A;  5LJ0 A;  5F5Z A;  4YYI A;  3I3J A;  5E9K A;  5FFW A;  4UIZ A;  3SVG A;  3UVW A;  1N72 A;  2D9E A;  4TS8 A;  5CQ6 A;  3D7C A;  4Z6H A;  5I7Y A;  5J0D A;  5FB0 A;  4YY4 A;  5H1V A;  5CQ7 A;  4TT2 A;  5C7N A;  1EQF A;  5KTX A;  4PCI A;  5II2 A;  5D0C A;  5KU3 A;  4N4I A;  4QR5 A;  4UIV A;  5I40 A;  3K2J A;  3O36 A;  3UVX A;  4TT6 A;  3P1D A;  5FE2 A;  4QSQ A;  5H85 A;  5I80 A;  4Z1Q A;  2L84 A;  4UYE A;  5AD2 A;  3O34 A;  3JVK A;  5TCM A;  2YW5 A;  5A5R A;  2KTB B;  2DVR A;  3SVF A;  2OUO A;  4N4F A;  4QSX A;  5EM3 A;  5TB6 A;  4PY6 A;  5E3G A;  4PTB A;  5IG6 A;  2YEK A;  5C4Q A;  5LJ2 A;  4Y03 A;  4YH3 A;  2E7O A;  5A5S A;  3G0J A;  5LKZ A;  5CY9 A;  4YYJ A;  3UW9 A;  1X0J A;  3UV2 A;  3HME A;  4CUT A;  3U5L A;  4YYM A;  5HRW A;  5I29 A;  3SVH A;  4N3W A;  4E96 A;  5I1Q A;  5EIC A;  5KO4 A;  4HXM A;  5CZG A;  1JSP B;  4QEV A;  5F3A A;  4QC1 A;  4NQN A;  4OUF A;  3LXJ A;  5DY7 A;  4O7E A;  4LRG A;  2YQD A;  5CQ5 A;  4NR7 A;  5E0R A;  5D24 A;  4PKL A;  5FFV A;  5DKD A;  5ETD A;  3UV4 A;  3QZT A;  4J1P A;  5HEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...