5F1LA

Crystal structure of the bromodomain of brd9 in complex with compound 9.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 9
publication title Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5f1lA00
4YH4A 4N4IA 2NXBA 2I7KA 4IR6A 4N4FA 3SVGA 4QSWA 3K2JA 4C67A 4HXMA 5HFRA 5H1TA 5IGMA 5HENA 3MQMA 4RVRA 4NXJA 5D3SA 2YQDA 4YYJA 4UIUA 5G4RA 5E74A 5E7DA 5FFWA 5F62A 5I40A 2E7NA 5I83A 2DKWA 4NR6A 3QZSA 4A9IA 4TTEA 4NRBA 4QEVA 5C8GA 2DVVA 2OUOA 4IR3A 5II2A 5F63A 4J0SA 4LDFA 4MEQA 4HBYA 2RO1A 2R0SA 2I8NA 1JM4B 4UYFA 3UVYA 5L98A 3UV2A 5FB1A 5HJCA 4YBMA 5HFQA 4A9OA 4XYAA 4UIVA 4MR5A 4MENA 5FE2A 5EWWA 4AKNA 4QR5A 1WUGA 5EWDA 4TQNA 4QEUA 1N72A 5A5OA 4LZ2A 4QNSA 5I1QA 4HBXA 5BT5A 4WHUA 4CFLA 4O70A 5FFVA 5IGLA 4O71A 4QUUA 5G4SA 5ENHA 5FE5A 5DYUA 5FG4A 3P1DA 2RNYA 5F61A 5E9IA 5D3PA 4NQMA 3U5KA 4UYEA 2E3KA 5ENBA 5I29A 2RI7A 5FE4A 5C87A 5CUGA 4CUUA 5FE7A 5CUEA 5DKCA 4LZSA 5FH8A 5LKUA 5C7NA 4O77A 4FLPA 5C4QA 5A82A 5A5PA 3LJWA 4YYKA 5L99A 5F25A 4PCIA 5HCLA 5HM0A 5DX4A 4CUPA 4NUEA 5CQ3A 4CURA 5C85A 5IBNA 5E9KA 5EWCA 5A81A 5CQ5A 5EWVA 3U5MA 4UIZA 4UITA 4HXKA 4BW1A 4CUTA 4J0RA 4LC2A 4PS5A 5CY9A 1F68A 5DY7A 5A5QA 5EU1A 5DFDA 5DYCA 5AMEA 5FE1A 4Z93A 5CRMA 5CP5A 5DW1A 5IGNA 3Q2FA 2DWWA 5FE0A 3MUKA 5A7CA 2LSPB 4QSTA 5CQ6A 4PCEA 4NUDA 4QEWA 2D9EA 5H1UA 4TU4A 2E7OA 4KV4A 4Q0NA 4YYGA 4NYVA 3P1FA 4HXSA 5E3GA 3UV4A 5FE9A 2L85A 3U5NA 5EPRA 2F6JA 5EWHA 4OGIA 4UIXA 2DVSA 2L5EA 5CQTA 5ENCA 4YABA 5I86A 4PY6A 3RCWA 4YYMA 4KCXA 4ALHA 4UYHA 3G0LA 3ONIA 5CUCA 4PKLA 5F2PA 5EQ1A 4UIWA 4UYDA 5II1A 5ENEA 5HRVA 4NR9A 3P1CA 3I3JA 3UVXA 4YY4A 4YYNA 4HXRA 2N9GA 5F3AA 5FG5A 4HXPA 4IR4A 5DKHA 5E73A 5AMFA 3MULA 4TS8A 4A9LA 3U5OA 4QYLA 4TZ8A 4YAXA 5LVRA 2YW5A 4WIVA 4MR4A 5DBMA 5LKZA 4Z1QA 3P1EA 1WUMA 5ENJA 5LUUA 5BT4A 5JWMA 4NYXA 4MEPA 1X0JA 5F1LA 4ZW1A 5CFWA 3LQHA 5D0CA 3HMFA 5EISA 5FB0A 4O7CA 4QZSA 4QR4A 4BW4A 4O7BA 5E9LA 5I88A 5D3TA 4XUBA 4YATA 4TT4A 4UYGA 2L84A 4QUTA 4CLBA 4HXLA 4QSPA 5L8UA 5FH7A 5HQ6A 5DFCA 2YELA 4YK0A 5BT3A 4A9KA 5F1HA 4CUSA 4CL9A 5FH6A 4QB3A 4BJXA 5LJ0A 5KTWA 4NQNA 3U5JA 3U5PA 5D3HA 4Z6HA 4X2IA 4A9FA 5A5RA 3S92A 5I7XA 4BHWA 4TYLA 4Z6IA 4A9HA 1E6IA 4NUCA 3O33A 3O34A 5ENIA 4WHWA 4GPJA 4OUFA 4O78A 2DVRA 4NR4A 3DWYA 5LJ1A 3QZTA 5DLZA 5KU3A 4QSQA 4LYSA 2FSAA 3LXJA 4TU6A 3D7CA 4QSUA 2YYNA 2G4AA 5CRZA 2YEMA 4HBWA 3JVKA 3TLPA 5IIDA 4NYWA 4HXOA 4F3IA 2DATA 3GG3A 4QSRA 5EM3A 5A83A 5D3LA 3HMEA 2RFJA 5LVQA 4IOQA 5F5ZA 5FFYA 5CGPA 5FDZA 5I80A 2RNXA 4A9EA 5LKTA 3IU5A 4NR5A 2OO1A 5HRXA 4DONA 4Z1SA 3AADA 3HMHA 5KHMA 5I7YA 4YBSA 4QSVA 3MB4A 4LYWA 4YYIA 5D3RA 1JSPB 5HQ7A 4XY9A 5D7XA 4Y03A 2MJVB 5EPBA 3G0JA 5CZGA 4BW2A 4HBVA 5ACYA 5EGUA 4MR3A 5EP7A 4QSXA 5DKDA 5A5SA 4QBMA 3ZYUA 4CFKA 5FE3A 4N3WA 4YH3A 2WP1A 5IGKA 4KV1A 4ALGA 3JVLA 5L8TA 5CQAA 4UIYA 4TT2A 5CPEA 4YADA 4ZC9A 4O74A 2DVQA 5C89A 5CU8A 4QY4A 5CTLA 4QYDA 3SVFA 5FE8A 5CUBA 2R10A 5KTUA 5D24A 5HELA 4NRCA 4O72A 5F36A 2H60A 3Q2EA 4YBTA 5D26A 4XUAA 5LKXA 4C66A 5FG6A 5I89A 3S91A 5J0DA 3JVMA 4TT6A 5EICA 5EVAA 4E96A 3FKMX 4J3IA 5EV9A 5AD3A 3UV5A 5F60A 5DYXA 3SVHA 4NRAA 4OGJA 4LR6A 5FBXA 5KO4A 4NS5A 5IG6A 2R0VA 4IR5A 4QC1A 4N4GA 2RS9B 3P5OA 4UYFB 5HLSA 5EPSA 3AQAA 4YYHA 5ETDA 3O35A 5ETBA 5H1VA 5A85A 2KTBB 5CUAA 4YC9A 3JVJA 2RNWA 5EI4A 4Q0OA 5TCMA 2GRCA 2F6NA 4IORA 1EQFA 5LJ2A 2D82A 3UVDA 5L97A 2OSSA 5CQ7A 5A5NA 3MB3A 3O37A 3QZVA 5TB6A 5CQ8A 4O76A 4N4HA 5JI8A 5KTXA 5EA1A 5ENGA 4A9MA 4QC3A 3LQIA 5CQ4A 4LRGA 3UVWA 3U5LA 3UW9A 4O75A 5FE6A 5E9MA 4NR8A 4YYDA 5DW2A 2WP2A 5K29A 2YDWA 5EK9A 5COIA 2R0YA 5E0RA 5DFBA 4O7AA 4CUQA 5E9YA 5DYAA 5D3NA 3IU6A 4HXNA 5HQ5A 3LQJA 5DLXA 4O7FA 5ENFA 4NR7A 4TZ2A 4ZQLA 4O7EA 5D3JA 2YEKA 5E3DA 5CUDA 4IOOA 3NXBA 5H85A 4PTBA 5AD2A 4XY8A 4MEOA 4BW3A 5E9VA 4A9NA 3MXFA 3O36A 5HRWA 4LYIA 5L96A 5HEMA 4LZRA 4MR6A 4YY6A 4QSSA 3DAIA 1ZS5A 5D25A 4J1PA 4QR3A 5CS8A 4A9JA
chains in the Genus database with same CATH superfamily
4YH4A 4N4IA 2NXBA 2I7KA 4IR6A 4N4FA 3SVGA 4QSWA 3K2JA 4C67A 4HXMA 5HFRA 5H1TA 5IGMA 5HENA 3MQMA 4RVRA 4NXJA 5D3SA 3VKHA 2YQDA 4YYJA 4UIUA 5G4RA 5E74A 5E7DA 5FFWA 5F62A 5I40A 2E7NA 5I83A 2DKWA 4NR6A 3QZSA 4A9IA 4TTEA 4NRBA 4QEVA 5C8GA 2DVVA 2OUOA 4IR3A 5II2A 5F63A 4J0SA 4LDFA 4MEQA 4HBYA 2RO1A 2R0SA 2I8NA 1JM4B 4UYFA 3UVYA 5L98A 3UV2A 5FB1A 5HJCA 4YBMA 5HFQA 4A9OA 4XYAA 4UIVA 4MR5A 4MENA 5FE2A 4AI6A 5EWWA 4AKNA 4QR5A 1WUGA 5EWDA 4TQNA 4QEUA 1N72A 5A5OA 4LZ2A 4QNSA 5I1QA 4HBXA 5BT5A 4WHUA 4CFLA 4O70A 5FFVA 5IGLA 4O71A 4QUUA 5G4SA 5ENHA 5FE5A 5DYUA 5FG4A 3P1DA 2RNYA 5F61A 5E9IA 5D3PA 4NQMA 3U5KA 4UYEA 2E3KA 5ENBA 5I29A 2RI7A 5FE4A 5C87A 5CUGA 4CUUA 5FE7A 5CUEA 5DKCA 4LZSA 5FH8A 5LKUA 5C7NA 4O77A 4FLPA 5C4QA 5A82A 5A5PA 3LJWA 4YYKA 5L99A 5F25A 4PCIA 5HCLA 5HM0A 5DX4A 4CUPA 4AKIA 4NUEA 5CQ3A 4CURA 5C85A 5IBNA 5E9KA 5EWCA 5A81A 5CQ5A 5EWVA 3U5MA 4UIZA 4UITA 4HXKA 4BW1A 4CUTA 4J0RA 4LC2A 4PS5A 5CY9A 1F68A 5DY7A 5A5QA 5EU1A 5DFDA 5DYCA 5AMEA 5FE1A 4Z93A 5CRMA 5CP5A 5DW1A 5IGNA 3Q2FA 2DWWA 5FE0A 3MUKA 5A7CA 2LSPB 4QSTA 5CQ6A 4PCEA 4NUDA 4QEWA 2D9EA 5H1UA 4TU4A 2E7OA 4KV4A 4Q0NA 4YYGA 4NYVA 3P1FA 4HXSA 5E3GA 3UV4A 5FE9A 2L85A 3U5NA 5EPRA 2F6JA 5EWHA 4OGIA 4UIXA 2DVSA 2L5EA 5CQTA 5ENCA 4YABA 5I86A 4PY6A 3RCWA 4YYMA 4KCXA 4ALHA 4UYHA 3G0LA 3ONIA 5CUCA 4PKLA 5F2PA 5EQ1A 4UIWA 4UYDA 5II1A 5ENEA 5HRVA 4NR9A 3P1CA 3I3JA 3UVXA 4YY4A 4YYNA 4HXRA 2N9GA 5F3AA 5FG5A 4HXPA 4IR4A 5DKHA 5E73A 5AMFA 3MULA 4TS8A 4A9LA 3U5OA 4QYLA 4TZ8A 4YAXA 5LVRA 2YW5A 4WIVA 4MR4A 5DBMA 3D1DA 5LKZA 4Z1QA 3P1EA 1WUMA 5ENJA 5LUUA 5BT4A 5JWMA 4NYXA 4MEPA 1X0JA 5F1LA 4ZW1A 5CFWA 3LQHA 5D0CA 3HMFA 5EISA 5FB0A 4O7CA 1ZKRA 4QZSA 4QR4A 4BW4A 4O7BA 5E9LA 5I88A 5D3TA 4XUBA 3ERRA 4YATA 4TT4A 4UYGA 2L84A 4QUTA 4CLBA 4HXLA 4QSPA 5L8UA 5FH7A 5HQ6A 5DFCA 2YELA 4YK0A 5BT3A 4A9KA 5F1HA 4CUSA 4CL9A 5FH6A 4QB3A 4BJXA 5LJ0A 5KTWA 4NQNA 3U5JA 3U5PA 5D3HA 4Z6HA 4X2IA 4A9FA 5A5RA 3S92A 5I7XA 4BHWA 4TYLA 4Z6IA 4A9HA 1E6IA 4NUCA 3O33A 3O34A 5ENIA 4WHWA 4GPJA 4OUFA 4O78A 2DVRA 4NR4A 3DWYA 5LJ1A 3QZTA 5DLZA 5KU3A 4QSQA 4LYSA 2FSAA 3LXJA 4TU6A 3D7CA 4QSUA 2YYNA 2G4AA 5CRZA 2YEMA 3D1BA 4HBWA 3JVKA 3TLPA 5IIDA 4NYWA 4HXOA 4F3IA 2DATA 3GG3A 4QSRA 5EM3A 5A83A 5D3LA 3HMEA 2RFJA 5LVQA 4IOQA 5F5ZA 5FFYA 5CGPA 5FDZA 5I80A 2RNXA 4A9EA 5LKTA 3IU5A 4NR5A 2OO1A 5HRXA 4DONA 4Z1SA 3AADA 3HMHA 5KHMA 5I7YA 4YBSA 4QSVA 3MB4A 4LYWA 4YYIA 5D3RA 1JSPB 5HQ7A 4XY9A 5D7XA 4Y03A 2MJVB 5EPBA 3G0JA 5CZGA 4BW2A 4HBVA 5ACYA 5EGUA 4MR3A 5EP7A 4QSXA 5DKDA 5A5SA 4QBMA 3ZYUA 4CFKA 5FE3A 4N3WA 4YH3A 2WP1A 5IGKA 4KV1A 4ALGA 3JVLA 5L8TA 5CQAA 4AKHA 4UIYA 4TT2A 5CPEA 4YADA 4ZC9A 4O74A 2DVQA 5C89A 5CU8A 4QY4A 5CTLA 4QYDA 3SVFA 5FE8A 5CUBA 2R10A 5KTUA 3VKGA 5D24A 5HELA 4NRCA 4O72A 5F36A 2H60A 3Q2EA 4YBTA 5D26A 4XUAA 5LKXA 4C66A 5FG6A 5I89A 3S91A 5J0DA 3JVMA 4TT6A 5EICA 5EVAA 4E96A 3FKMX 4J3IA 5EV9A 5AD3A 3UV5A 5F60A 5DYXA 3SVHA 4NRAA 4OGJA 4LR6A 5FBXA 5KO4A 4NS5A 5IG6A 2R0VA 4IR5A 4QC1A 4AKGA 4N4GA 2RS9B 3P5OA 4UYFB 5HLSA 5EPSA 3AQAA 4YYHA 5ETDA 3O35A 5ETBA 5H1VA 5A85A 2KTBB 5CUAA 4YC9A 3JVJA 2RNWA 5EI4A 4Q0OA 5TCMA 2GRCA 2F6NA 4IORA 1EQFA 5LJ2A 2D82A 3UVDA 5L97A 2OSSA 5CQ7A 5A5NA 3MB3A 3O37A 3QZVA 5TB6A 5CQ8A 4O76A 4N4HA 5JI8A 5KTXA 5EA1A 5ENGA 4A9MA 4QC3A 3LQIA 5CQ4A 4LRGA 3UVWA 3U5LA 3UW9A 4O75A 2EJNA 5FE6A 5E9MA 4NR8A 4YYDA 5DW2A 2WP2A 5K29A 2YDWA 5EK9A 5COIA 2R0YA 5E0RA 5DFBA 4O7AA 4CUQA 5E9YA 5DYAA 5D3NA 3IU6A 4HXNA 5HQ5A 3LQJA 5DLXA 4O7FA 5ENFA 4NR7A 4TZ2A 4ZQLA 4O7EA 5D3JA 2YEKA 5E3DA 1PUOA 5CUDA 4IOOA 3NXBA 5H85A 4PTBA 5AD2A 4XY8A 4MEOA 4BW3A 5E9VA 4A9NA 3MXFA 3O36A 5HRWA 4LYIA 5L96A 5HEMA 4LZRA 4MR6A 4YY6A 4QSSA 3DAIA 1ZS5A 5D25A 4J1PA 4QR3A 5CS8A 4A9JA
chains in the Genus database with same CATH topology
4YH4A 4N4IA 2NXBA 2I7KA 4IR6A 4N4FA 3SVGA 4QSWA 3K2JA 4C67A 4HXMA 5HFRA 5H1TA 5IGMA 5HENA 3MQMA 4RVRA 4NXJA 5D3SA 2YQDA 4YYJA 4UIUA 5G4RA 5E74A 5E7DA 5FFWA 5F62A 5I40A 2E7NA 5I83A 2DKWA 4NR6A 3QZSA 4A9IA 4TTEA 4NRBA 4QEVA 5C8GA 2DVVA 2OUOA 4IR3A 5II2A 5F63A 4J0SA 4LDFA 4MEQA 4HBYA 2RO1A 2R0SA 2I8NA 1JM4B 4UYFA 3UVYA 5L98A 3UV2A 5FB1A 5HJCA 4YBMA 5HFQA 4A9OA 4XYAA 4UIVA 4MR5A 4MENA 5FE2A 5EWWA 4AKNA 4QR5A 1WUGA 5EWDA 4TQNA 4QEUA 1N72A 5A5OA 4LZ2A 4QNSA 5I1QA 4HBXA 5BT5A 4WHUA 4CFLA 4O70A 5FFVA 5IGLA 4O71A 4QUUA 5G4SA 5ENHA 5FE5A 5DYUA 5FG4A 3P1DA 2RNYA 5F61A 5E9IA 5D3PA 4NQMA 3U5KA 4UYEA 2E3KA 5ENBA 5I29A 2RI7A 5FE4A 5C87A 5CUGA 4CUUA 5FE7A 5CUEA 5DKCA 4LZSA 5FH8A 5LKUA 5C7NA 4O77A 4FLPA 5C4QA 5A82A 5A5PA 3LJWA 4YYKA 5L99A 5F25A 4PCIA 5HCLA 5HM0A 5DX4A 4CUPA 4NUEA 5CQ3A 4CURA 5C85A 5IBNA 5E9KA 5EWCA 5A81A 5CQ5A 5EWVA 3U5MA 4UIZA 4UITA 4HXKA 4BW1A 4CUTA 4J0RA 4LC2A 4PS5A 5CY9A 1F68A 5DY7A 5A5QA 5EU1A 5DFDA 5DYCA 5AMEA 5FE1A 4Z93A 5CRMA 5CP5A 5DW1A 5IGNA 3Q2FA 2DWWA 5FE0A 3MUKA 5A7CA 2LSPB 4QSTA 5CQ6A 4PCEA 4NUDA 4QEWA 2D9EA 5H1UA 4TU4A 2E7OA 4KV4A 4Q0NA 4YYGA 4NYVA 3P1FA 4HXSA 5E3GA 3UV4A 5FE9A 2L85A 3U5NA 5EPRA 2F6JA 5EWHA 4OGIA 4UIXA 2DVSA 2L5EA 5CQTA 5ENCA 4YABA 5I86A 4PY6A 3RCWA 4YYMA 4KCXA 4ALHA 4UYHA 3G0LA 3ONIA 5CUCA 4PKLA 5F2PA 5EQ1A 4UIWA 4UYDA 5II1A 5ENEA 5HRVA 4NR9A 3P1CA 3I3JA 3UVXA 4YY4A 4YYNA 4HXRA 2N9GA 5F3AA 5FG5A 4HXPA 4IR4A 5DKHA 5E73A 5AMFA 3MULA 4TS8A 4A9LA 3U5OA 4QYLA 4TZ8A 4YAXA 5LVRA 2YW5A 4WIVA 4MR4A 5DBMA 5LKZA 4Z1QA 3P1EA 1WUMA 5ENJA 5LUUA 5BT4A 5JWMA 4NYXA 4MEPA 1X0JA 5F1LA 4ZW1A 5CFWA 3LQHA 5D0CA 3HMFA 5EISA 5FB0A 4O7CA 4QZSA 4QR4A 4BW4A 4O7BA 5E9LA 5I88A 5D3TA 4XUBA 4YATA 4TT4A 4UYGA 2L84A 4QUTA 4CLBA 4HXLA 4QSPA 5L8UA 5FH7A 5HQ6A 5DFCA 2YELA 4YK0A 5BT3A 4A9KA 5F1HA 4CUSA 4CL9A 5FH6A 4QB3A 4BJXA 5LJ0A 5KTWA 4NQNA 3U5JA 3U5PA 5D3HA 4Z6HA 4X2IA 4A9FA 5A5RA 3S92A 5I7XA 4BHWA 4TYLA 4Z6IA 4A9HA 1E6IA 4NUCA 3O33A 3O34A 5ENIA 4WHWA 4GPJA 4OUFA 4O78A 2DVRA 4NR4A 3DWYA 5LJ1A 3QZTA 5DLZA 5KU3A 4QSQA 4LYSA 2FSAA 3LXJA 4TU6A 3D7CA 4QSUA 2YYNA 2G4AA 5CRZA 2YEMA 4HBWA 3JVKA 3TLPA 5IIDA 4NYWA 4HXOA 4F3IA 2DATA 3GG3A 4QSRA 5EM3A 5A83A 5D3LA 3HMEA 2RFJA 5LVQA 4IOQA 5F5ZA 5FFYA 5CGPA 5FDZA 5I80A 2RNXA 4A9EA 5LKTA 3IU5A 4NR5A 2OO1A 5HRXA 4DONA 4Z1SA 3AADA 3HMHA 5KHMA 5I7YA 4YBSA 4QSVA 3MB4A 4LYWA 4YYIA 5D3RA 1JSPB 5HQ7A 4XY9A 5D7XA 4Y03A 2MJVB 5EPBA 3G0JA 5CZGA 4BW2A 4HBVA 5ACYA 5EGUA 4MR3A 5EP7A 4QSXA 5DKDA 5A5SA 4QBMA 3ZYUA 4CFKA 5FE3A 4N3WA 4YH3A 2WP1A 5IGKA 4KV1A 4ALGA 3JVLA 5L8TA 5CQAA 4UIYA 4TT2A 5CPEA 4YADA 4ZC9A 4O74A 2DVQA 5C89A 5CU8A 4QY4A 5CTLA 4QYDA 3SVFA 5FE8A 5CUBA 2R10A 5KTUA 5D24A 5HELA 4NRCA 4O72A 5F36A 2H60A 3Q2EA 4YBTA 5D26A 4XUAA 5LKXA 4C66A 5FG6A 5I89A 3S91A 5J0DA 3JVMA 4TT6A 5EICA 5EVAA 4E96A 3FKMX 4J3IA 5EV9A 5AD3A 3UV5A 5F60A 5DYXA 3SVHA 4NRAA 4OGJA 4LR6A 5FBXA 5KO4A 4NS5A 5IG6A 2R0VA 4IR5A 4QC1A 4N4GA 2RS9B 3P5OA 4UYFB 5HLSA 5EPSA 3AQAA 4YYHA 5ETDA 3O35A 5ETBA 5H1VA 5A85A 2KTBB 5CUAA 4YC9A 3JVJA 2RNWA 5EI4A 4Q0OA 5TCMA 2GRCA 2F6NA 4IORA 1EQFA 5LJ2A 2D82A 3UVDA 5L97A 2OSSA 5CQ7A 5A5NA 3MB3A 3O37A 3QZVA 5TB6A 5CQ8A 4O76A 4N4HA 5JI8A 5KTXA 5EA1A 5ENGA 4A9MA 4QC3A 3LQIA 5CQ4A 4LRGA 3UVWA 3U5LA 3UW9A 4O75A 5FE6A 5E9MA 4NR8A 4YYDA 5DW2A 2WP2A 5K29A 2YDWA 5EK9A 5COIA 2R0YA 5E0RA 5DFBA 4O7AA 4CUQA 5E9YA 5DYAA 5D3NA 3IU6A 4HXNA 5HQ5A 3LQJA 5DLXA 4O7FA 5ENFA 4NR7A 4TZ2A 4ZQLA 4O7EA 5D3JA 2YEKA 5E3DA 5CUDA 4IOOA 3NXBA 5H85A 4PTBA 5AD2A 4XY8A 4MEOA 4BW3A 5E9VA 4A9NA 3MXFA 3O36A 5HRWA 4LYIA 5L96A 5HEMA 4LZRA 4MR6A 4YY6A 4QSSA 3DAIA 1ZS5A 5D25A 4J1PA 4QR3A 5CS8A 4A9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YH4 A;  4N4I A;  2NXB A;  2I7K A;  4IR6 A;  4N4F A;  3SVG A;  4QSW A;  3K2J A;  4C67 A;  4HXM A;  5HFR A;  5H1T A;  5IGM A;  5HEN A;  3MQM A;  4RVR A;  4NXJ A;  5D3S A;  2YQD A;  4YYJ A;  4UIU A;  5G4R A;  5E74 A;  5E7D A;  5FFW A;  5F62 A;  5I40 A;  2E7N A;  5I83 A;  2DKW A;  4NR6 A;  3QZS A;  4A9I A;  4TTE A;  4NRB A;  4QEV A;  5C8G A;  2DVV A;  2OUO A;  4IR3 A;  5II2 A;  5F63 A;  4J0S A;  4LDF A;  4MEQ A;  4HBY A;  2RO1 A;  2R0S A;  2I8N A;  1JM4 B;  4UYF A;  3UVY A;  5L98 A;  3UV2 A;  5FB1 A;  5HJC A;  4YBM A;  5HFQ A;  4A9O A;  4XYA A;  4UIV A;  4MR5 A;  4MEN A;  5FE2 A;  5EWW A;  4AKN A;  4QR5 A;  1WUG A;  5EWD A;  4TQN A;  4QEU A;  1N72 A;  5A5O A;  4LZ2 A;  4QNS A;  5I1Q A;  4HBX A;  5BT5 A;  4WHU A;  4CFL A;  4O70 A;  5FFV A;  5IGL A;  4O71 A;  4QUU A;  5G4S A;  5ENH A;  5FE5 A;  5DYU A;  5FG4 A;  3P1D A;  2RNY A;  5F61 A;  5E9I A;  5D3P A;  4NQM A;  3U5K A;  4UYE A;  2E3K A;  5ENB A;  5I29 A;  2RI7 A;  5FE4 A;  5C87 A;  5CUG A;  4CUU A;  5FE7 A;  5CUE A;  5DKC A;  4LZS A;  5FH8 A;  5LKU A;  5C7N A;  4O77 A;  4FLP A;  5C4Q A;  5A82 A;  5A5P A;  3LJW A;  4YYK A;  5L99 A;  5F25 A;  4PCI A;  5HCL A;  5HM0 A;  5DX4 A;  4CUP A;  4NUE A;  5CQ3 A;  4CUR A;  5C85 A;  5IBN A;  5E9K A;  5EWC A;  5A81 A;  5CQ5 A;  5EWV A;  3U5M A;  4UIZ A;  4UIT A;  4HXK A;  4BW1 A;  4CUT A;  4J0R A;  4LC2 A;  4PS5 A;  5CY9 A;  1F68 A;  5DY7 A;  5A5Q A;  5EU1 A;  5DFD A;  5DYC A;  5AME A;  5FE1 A;  4Z93 A;  5CRM A;  5CP5 A;  5DW1 A;  5IGN A;  3Q2F A;  2DWW A;  5FE0 A;  3MUK A;  5A7C A;  2LSP B;  4QST A;  5CQ6 A;  4PCE A;  4NUD A;  4QEW A;  2D9E A;  5H1U A;  4TU4 A;  2E7O A;  4KV4 A;  4Q0N A;  4YYG A;  4NYV A;  3P1F A;  4HXS A;  5E3G A;  3UV4 A;  5FE9 A;  2L85 A;  3U5N A;  5EPR A;  2F6J A;  5EWH A;  4OGI A;  4UIX A;  2DVS A;  2L5E A;  5CQT A;  5ENC A;  4YAB A;  5I86 A;  4PY6 A;  3RCW A;  4YYM A;  4KCX A;  4ALH A;  4UYH A;  3G0L A;  3ONI A;  5CUC A;  4PKL A;  5F2P A;  5EQ1 A;  4UIW A;  4UYD A;  5II1 A;  5ENE A;  5HRV A;  4NR9 A;  3P1C A;  3I3J A;  3UVX A;  4YY4 A;  4YYN A;  4HXR A;  2N9G A;  5F3A A;  5FG5 A;  4HXP A;  4IR4 A;  5DKH A;  5E73 A;  5AMF A;  3MUL A;  4TS8 A;  4A9L A;  3U5O A;  4QYL A;  4TZ8 A;  4YAX A;  5LVR A;  2YW5 A;  4WIV A;  4MR4 A;  5DBM A;  5LKZ A;  4Z1Q A;  3P1E A;  1WUM A;  5ENJ A;  5LUU A;  5BT4 A;  5JWM A;  4NYX A;  4MEP A;  1X0J A;  5F1L A;  4ZW1 A;  5CFW A;  3LQH A;  5D0C A;  3HMF A;  5EIS A;  5FB0 A;  4O7C A;  4QZS A;  4QR4 A;  4BW4 A;  4O7B A;  5E9L A;  5I88 A;  5D3T A;  4XUB A;  4YAT A;  4TT4 A;  4UYG A;  2L84 A;  4QUT A;  4CLB A;  4HXL A;  4QSP A;  5L8U A;  5FH7 A;  5HQ6 A;  5DFC A;  2YEL A;  4YK0 A;  5BT3 A;  4A9K A;  5F1H A;  4CUS A;  4CL9 A;  5FH6 A;  4QB3 A;  4BJX A;  5LJ0 A;  5KTW A;  4NQN A;  3U5J A;  3U5P A;  5D3H A;  4Z6H A;  4X2I A;  4A9F A;  5A5R A;  3S92 A;  5I7X A;  4BHW A;  4TYL A;  4Z6I A;  4A9H A;  1E6I A;  4NUC A;  3O33 A;  3O34 A;  5ENI A;  4WHW A;  4GPJ A;  4OUF A;  4O78 A;  2DVR A;  4NR4 A;  3DWY A;  5LJ1 A;  3QZT A;  5DLZ A;  5KU3 A;  4QSQ A;  4LYS A;  2FSA A;  3LXJ A;  4TU6 A;  3D7C A;  4QSU A;  2YYN A;  2G4A A;  5CRZ A;  2YEM A;  4HBW A;  3JVK A;  3TLP A;  5IID A;  4NYW A;  4HXO A;  4F3I A;  2DAT A;  3GG3 A;  4QSR A;  5EM3 A;  5A83 A;  5D3L A;  3HME A;  2RFJ A;  5LVQ A;  4IOQ A;  5F5Z A;  5FFY A;  5CGP A;  5FDZ A;  5I80 A;  2RNX A;  4A9E A;  5LKT A;  3IU5 A;  4NR5 A;  2OO1 A;  5HRX A;  4DON A;  4Z1S A;  3AAD A;  3HMH A;  5KHM A;  5I7Y A;  4YBS A;  4QSV A;  3MB4 A;  4LYW A;  4YYI A;  5D3R A;  1JSP B;  5HQ7 A;  4XY9 A;  5D7X A;  4Y03 A;  2MJV B;  5EPB A;  3G0J A;  5CZG A;  4BW2 A;  4HBV A;  5ACY A;  5EGU A;  4MR3 A;  5EP7 A;  4QSX A;  5DKD A;  5A5S A;  4QBM A;  3ZYU A;  4CFK A;  5FE3 A;  4N3W A;  4YH3 A;  2WP1 A;  5IGK A;  4KV1 A;  4ALG A;  3JVL A;  5L8T A;  5CQA A;  4UIY A;  4TT2 A;  5CPE A;  4YAD A;  4ZC9 A;  4O74 A;  2DVQ A;  5C89 A;  5CU8 A;  4QY4 A;  5CTL A;  4QYD A;  3SVF A;  5FE8 A;  5CUB A;  2R10 A;  5KTU A;  5D24 A;  5HEL A;  4NRC A;  4O72 A;  5F36 A;  2H60 A;  3Q2E A;  4YBT A;  5D26 A;  4XUA A;  5LKX A;  4C66 A;  5FG6 A;  5I89 A;  3S91 A;  5J0D A;  3JVM A;  4TT6 A;  5EIC A;  5EVA A;  4E96 A;  3FKM X;  4J3I A;  5EV9 A;  5AD3 A;  3UV5 A;  5F60 A;  5DYX A;  3SVH A;  4NRA A;  4OGJ A;  4LR6 A;  5FBX A;  5KO4 A;  4NS5 A;  5IG6 A;  2R0V A;  4IR5 A;  4QC1 A;  4N4G A;  2RS9 B;  3P5O A;  4UYF B;  5HLS A;  5EPS A;  3AQA A;  4YYH A;  5ETD A;  3O35 A;  5ETB A;  5H1V A;  5A85 A;  2KTB B;  5CUA A;  4YC9 A;  3JVJ A;  2RNW A;  5EI4 A;  4Q0O A;  5TCM A;  2GRC A;  2F6N A;  4IOR A;  1EQF A;  5LJ2 A;  2D82 A;  3UVD A;  5L97 A;  2OSS A;  5CQ7 A;  5A5N A;  3MB3 A;  3O37 A;  3QZV A;  5TB6 A;  5CQ8 A;  4O76 A;  4N4H A;  5JI8 A;  5KTX A;  5EA1 A;  5ENG A;  4A9M A;  4QC3 A;  3LQI A;  5CQ4 A;  4LRG A;  3UVW A;  3U5L A;  3UW9 A;  4O75 A;  5FE6 A;  5E9M A;  4NR8 A;  4YYD A;  5DW2 A;  2WP2 A;  5K29 A;  2YDW A;  5EK9 A;  5COI A;  2R0Y A;  5E0R A;  5DFB A;  4O7A A;  4CUQ A;  5E9Y A;  5DYA A;  5D3N A;  3IU6 A;  4HXN A;  5HQ5 A;  3LQJ A;  5DLX A;  4O7F A;  5ENF A;  4NR7 A;  4TZ2 A;  4ZQL A;  4O7E A;  5D3J A;  2YEK A;  5E3D A;  5CUD A;  4IOO A;  3NXB A;  5H85 A;  4PTB A;  5AD2 A;  4XY8 A;  4MEO A;  4BW3 A;  5E9V A;  4A9N A;  3MXF A;  3O36 A;  5HRW A;  4LYI A;  5L96 A;  5HEM A;  4LZR A;  4MR6 A;  4YY6 A;  4QSS A;  3DAI A;  1ZS5 A;  5D25 A;  4J1P A;  4QR3 A;  5CS8 A;  4A9J A; 
#chains in the Genus database with same CATH topology
 4YH4 A;  4N4I A;  2NXB A;  2I7K A;  4IR6 A;  4N4F A;  3SVG A;  4QSW A;  3K2J A;  4C67 A;  4HXM A;  5HFR A;  5H1T A;  5IGM A;  5HEN A;  3MQM A;  4RVR A;  4NXJ A;  5D3S A;  3VKH A;  2YQD A;  4YYJ A;  4UIU A;  5G4R A;  5E74 A;  5E7D A;  5FFW A;  5F62 A;  5I40 A;  2E7N A;  5I83 A;  2DKW A;  4NR6 A;  3QZS A;  4A9I A;  4TTE A;  4NRB A;  4QEV A;  5C8G A;  2DVV A;  2OUO A;  4IR3 A;  5II2 A;  5F63 A;  4J0S A;  4LDF A;  4MEQ A;  4HBY A;  2RO1 A;  2R0S A;  2I8N A;  1JM4 B;  4UYF A;  3UVY A;  5L98 A;  3UV2 A;  5FB1 A;  5HJC A;  4YBM A;  5HFQ A;  4A9O A;  4XYA A;  4UIV A;  4MR5 A;  4MEN A;  5FE2 A;  4AI6 A;  5EWW A;  4AKN A;  4QR5 A;  1WUG A;  5EWD A;  4TQN A;  4QEU A;  1N72 A;  5A5O A;  4LZ2 A;  4QNS A;  5I1Q A;  4HBX A;  5BT5 A;  4WHU A;  4CFL A;  4O70 A;  5FFV A;  5IGL A;  4O71 A;  4QUU A;  5G4S A;  5ENH A;  5FE5 A;  5DYU A;  5FG4 A;  3P1D A;  2RNY A;  5F61 A;  5E9I A;  5D3P A;  4NQM A;  3U5K A;  4UYE A;  2E3K A;  5ENB A;  5I29 A;  2RI7 A;  5FE4 A;  5C87 A;  5CUG A;  4CUU A;  5FE7 A;  5CUE A;  5DKC A;  4LZS A;  5FH8 A;  5LKU A;  5C7N A;  4O77 A;  4FLP A;  5C4Q A;  5A82 A;  5A5P A;  3LJW A;  4YYK A;  5L99 A;  5F25 A;  4PCI A;  5HCL A;  5HM0 A;  5DX4 A;  4CUP A;  4AKI A;  4NUE A;  5CQ3 A;  4CUR A;  5C85 A;  5IBN A;  5E9K A;  5EWC A;  5A81 A;  5CQ5 A;  5EWV A;  3U5M A;  4UIZ A;  4UIT A;  4HXK A;  4BW1 A;  4CUT A;  4J0R A;  4LC2 A;  4PS5 A;  5CY9 A;  1F68 A;  5DY7 A;  5A5Q A;  5EU1 A;  5DFD A;  5DYC A;  5AME A;  5FE1 A;  4Z93 A;  5CRM A;  5CP5 A;  5DW1 A;  5IGN A;  3Q2F A;  2DWW A;  5FE0 A;  3MUK A;  5A7C A;  2LSP B;  4QST A;  5CQ6 A;  4PCE A;  4NUD A;  4QEW A;  2D9E A;  5H1U A;  4TU4 A;  2E7O A;  4KV4 A;  4Q0N A;  4YYG A;  4NYV A;  3P1F A;  4HXS A;  5E3G A;  3UV4 A;  5FE9 A;  2L85 A;  3U5N A;  5EPR A;  2F6J A;  5EWH A;  4OGI A;  4UIX A;  2DVS A;  2L5E A;  5CQT A;  5ENC A;  4YAB A;  5I86 A;  4PY6 A;  3RCW A;  4YYM A;  4KCX A;  4ALH A;  4UYH A;  3G0L A;  3ONI A;  5CUC A;  4PKL A;  5F2P A;  5EQ1 A;  4UIW A;  4UYD A;  5II1 A;  5ENE A;  5HRV A;  4NR9 A;  3P1C A;  3I3J A;  3UVX A;  4YY4 A;  4YYN A;  4HXR A;  2N9G A;  5F3A A;  5FG5 A;  4HXP A;  4IR4 A;  5DKH A;  5E73 A;  5AMF A;  3MUL A;  4TS8 A;  4A9L A;  3U5O A;  4QYL A;  4TZ8 A;  4YAX A;  5LVR A;  2YW5 A;  4WIV A;  4MR4 A;  5DBM A;  3D1D A;  5LKZ A;  4Z1Q A;  3P1E A;  1WUM A;  5ENJ A;  5LUU A;  5BT4 A;  5JWM A;  4NYX A;  4MEP A;  1X0J A;  5F1L A;  4ZW1 A;  5CFW A;  3LQH A;  5D0C A;  3HMF A;  5EIS A;  5FB0 A;  4O7C A;  1ZKR A;  4QZS A;  4QR4 A;  4BW4 A;  4O7B A;  5E9L A;  5I88 A;  5D3T A;  4XUB A;  3ERR A;  4YAT A;  4TT4 A;  4UYG A;  2L84 A;  4QUT A;  4CLB A;  4HXL A;  4QSP A;  5L8U A;  5FH7 A;  5HQ6 A;  5DFC A;  2YEL A;  4YK0 A;  5BT3 A;  4A9K A;  5F1H A;  4CUS A;  4CL9 A;  5FH6 A;  4QB3 A;  4BJX A;  5LJ0 A;  5KTW A;  4NQN A;  3U5J A;  3U5P A;  5D3H A;  4Z6H A;  4X2I A;  4A9F A;  5A5R A;  3S92 A;  5I7X A;  4BHW A;  4TYL A;  4Z6I A;  4A9H A;  1E6I A;  4NUC A;  3O33 A;  3O34 A;  5ENI A;  4WHW A;  4GPJ A;  4OUF A;  4O78 A;  2DVR A;  4NR4 A;  3DWY A;  5LJ1 A;  3QZT A;  5DLZ A;  5KU3 A;  4QSQ A;  4LYS A;  2FSA A;  3LXJ A;  4TU6 A;  3D7C A;  4QSU A;  2YYN A;  2G4A A;  5CRZ A;  2YEM A;  3D1B A;  4HBW A;  3JVK A;  3TLP A;  5IID A;  4NYW A;  4HXO A;  4F3I A;  2DAT A;  3GG3 A;  4QSR A;  5EM3 A;  5A83 A;  5D3L A;  3HME A;  2RFJ A;  5LVQ A;  4IOQ A;  5F5Z A;  5FFY A;  5CGP A;  5FDZ A;  5I80 A;  2RNX A;  4A9E A;  5LKT A;  3IU5 A;  4NR5 A;  2OO1 A;  5HRX A;  4DON A;  4Z1S A;  3AAD A;  3HMH A;  5KHM A;  5I7Y A;  4YBS A;  4QSV A;  3MB4 A;  4LYW A;  4YYI A;  5D3R A;  1JSP B;  5HQ7 A;  4XY9 A;  5D7X A;  4Y03 A;  2MJV B;  5EPB A;  3G0J A;  5CZG A;  4BW2 A;  4HBV A;  5ACY A;  5EGU A;  4MR3 A;  5EP7 A;  4QSX A;  5DKD A;  5A5S A;  4QBM A;  3ZYU A;  4CFK A;  5FE3 A;  4N3W A;  4YH3 A;  2WP1 A;  5IGK A;  4KV1 A;  4ALG A;  3JVL A;  5L8T A;  5CQA A;  4AKH A;  4UIY A;  4TT2 A;  5CPE A;  4YAD A;  4ZC9 A;  4O74 A;  2DVQ A;  5C89 A;  5CU8 A;  4QY4 A;  5CTL A;  4QYD A;  3SVF A;  5FE8 A;  5CUB A;  2R10 A;  5KTU A;  3VKG A;  5D24 A;  5HEL A;  4NRC A;  4O72 A;  5F36 A;  2H60 A;  3Q2E A;  4YBT A;  5D26 A;  4XUA A;  5LKX A;  4C66 A;  5FG6 A;  5I89 A;  3S91 A;  5J0D A;  3JVM A;  4TT6 A;  5EIC A;  5EVA A;  4E96 A;  3FKM X;  4J3I A;  5EV9 A;  5AD3 A;  3UV5 A;  5F60 A;  5DYX A;  3SVH A;  4NRA A;  4OGJ A;  4LR6 A;  5FBX A;  5KO4 A;  4NS5 A;  5IG6 A;  2R0V A;  4IR5 A;  4QC1 A;  4AKG A;  4N4G A;  2RS9 B;  3P5O A;  4UYF B;  5HLS A;  5EPS A;  3AQA A;  4YYH A;  5ETD A;  3O35 A;  5ETB A;  5H1V A;  5A85 A;  2KTB B;  5CUA A;  4YC9 A;  3JVJ A;  2RNW A;  5EI4 A;  4Q0O A;  5TCM A;  2GRC A;  2F6N A;  4IOR A;  1EQF A;  5LJ2 A;  2D82 A;  3UVD A;  5L97 A;  2OSS A;  5CQ7 A;  5A5N A;  3MB3 A;  3O37 A;  3QZV A;  5TB6 A;  5CQ8 A;  4O76 A;  4N4H A;  5JI8 A;  5KTX A;  5EA1 A;  5ENG A;  4A9M A;  4QC3 A;  3LQI A;  5CQ4 A;  4LRG A;  3UVW A;  3U5L A;  3UW9 A;  4O75 A;  2EJN A;  5FE6 A;  5E9M A;  4NR8 A;  4YYD A;  5DW2 A;  2WP2 A;  5K29 A;  2YDW A;  5EK9 A;  5COI A;  2R0Y A;  5E0R A;  5DFB A;  4O7A A;  4CUQ A;  5E9Y A;  5DYA A;  5D3N A;  3IU6 A;  4HXN A;  5HQ5 A;  3LQJ A;  5DLX A;  4O7F A;  5ENF A;  4NR7 A;  4TZ2 A;  4ZQL A;  4O7E A;  5D3J A;  2YEK A;  5E3D A;  1PUO A;  5CUD A;  4IOO A;  3NXB A;  5H85 A;  4PTB A;  5AD2 A;  4XY8 A;  4MEO A;  4BW3 A;  5E9V A;  4A9N A;  3MXF A;  3O36 A;  5HRW A;  4LYI A;  5L96 A;  5HEM A;  4LZR A;  4MR6 A;  4YY6 A;  4QSS A;  3DAI A;  1ZS5 A;  5D25 A;  4J1P A;  4QR3 A;  5CS8 A;  4A9J A; 
#chains in the Genus database with same CATH homology
 4YH4 A;  4N4I A;  2NXB A;  2I7K A;  4IR6 A;  4N4F A;  3SVG A;  4QSW A;  3K2J A;  4C67 A;  4HXM A;  5HFR A;  5H1T A;  5IGM A;  5HEN A;  3MQM A;  4RVR A;  4NXJ A;  5D3S A;  2YQD A;  4YYJ A;  4UIU A;  5G4R A;  5E74 A;  5E7D A;  5FFW A;  5F62 A;  5I40 A;  2E7N A;  5I83 A;  2DKW A;  4NR6 A;  3QZS A;  4A9I A;  4TTE A;  4NRB A;  4QEV A;  5C8G A;  2DVV A;  2OUO A;  4IR3 A;  5II2 A;  5F63 A;  4J0S A;  4LDF A;  4MEQ A;  4HBY A;  2RO1 A;  2R0S A;  2I8N A;  1JM4 B;  4UYF A;  3UVY A;  5L98 A;  3UV2 A;  5FB1 A;  5HJC A;  4YBM A;  5HFQ A;  4A9O A;  4XYA A;  4UIV A;  4MR5 A;  4MEN A;  5FE2 A;  5EWW A;  4AKN A;  4QR5 A;  1WUG A;  5EWD A;  4TQN A;  4QEU A;  1N72 A;  5A5O A;  4LZ2 A;  4QNS A;  5I1Q A;  4HBX A;  5BT5 A;  4WHU A;  4CFL A;  4O70 A;  5FFV A;  5IGL A;  4O71 A;  4QUU A;  5G4S A;  5ENH A;  5FE5 A;  5DYU A;  5FG4 A;  3P1D A;  2RNY A;  5F61 A;  5E9I A;  5D3P A;  4NQM A;  3U5K A;  4UYE A;  2E3K A;  5ENB A;  5I29 A;  2RI7 A;  5FE4 A;  5C87 A;  5CUG A;  4CUU A;  5FE7 A;  5CUE A;  5DKC A;  4LZS A;  5FH8 A;  5LKU A;  5C7N A;  4O77 A;  4FLP A;  5C4Q A;  5A82 A;  5A5P A;  3LJW A;  4YYK A;  5L99 A;  5F25 A;  4PCI A;  5HCL A;  5HM0 A;  5DX4 A;  4CUP A;  4NUE A;  5CQ3 A;  4CUR A;  5C85 A;  5IBN A;  5E9K A;  5EWC A;  5A81 A;  5CQ5 A;  5EWV A;  3U5M A;  4UIZ A;  4UIT A;  4HXK A;  4BW1 A;  4CUT A;  4J0R A;  4LC2 A;  4PS5 A;  5CY9 A;  1F68 A;  5DY7 A;  5A5Q A;  5EU1 A;  5DFD A;  5DYC A;  5AME A;  5FE1 A;  4Z93 A;  5CRM A;  5CP5 A;  5DW1 A;  5IGN A;  3Q2F A;  2DWW A;  5FE0 A;  3MUK A;  5A7C A;  2LSP B;  4QST A;  5CQ6 A;  4PCE A;  4NUD A;  4QEW A;  2D9E A;  5H1U A;  4TU4 A;  2E7O A;  4KV4 A;  4Q0N A;  4YYG A;  4NYV A;  3P1F A;  4HXS A;  5E3G A;  3UV4 A;  5FE9 A;  2L85 A;  3U5N A;  5EPR A;  2F6J A;  5EWH A;  4OGI A;  4UIX A;  2DVS A;  2L5E A;  5CQT A;  5ENC A;  4YAB A;  5I86 A;  4PY6 A;  3RCW A;  4YYM A;  4KCX A;  4ALH A;  4UYH A;  3G0L A;  3ONI A;  5CUC A;  4PKL A;  5F2P A;  5EQ1 A;  4UIW A;  4UYD A;  5II1 A;  5ENE A;  5HRV A;  4NR9 A;  3P1C A;  3I3J A;  3UVX A;  4YY4 A;  4YYN A;  4HXR A;  2N9G A;  5F3A A;  5FG5 A;  4HXP A;  4IR4 A;  5DKH A;  5E73 A;  5AMF A;  3MUL A;  4TS8 A;  4A9L A;  3U5O A;  4QYL A;  4TZ8 A;  4YAX A;  5LVR A;  2YW5 A;  4WIV A;  4MR4 A;  5DBM A;  5LKZ A;  4Z1Q A;  3P1E A;  1WUM A;  5ENJ A;  5LUU A;  5BT4 A;  5JWM A;  4NYX A;  4MEP A;  1X0J A;  5F1L A;  4ZW1 A;  5CFW A;  3LQH A;  5D0C A;  3HMF A;  5EIS A;  5FB0 A;  4O7C A;  4QZS A;  4QR4 A;  4BW4 A;  4O7B A;  5E9L A;  5I88 A;  5D3T A;  4XUB A;  4YAT A;  4TT4 A;  4UYG A;  2L84 A;  4QUT A;  4CLB A;  4HXL A;  4QSP A;  5L8U A;  5FH7 A;  5HQ6 A;  5DFC A;  2YEL A;  4YK0 A;  5BT3 A;  4A9K A;  5F1H A;  4CUS A;  4CL9 A;  5FH6 A;  4QB3 A;  4BJX A;  5LJ0 A;  5KTW A;  4NQN A;  3U5J A;  3U5P A;  5D3H A;  4Z6H A;  4X2I A;  4A9F A;  5A5R A;  3S92 A;  5I7X A;  4BHW A;  4TYL A;  4Z6I A;  4A9H A;  1E6I A;  4NUC A;  3O33 A;  3O34 A;  5ENI A;  4WHW A;  4GPJ A;  4OUF A;  4O78 A;  2DVR A;  4NR4 A;  3DWY A;  5LJ1 A;  3QZT A;  5DLZ A;  5KU3 A;  4QSQ A;  4LYS A;  2FSA A;  3LXJ A;  4TU6 A;  3D7C A;  4QSU A;  2YYN A;  2G4A A;  5CRZ A;  2YEM A;  4HBW A;  3JVK A;  3TLP A;  5IID A;  4NYW A;  4HXO A;  4F3I A;  2DAT A;  3GG3 A;  4QSR A;  5EM3 A;  5A83 A;  5D3L A;  3HME A;  2RFJ A;  5LVQ A;  4IOQ A;  5F5Z A;  5FFY A;  5CGP A;  5FDZ A;  5I80 A;  2RNX A;  4A9E A;  5LKT A;  3IU5 A;  4NR5 A;  2OO1 A;  5HRX A;  4DON A;  4Z1S A;  3AAD A;  3HMH A;  5KHM A;  5I7Y A;  4YBS A;  4QSV A;  3MB4 A;  4LYW A;  4YYI A;  5D3R A;  1JSP B;  5HQ7 A;  4XY9 A;  5D7X A;  4Y03 A;  2MJV B;  5EPB A;  3G0J A;  5CZG A;  4BW2 A;  4HBV A;  5ACY A;  5EGU A;  4MR3 A;  5EP7 A;  4QSX A;  5DKD A;  5A5S A;  4QBM A;  3ZYU A;  4CFK A;  5FE3 A;  4N3W A;  4YH3 A;  2WP1 A;  5IGK A;  4KV1 A;  4ALG A;  3JVL A;  5L8T A;  5CQA A;  4UIY A;  4TT2 A;  5CPE A;  4YAD A;  4ZC9 A;  4O74 A;  2DVQ A;  5C89 A;  5CU8 A;  4QY4 A;  5CTL A;  4QYD A;  3SVF A;  5FE8 A;  5CUB A;  2R10 A;  5KTU A;  5D24 A;  5HEL A;  4NRC A;  4O72 A;  5F36 A;  2H60 A;  3Q2E A;  4YBT A;  5D26 A;  4XUA A;  5LKX A;  4C66 A;  5FG6 A;  5I89 A;  3S91 A;  5J0D A;  3JVM A;  4TT6 A;  5EIC A;  5EVA A;  4E96 A;  3FKM X;  4J3I A;  5EV9 A;  5AD3 A;  3UV5 A;  5F60 A;  5DYX A;  3SVH A;  4NRA A;  4OGJ A;  4LR6 A;  5FBX A;  5KO4 A;  4NS5 A;  5IG6 A;  2R0V A;  4IR5 A;  4QC1 A;  4N4G A;  2RS9 B;  3P5O A;  4UYF B;  5HLS A;  5EPS A;  3AQA A;  4YYH A;  5ETD A;  3O35 A;  5ETB A;  5H1V A;  5A85 A;  2KTB B;  5CUA A;  4YC9 A;  3JVJ A;  2RNW A;  5EI4 A;  4Q0O A;  5TCM A;  2GRC A;  2F6N A;  4IOR A;  1EQF A;  5LJ2 A;  2D82 A;  3UVD A;  5L97 A;  2OSS A;  5CQ7 A;  5A5N A;  3MB3 A;  3O37 A;  3QZV A;  5TB6 A;  5CQ8 A;  4O76 A;  4N4H A;  5JI8 A;  5KTX A;  5EA1 A;  5ENG A;  4A9M A;  4QC3 A;  3LQI A;  5CQ4 A;  4LRG A;  3UVW A;  3U5L A;  3UW9 A;  4O75 A;  5FE6 A;  5E9M A;  4NR8 A;  4YYD A;  5DW2 A;  2WP2 A;  5K29 A;  2YDW A;  5EK9 A;  5COI A;  2R0Y A;  5E0R A;  5DFB A;  4O7A A;  4CUQ A;  5E9Y A;  5DYA A;  5D3N A;  3IU6 A;  4HXN A;  5HQ5 A;  3LQJ A;  5DLX A;  4O7F A;  5ENF A;  4NR7 A;  4TZ2 A;  4ZQL A;  4O7E A;  5D3J A;  2YEK A;  5E3D A;  5CUD A;  4IOO A;  3NXB A;  5H85 A;  4PTB A;  5AD2 A;  4XY8 A;  4MEO A;  4BW3 A;  5E9V A;  4A9N A;  3MXF A;  3O36 A;  5HRW A;  4LYI A;  5L96 A;  5HEM A;  4LZR A;  4MR6 A;  4YY6 A;  4QSS A;  3DAI A;  1ZS5 A;  5D25 A;  4J1P A;  4QR3 A;  5CS8 A;  4A9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...