5F1LA

Crystal structure of the bromodomain of brd9 in complex with compound 9.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 9
publication title Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5f1lA00
4QZSA 5D3NA 3AQAA 5F3AA 4QBMA 3O34A 3LJWA 3UVDA 2RO1A 4QSTA 4QY4A 4X2IA 4LZRA 5HQ7A 2RFJA 4CFLA 4YYJA 5A5SA 5ENCA 3G0LA 5ACYA 5EISA 3D7CA 4O74A 5D3RA 5KTWA 5FE4A 4A9JA 5DFBA 4Q0OA 4TT2A 5EM3A 5EWDA 5CUCA 4WHUA 5LJ1A 3HMHA 3IU5A 4A9KA 3K2JA 4WHWA 5DFCA 4MEQA 5G4RA 5FE1A 5FH7A 5ENFA 2DVRA 5KTXA 4AKNA 4NRBA 2RNYA 3Q2FA 5DYXA 5LUUA 5II1A 4N4GA 4ALGA 4YAXA 5TB6A 5FBXA 4HBXA 5A81A 3O36A 4YYKA 3DAIA 4QSXA 5E0RA 4O7CA 5TCMA 4YC9A 4Z1QA 5LKXA 5C8GA 2I8NA 4TS8A 5CQ4A 5F25A 5CQTA 2YDWA 4O72A 5H1UA 4O70A 5ENIA 5II2A 1JM4B 4YYNA 1X0JA 3LQJA 5KU3A 4NQMA 3UW9A 3U5PA 5F60A 5FDZA 4BW1A 3G0JA 3LQIA 5CPEA 4IR3A 4WIVA 2WP1A 2R0SA 5CQ7A 3I3JA 2YYNA 5CQAA 5CS8A 4PKLA 3S91A 5A85A 4IR6A 5EWWA 3HMEA 4J1PA 4YK0A 5DLZA 5E73A 3UV2A 4MEPA 5D7XA 5E9YA 2G4AA 4XUAA 4A9HA 4CLBA 4YYHA 4BW4A 5I1QA 4PS5A 5JI8A 4J0RA 5L96A 5DYUA 4QEWA 5EPRA 3S92A 4UIUA 5E9IA 4TQNA 4O77A 5D24A 4YY6A 4LYSA 3SVHA 5E9KA 5F63A 3P1EA 4LYWA 5FB0A 5CY9A 5HQ6A 5ETDA 5EVAA 5HRWA 4XY9A 2DVQA 5HCLA 4O7BA 4UYHA 4GPJA 4ZQLA 3UVWA 5IIDA 4NXJA 5LKZA 1F68A 4LR6A 3FKMX 5H1TA 5KTUA 4O78A 5FE9A 4YYDA 5CFWA 4CL9A 4TTEA 4NUDA 5DLXA 3RCWA 5EA1A 4BW3A 4QYLA 3UV5A 4CUPA 4MR4A 4NR5A 5C85A 5EGUA 1JSPB 4XY8A 5L97A 5DW1A 4QR3A 4A9LA 5A5OA 5HRVA 3IU6A 5DX4A 5E7DA 2RNWA 2YEMA 4MR6A 1ZS5A 5E9LA 3ZYUA 4QR4A 4QSWA 4UIXA 2MJVB 2YQDA 4NUEA 5FFVA 4LYIA 3MB3A 4XYAA 4HXOA 5FE7A 3SVFA 5I29A 4HXPA 2KTBB 4HBWA 4YH3A 5HENA 5H1VA 5A7CA 5EI4A 5I88A 4IR4A 5F1LA 5DYCA 5CQ3A 4C67A 5HLSA 5HRXA 5IBNA 4XUBA 4TYLA 5CQ8A 5D25A 5AMEA 3P1CA 3QZTA 4HXRA 4QNSA 2L85A 3O37A 4QEUA 5DY7A 3MULA 4QSQA 5BT5A 2WP2A 5ENBA 4CFKA 3JVKA 5E9MA 4TT4A 5CUBA 4A9EA 3QZVA 4FLPA 5DYAA 2RI7A 4CURA 5CRMA 5L8UA 5CUDA 5EWCA 3U5MA 4LC2A 4O7AA 5EPSA 4PTBA 3NXBA 5CU8A 2E7NA 5I40A 5I83A 4TZ8A 4HXLA 4N3WA 4Z6HA 4Z6IA 4ZC9A 4TU4A 5C7NA 5LKUA 1WUMA 3LQHA 2LSPB 3P5OA 5CRZA 5DKCA 5FE6A 5L8TA 4QB3A 5D3HA 4LZ2A 4NYVA 5HFQA 4YBMA 5ENJA 3JVMA 4IOOA 4PY6A 3U5NA 4MR3A 4QEVA 5HJCA 4UYDA 3O35A 2DATA 2FSAA 5EICA 2GRCA 5F2PA 3U5JA 4NYXA 2E7OA 4J0SA 4UIYA 5EPBA 2R0YA 4NQNA 4QSVA 3UVYA 4QUTA 5LKTA 5EWVA 4A9MA 4BJXA 3P1DA 5F62A 4QC3A 5BT4A 5HQ5A 2YEKA 4PCEA 2YELA 5F36A 4MENA 3UV4A 4YBSA 4NR8A 4O76A 5I89A 5HEMA 5L99A 2F6NA 2DKWA 3Q2EA 5L98A 3GG3A 4HBYA 4O7EA 5FE2A 5JWMA 3U5KA 3JVLA 2R10A 5EP7A 5A82A 2L84A 5FH8A 3ONIA 2DVVA 1E6IA 4HXNA 5FG6A 3SVGA 3U5LA 4NRAA 4YY4A 5H85A 5ETBA 4KCXA 4UYGA 5F61A 4OGIA 4YYMA 4QSPA 4NRCA 5CP5A 4NR6A 4O71A 4NUCA 4YYGA 2L5EA 5CQ6A 2YW5A 5F5ZA 5FE0A 4QUUA 4LDFA 4YBTA 4HXKA 2R0VA 4KV4A 4UIZA 3QZSA 5E3DA 4O7FA 2H60A 4UIVA 4Z1SA 5IG6A 2NXBA 5CTLA 4A9NA 5LVQA 5ENHA 5A5PA 5DFDA 4UYFB 3U5OA 4N4FA 4J3IA 5IGLA 5I7YA 4NR9A 5KHMA 4IOQA 5D26A 4QSUA 4CUTA 5D3LA 5EV9A 4OGJA 2OUOA 5K29A 5IGMA 5CQ5A 5HFRA 4A9FA 4YYIA 4YABA 3UVXA 2OO1A 4MEOA 5BT3A 4NYWA 1WUGA 5E9VA 5COIA 4TT6A 5HELA 5ENGA 3JVJA 4O75A 1EQFA 4YATA 4ALHA 4HXSA 5CUGA 5EQ1A 4YH4A 5EU1A 4QSRA 2E3KA 5LJ0A 4TZ2A 3HMFA 4QR5A 5ENEA 5FFYA 5FH6A 5C89A 5FE5A 5KO4A 5IGKA 4NS5A 4N4HA 5G4SA 4PCIA 3AADA 5FG4A 4N4IA 5FE3A 5FB1A 3P1FA 5D3SA 5D0CA 5C87A 5AD2A 4C66A 4QC1A 5E3GA 5CUEA 5E74A 5J0DA 5D3JA 4BW2A 2D9EA 4YADA 4KV1A 4IORA 2F6JA 5A83A 4TU6A 5FFWA 4OUFA 4NR4A 4UYEA 4HXMA 2D82A 5D3TA 3MXFA 4QYDA 4UITA 3LXJA 5AMFA 2RNXA 4BHWA 5A5RA 4A9IA 5I7XA 4F3IA 5D3PA 5EK9A 5LJ2A 2N9GA 5DW2A 5IGNA 5CGPA 5CZGA 4CUUA 4IR5A 3MB4A 4Z93A 3MQMA 4ZW1A 5A5QA 5FE8A 5DKHA 5EWHA 4NR7A 2RS9B 5AD3A 5F1HA 4RVRA 4UIWA 4CUSA 4UYFA 4A9OA 4Y03A 4E96A 4HBVA 4CUQA 5C4QA 5LVRA 5FG5A 2DWWA 3TLPA 2OSSA 5I86A 2DVSA 3O33A 4Q0NA 4QSSA 4LRGA 4DONA 5DKDA 2I7KA 5A5NA 4LZSA 5I80A 3DWYA 5HM0A 5DBMA 5CUAA 3MUKA 1N72A 4MR5A
chains in the Genus database with same CATH superfamily
4QZSA 5D3NA 3AQAA 5F3AA 4QBMA 3ERRA 3O34A 3LJWA 3UVDA 2RO1A 4QSTA 4QY4A 4X2IA 4LZRA 5HQ7A 2RFJA 4CFLA 4YYJA 5A5SA 5ENCA 3G0LA 5ACYA 5EISA 3D7CA 4O74A 5D3RA 5KTWA 5FE4A 4A9JA 5DFBA 4Q0OA 4TT2A 5EM3A 5EWDA 5CUCA 4WHUA 5LJ1A 3HMHA 3IU5A 4A9KA 3K2JA 4WHWA 5DFCA 4MEQA 5G4RA 5FE1A 5FH7A 5ENFA 2DVRA 5KTXA 4AKNA 4NRBA 2RNYA 3Q2FA 5DYXA 5LUUA 5II1A 4N4GA 4ALGA 4YAXA 5TB6A 5FBXA 4HBXA 5A81A 3O36A 4YYKA 3DAIA 4QSXA 5E0RA 4O7CA 5TCMA 4YC9A 4Z1QA 5LKXA 5C8GA 2I8NA 4TS8A 5CQ4A 5F25A 5CQTA 2YDWA 4O72A 5H1UA 4O70A 5ENIA 5II2A 1JM4B 4YYNA 1X0JA 3LQJA 5KU3A 4NQMA 3UW9A 3U5PA 5F60A 5FDZA 4BW1A 3G0JA 3LQIA 5CPEA 4IR3A 4WIVA 2WP1A 2R0SA 5CQ7A 3I3JA 2YYNA 5CQAA 5CS8A 4PKLA 3S91A 5A85A 4IR6A 5EWWA 4AKIA 3HMEA 4J1PA 4YK0A 5DLZA 5E73A 3UV2A 4MEPA 5D7XA 5E9YA 2G4AA 4XUAA 4A9HA 4CLBA 4YYHA 4BW4A 5I1QA 4PS5A 5JI8A 4J0RA 5L96A 5DYUA 4QEWA 5EPRA 3S92A 4UIUA 5E9IA 4TQNA 4O77A 5D24A 4YY6A 4LYSA 3SVHA 5E9KA 5F63A 3P1EA 4LYWA 5FB0A 5CY9A 5HQ6A 5ETDA 5EVAA 5HRWA 4XY9A 2DVQA 5HCLA 4O7BA 4UYHA 4GPJA 4ZQLA 3UVWA 5IIDA 4NXJA 5LKZA 1F68A 4LR6A 3FKMX 5H1TA 5KTUA 4O78A 5FE9A 4YYDA 5CFWA 4CL9A 4TTEA 4NUDA 5DLXA 3RCWA 5EA1A 4BW3A 4QYLA 3UV5A 4CUPA 4MR4A 4NR5A 5C85A 5EGUA 1JSPB 4XY8A 5L97A 5DW1A 4QR3A 4A9LA 5A5OA 5HRVA 3IU6A 5DX4A 5E7DA 2RNWA 2YEMA 4MR6A 1ZS5A 5E9LA 3ZYUA 4QR4A 4QSWA 4UIXA 2MJVB 2YQDA 4NUEA 5FFVA 4LYIA 3MB3A 4XYAA 4HXOA 5FE7A 3SVFA 5I29A 4AKGA 4HXPA 2KTBB 4HBWA 4YH3A 5HENA 5H1VA 5A7CA 5EI4A 5I88A 4IR4A 5F1LA 5DYCA 5CQ3A 4C67A 5HLSA 5HRXA 5IBNA 4XUBA 4AI6A 4TYLA 5CQ8A 5D25A 5AMEA 3P1CA 3QZTA 4HXRA 4QNSA 2L85A 3O37A 4QEUA 5DY7A 3MULA 4QSQA 5BT5A 2WP2A 5ENBA 4CFKA 3JVKA 5E9MA 4TT4A 5CUBA 4A9EA 3QZVA 4FLPA 5DYAA 2RI7A 4CURA 5CRMA 5L8UA 5CUDA 5EWCA 3U5MA 4LC2A 4O7AA 5EPSA 4PTBA 3NXBA 5CU8A 2E7NA 5I40A 5I83A 4TZ8A 4HXLA 4N3WA 4Z6HA 4Z6IA 4ZC9A 4TU4A 5C7NA 5LKUA 1WUMA 3LQHA 2LSPB 3P5OA 5CRZA 5DKCA 5FE6A 5L8TA 4QB3A 5D3HA 4LZ2A 4NYVA 5HFQA 4YBMA 5ENJA 3D1BA 3JVMA 4IOOA 4PY6A 3U5NA 4MR3A 4QEVA 5HJCA 4UYDA 3O35A 2DATA 2FSAA 5EICA 2GRCA 5F2PA 3U5JA 4NYXA 2E7OA 4J0SA 4UIYA 5EPBA 2R0YA 4NQNA 4QSVA 3UVYA 4QUTA 5LKTA 5EWVA 2EJNA 4A9MA 4BJXA 3P1DA 5F62A 4QC3A 5BT4A 5HQ5A 2YEKA 4PCEA 2YELA 5F36A 4MENA 3UV4A 4YBSA 4NR8A 4O76A 5I89A 5HEMA 5L99A 2F6NA 2DKWA 3Q2EA 5L98A 3GG3A 4HBYA 4O7EA 5FE2A 5JWMA 3U5KA 3JVLA 2R10A 5EP7A 5A82A 2L84A 5FH8A 3VKGA 3ONIA 2DVVA 1E6IA 4HXNA 5FG6A 3SVGA 3U5LA 4NRAA 4YY4A 5H85A 5ETBA 4KCXA 4UYGA 5F61A 4OGIA 4YYMA 4QSPA 4NRCA 5CP5A 4NR6A 4O71A 4NUCA 4YYGA 2L5EA 5CQ6A 2YW5A 5F5ZA 5FE0A 4QUUA 3VKHA 4LDFA 4YBTA 3D1DA 4HXKA 2R0VA 4KV4A 4UIZA 3QZSA 5E3DA 4O7FA 2H60A 4UIVA 4Z1SA 5IG6A 2NXBA 5CTLA 4A9NA 5LVQA 5ENHA 5A5PA 5DFDA 4UYFB 3U5OA 4N4FA 4J3IA 5IGLA 5I7YA 4NR9A 5KHMA 4IOQA 5D26A 4QSUA 1ZKRA 4CUTA 5D3LA 5EV9A 4OGJA 2OUOA 5K29A 5IGMA 5CQ5A 5HFRA 4A9FA 4YYIA 4YABA 3UVXA 2OO1A 4MEOA 5BT3A 4NYWA 1WUGA 5E9VA 5COIA 4TT6A 5HELA 5ENGA 3JVJA 4O75A 1EQFA 4YATA 4ALHA 4HXSA 5CUGA 5EQ1A 4YH4A 5EU1A 4QSRA 4AKHA 2E3KA 5LJ0A 4TZ2A 3HMFA 4QR5A 5ENEA 5FFYA 5FH6A 5C89A 5FE5A 5KO4A 5IGKA 4NS5A 4N4HA 5G4SA 4PCIA 3AADA 5FG4A 4N4IA 5FE3A 5FB1A 3P1FA 5D3SA 5D0CA 5C87A 5AD2A 4C66A 4QC1A 5E3GA 1PUOA 5CUEA 5E74A 5J0DA 5D3JA 4BW2A 2D9EA 4YADA 4KV1A 4IORA 2F6JA 5A83A 4TU6A 5FFWA 4OUFA 4NR4A 4UYEA 4HXMA 2D82A 5D3TA 3MXFA 4QYDA 4UITA 3LXJA 5AMFA 2RNXA 4BHWA 5A5RA 4A9IA 5I7XA 4F3IA 5D3PA 5EK9A 5LJ2A 2N9GA 5DW2A 5IGNA 5CGPA 5CZGA 4CUUA 4IR5A 3MB4A 4Z93A 3MQMA 4ZW1A 5A5QA 5FE8A 5DKHA 5EWHA 4NR7A 2RS9B 5AD3A 5F1HA 4RVRA 4UIWA 4CUSA 4UYFA 4A9OA 4Y03A 4E96A 4HBVA 4CUQA 5C4QA 5LVRA 5FG5A 2DWWA 3TLPA 2OSSA 5I86A 2DVSA 3O33A 4Q0NA 4QSSA 4LRGA 4DONA 5DKDA 2I7KA 5A5NA 4LZSA 5I80A 3DWYA 5HM0A 5DBMA 5CUAA 3MUKA 1N72A 4MR5A
chains in the Genus database with same CATH topology
4QZSA 5D3NA 3AQAA 5F3AA 4QBMA 3O34A 3LJWA 3UVDA 2RO1A 4QSTA 4QY4A 4X2IA 4LZRA 5HQ7A 2RFJA 4CFLA 4YYJA 5A5SA 5ENCA 3G0LA 5ACYA 5EISA 3D7CA 4O74A 5D3RA 5KTWA 5FE4A 4A9JA 5DFBA 4Q0OA 4TT2A 5EM3A 5EWDA 5CUCA 4WHUA 5LJ1A 3HMHA 3IU5A 4A9KA 3K2JA 4WHWA 5DFCA 4MEQA 5G4RA 5FE1A 5FH7A 5ENFA 2DVRA 5KTXA 4AKNA 4NRBA 2RNYA 3Q2FA 5DYXA 5LUUA 5II1A 4N4GA 4ALGA 4YAXA 5TB6A 5FBXA 4HBXA 5A81A 3O36A 4YYKA 3DAIA 4QSXA 5E0RA 4O7CA 5TCMA 4YC9A 4Z1QA 5LKXA 5C8GA 2I8NA 4TS8A 5CQ4A 5F25A 5CQTA 2YDWA 4O72A 5H1UA 4O70A 5ENIA 5II2A 1JM4B 4YYNA 1X0JA 3LQJA 5KU3A 4NQMA 3UW9A 3U5PA 5F60A 5FDZA 4BW1A 3G0JA 3LQIA 5CPEA 4IR3A 4WIVA 2WP1A 2R0SA 5CQ7A 3I3JA 2YYNA 5CQAA 5CS8A 4PKLA 3S91A 5A85A 4IR6A 5EWWA 3HMEA 4J1PA 4YK0A 5DLZA 5E73A 3UV2A 4MEPA 5D7XA 5E9YA 2G4AA 4XUAA 4A9HA 4CLBA 4YYHA 4BW4A 5I1QA 4PS5A 5JI8A 4J0RA 5L96A 5DYUA 4QEWA 5EPRA 3S92A 4UIUA 5E9IA 4TQNA 4O77A 5D24A 4YY6A 4LYSA 3SVHA 5E9KA 5F63A 3P1EA 4LYWA 5FB0A 5CY9A 5HQ6A 5ETDA 5EVAA 5HRWA 4XY9A 2DVQA 5HCLA 4O7BA 4UYHA 4GPJA 4ZQLA 3UVWA 5IIDA 4NXJA 5LKZA 1F68A 4LR6A 3FKMX 5H1TA 5KTUA 4O78A 5FE9A 4YYDA 5CFWA 4CL9A 4TTEA 4NUDA 5DLXA 3RCWA 5EA1A 4BW3A 4QYLA 3UV5A 4CUPA 4MR4A 4NR5A 5C85A 5EGUA 1JSPB 4XY8A 5L97A 5DW1A 4QR3A 4A9LA 5A5OA 5HRVA 3IU6A 5DX4A 5E7DA 2RNWA 2YEMA 4MR6A 1ZS5A 5E9LA 3ZYUA 4QR4A 4QSWA 4UIXA 2MJVB 2YQDA 4NUEA 5FFVA 4LYIA 3MB3A 4XYAA 4HXOA 5FE7A 3SVFA 5I29A 4HXPA 2KTBB 4HBWA 4YH3A 5HENA 5H1VA 5A7CA 5EI4A 5I88A 4IR4A 5F1LA 5DYCA 5CQ3A 4C67A 5HLSA 5HRXA 5IBNA 4XUBA 4TYLA 5CQ8A 5D25A 5AMEA 3P1CA 3QZTA 4HXRA 4QNSA 2L85A 3O37A 4QEUA 5DY7A 3MULA 4QSQA 5BT5A 2WP2A 5ENBA 4CFKA 3JVKA 5E9MA 4TT4A 5CUBA 4A9EA 3QZVA 4FLPA 5DYAA 2RI7A 4CURA 5CRMA 5L8UA 5CUDA 5EWCA 3U5MA 4LC2A 4O7AA 5EPSA 4PTBA 3NXBA 5CU8A 2E7NA 5I40A 5I83A 4TZ8A 4HXLA 4N3WA 4Z6HA 4Z6IA 4ZC9A 4TU4A 5C7NA 5LKUA 1WUMA 3LQHA 2LSPB 3P5OA 5CRZA 5DKCA 5FE6A 5L8TA 4QB3A 5D3HA 4LZ2A 4NYVA 5HFQA 4YBMA 5ENJA 3JVMA 4IOOA 4PY6A 3U5NA 4MR3A 4QEVA 5HJCA 4UYDA 3O35A 2DATA 2FSAA 5EICA 2GRCA 5F2PA 3U5JA 4NYXA 2E7OA 4J0SA 4UIYA 5EPBA 2R0YA 4NQNA 4QSVA 3UVYA 4QUTA 5LKTA 5EWVA 4A9MA 4BJXA 3P1DA 5F62A 4QC3A 5BT4A 5HQ5A 2YEKA 4PCEA 2YELA 5F36A 4MENA 3UV4A 4YBSA 4NR8A 4O76A 5I89A 5HEMA 5L99A 2F6NA 2DKWA 3Q2EA 5L98A 3GG3A 4HBYA 4O7EA 5FE2A 5JWMA 3U5KA 3JVLA 2R10A 5EP7A 5A82A 2L84A 5FH8A 3ONIA 2DVVA 1E6IA 4HXNA 5FG6A 3SVGA 3U5LA 4NRAA 4YY4A 5H85A 5ETBA 4KCXA 4UYGA 5F61A 4OGIA 4YYMA 4QSPA 4NRCA 5CP5A 4NR6A 4O71A 4NUCA 4YYGA 2L5EA 5CQ6A 2YW5A 5F5ZA 5FE0A 4QUUA 4LDFA 4YBTA 4HXKA 2R0VA 4KV4A 4UIZA 3QZSA 5E3DA 4O7FA 2H60A 4UIVA 4Z1SA 5IG6A 2NXBA 5CTLA 4A9NA 5LVQA 5ENHA 5A5PA 5DFDA 4UYFB 3U5OA 4N4FA 4J3IA 5IGLA 5I7YA 4NR9A 5KHMA 4IOQA 5D26A 4QSUA 4CUTA 5D3LA 5EV9A 4OGJA 2OUOA 5K29A 5IGMA 5CQ5A 5HFRA 4A9FA 4YYIA 4YABA 3UVXA 2OO1A 4MEOA 5BT3A 4NYWA 1WUGA 5E9VA 5COIA 4TT6A 5HELA 5ENGA 3JVJA 4O75A 1EQFA 4YATA 4ALHA 4HXSA 5CUGA 5EQ1A 4YH4A 5EU1A 4QSRA 2E3KA 5LJ0A 4TZ2A 3HMFA 4QR5A 5ENEA 5FFYA 5FH6A 5C89A 5FE5A 5KO4A 5IGKA 4NS5A 4N4HA 5G4SA 4PCIA 3AADA 5FG4A 4N4IA 5FE3A 5FB1A 3P1FA 5D3SA 5D0CA 5C87A 5AD2A 4C66A 4QC1A 5E3GA 5CUEA 5E74A 5J0DA 5D3JA 4BW2A 2D9EA 4YADA 4KV1A 4IORA 2F6JA 5A83A 4TU6A 5FFWA 4OUFA 4NR4A 4UYEA 4HXMA 2D82A 5D3TA 3MXFA 4QYDA 4UITA 3LXJA 5AMFA 2RNXA 4BHWA 5A5RA 4A9IA 5I7XA 4F3IA 5D3PA 5EK9A 5LJ2A 2N9GA 5DW2A 5IGNA 5CGPA 5CZGA 4CUUA 4IR5A 3MB4A 4Z93A 3MQMA 4ZW1A 5A5QA 5FE8A 5DKHA 5EWHA 4NR7A 2RS9B 5AD3A 5F1HA 4RVRA 4UIWA 4CUSA 4UYFA 4A9OA 4Y03A 4E96A 4HBVA 4CUQA 5C4QA 5LVRA 5FG5A 2DWWA 3TLPA 2OSSA 5I86A 2DVSA 3O33A 4Q0NA 4QSSA 4LRGA 4DONA 5DKDA 2I7KA 5A5NA 4LZSA 5I80A 3DWYA 5HM0A 5DBMA 5CUAA 3MUKA 1N72A 4MR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QZS A;  5D3N A;  3AQA A;  5F3A A;  4QBM A;  3O34 A;  3LJW A;  3UVD A;  2RO1 A;  4QST A;  4QY4 A;  4X2I A;  4LZR A;  5HQ7 A;  2RFJ A;  4CFL A;  4YYJ A;  5A5S A;  5ENC A;  3G0L A;  5ACY A;  5EIS A;  3D7C A;  4O74 A;  5D3R A;  5KTW A;  5FE4 A;  4A9J A;  5DFB A;  4Q0O A;  4TT2 A;  5EM3 A;  5EWD A;  5CUC A;  4WHU A;  5LJ1 A;  3HMH A;  3IU5 A;  4A9K A;  3K2J A;  4WHW A;  5DFC A;  4MEQ A;  5G4R A;  5FE1 A;  5FH7 A;  5ENF A;  2DVR A;  5KTX A;  4AKN A;  4NRB A;  2RNY A;  3Q2F A;  5DYX A;  5LUU A;  5II1 A;  4N4G A;  4ALG A;  4YAX A;  5TB6 A;  5FBX A;  4HBX A;  5A81 A;  3O36 A;  4YYK A;  3DAI A;  4QSX A;  5E0R A;  4O7C A;  5TCM A;  4YC9 A;  4Z1Q A;  5LKX A;  5C8G A;  2I8N A;  4TS8 A;  5CQ4 A;  5F25 A;  5CQT A;  2YDW A;  4O72 A;  5H1U A;  4O70 A;  5ENI A;  5II2 A;  1JM4 B;  4YYN A;  1X0J A;  3LQJ A;  5KU3 A;  4NQM A;  3UW9 A;  3U5P A;  5F60 A;  5FDZ A;  4BW1 A;  3G0J A;  3LQI A;  5CPE A;  4IR3 A;  4WIV A;  2WP1 A;  2R0S A;  5CQ7 A;  3I3J A;  2YYN A;  5CQA A;  5CS8 A;  4PKL A;  3S91 A;  5A85 A;  4IR6 A;  5EWW A;  3HME A;  4J1P A;  4YK0 A;  5DLZ A;  5E73 A;  3UV2 A;  4MEP A;  5D7X A;  5E9Y A;  2G4A A;  4XUA A;  4A9H A;  4CLB A;  4YYH A;  4BW4 A;  5I1Q A;  4PS5 A;  5JI8 A;  4J0R A;  5L96 A;  5DYU A;  4QEW A;  5EPR A;  3S92 A;  4UIU A;  5E9I A;  4TQN A;  4O77 A;  5D24 A;  4YY6 A;  4LYS A;  3SVH A;  5E9K A;  5F63 A;  3P1E A;  4LYW A;  5FB0 A;  5CY9 A;  5HQ6 A;  5ETD A;  5EVA A;  5HRW A;  4XY9 A;  2DVQ A;  5HCL A;  4O7B A;  4UYH A;  4GPJ A;  4ZQL A;  3UVW A;  5IID A;  4NXJ A;  5LKZ A;  1F68 A;  4LR6 A;  3FKM X;  5H1T A;  5KTU A;  4O78 A;  5FE9 A;  4YYD A;  5CFW A;  4CL9 A;  4TTE A;  4NUD A;  5DLX A;  3RCW A;  5EA1 A;  4BW3 A;  4QYL A;  3UV5 A;  4CUP A;  4MR4 A;  4NR5 A;  5C85 A;  5EGU A;  1JSP B;  4XY8 A;  5L97 A;  5DW1 A;  4QR3 A;  4A9L A;  5A5O A;  5HRV A;  3IU6 A;  5DX4 A;  5E7D A;  2RNW A;  2YEM A;  4MR6 A;  1ZS5 A;  5E9L A;  3ZYU A;  4QR4 A;  4QSW A;  4UIX A;  2MJV B;  2YQD A;  4NUE A;  5FFV A;  4LYI A;  3MB3 A;  4XYA A;  4HXO A;  5FE7 A;  3SVF A;  5I29 A;  4HXP A;  2KTB B;  4HBW A;  4YH3 A;  5HEN A;  5H1V A;  5A7C A;  5EI4 A;  5I88 A;  4IR4 A;  5F1L A;  5DYC A;  5CQ3 A;  4C67 A;  5HLS A;  5HRX A;  5IBN A;  4XUB A;  4TYL A;  5CQ8 A;  5D25 A;  5AME A;  3P1C A;  3QZT A;  4HXR A;  4QNS A;  2L85 A;  3O37 A;  4QEU A;  5DY7 A;  3MUL A;  4QSQ A;  5BT5 A;  2WP2 A;  5ENB A;  4CFK A;  3JVK A;  5E9M A;  4TT4 A;  5CUB A;  4A9E A;  3QZV A;  4FLP A;  5DYA A;  2RI7 A;  4CUR A;  5CRM A;  5L8U A;  5CUD A;  5EWC A;  3U5M A;  4LC2 A;  4O7A A;  5EPS A;  4PTB A;  3NXB A;  5CU8 A;  2E7N A;  5I40 A;  5I83 A;  4TZ8 A;  4HXL A;  4N3W A;  4Z6H A;  4Z6I A;  4ZC9 A;  4TU4 A;  5C7N A;  5LKU A;  1WUM A;  3LQH A;  2LSP B;  3P5O A;  5CRZ A;  5DKC A;  5FE6 A;  5L8T A;  4QB3 A;  5D3H A;  4LZ2 A;  4NYV A;  5HFQ A;  4YBM A;  5ENJ A;  3JVM A;  4IOO A;  4PY6 A;  3U5N A;  4MR3 A;  4QEV A;  5HJC A;  4UYD A;  3O35 A;  2DAT A;  2FSA A;  5EIC A;  2GRC A;  5F2P A;  3U5J A;  4NYX A;  2E7O A;  4J0S A;  4UIY A;  5EPB A;  2R0Y A;  4NQN A;  4QSV A;  3UVY A;  4QUT A;  5LKT A;  5EWV A;  4A9M A;  4BJX A;  3P1D A;  5F62 A;  4QC3 A;  5BT4 A;  5HQ5 A;  2YEK A;  4PCE A;  2YEL A;  5F36 A;  4MEN A;  3UV4 A;  4YBS A;  4NR8 A;  4O76 A;  5I89 A;  5HEM A;  5L99 A;  2F6N A;  2DKW A;  3Q2E A;  5L98 A;  3GG3 A;  4HBY A;  4O7E A;  5FE2 A;  5JWM A;  3U5K A;  3JVL A;  2R10 A;  5EP7 A;  5A82 A;  2L84 A;  5FH8 A;  3ONI A;  2DVV A;  1E6I A;  4HXN A;  5FG6 A;  3SVG A;  3U5L A;  4NRA A;  4YY4 A;  5H85 A;  5ETB A;  4KCX A;  4UYG A;  5F61 A;  4OGI A;  4YYM A;  4QSP A;  4NRC A;  5CP5 A;  4NR6 A;  4O71 A;  4NUC A;  4YYG A;  2L5E A;  5CQ6 A;  2YW5 A;  5F5Z A;  5FE0 A;  4QUU A;  4LDF A;  4YBT A;  4HXK A;  2R0V A;  4KV4 A;  4UIZ A;  3QZS A;  5E3D A;  4O7F A;  2H60 A;  4UIV A;  4Z1S A;  5IG6 A;  2NXB A;  5CTL A;  4A9N A;  5LVQ A;  5ENH A;  5A5P A;  5DFD A;  4UYF B;  3U5O A;  4N4F A;  4J3I A;  5IGL A;  5I7Y A;  4NR9 A;  5KHM A;  4IOQ A;  5D26 A;  4QSU A;  4CUT A;  5D3L A;  5EV9 A;  4OGJ A;  2OUO A;  5K29 A;  5IGM A;  5CQ5 A;  5HFR A;  4A9F A;  4YYI A;  4YAB A;  3UVX A;  2OO1 A;  4MEO A;  5BT3 A;  4NYW A;  1WUG A;  5E9V A;  5COI A;  4TT6 A;  5HEL A;  5ENG A;  3JVJ A;  4O75 A;  1EQF A;  4YAT A;  4ALH A;  4HXS A;  5CUG A;  5EQ1 A;  4YH4 A;  5EU1 A;  4QSR A;  2E3K A;  5LJ0 A;  4TZ2 A;  3HMF A;  4QR5 A;  5ENE A;  5FFY A;  5FH6 A;  5C89 A;  5FE5 A;  5KO4 A;  5IGK A;  4NS5 A;  4N4H A;  5G4S A;  4PCI A;  3AAD A;  5FG4 A;  4N4I A;  5FE3 A;  5FB1 A;  3P1F A;  5D3S A;  5D0C A;  5C87 A;  5AD2 A;  4C66 A;  4QC1 A;  5E3G A;  5CUE A;  5E74 A;  5J0D A;  5D3J A;  4BW2 A;  2D9E A;  4YAD A;  4KV1 A;  4IOR A;  2F6J A;  5A83 A;  4TU6 A;  5FFW A;  4OUF A;  4NR4 A;  4UYE A;  4HXM A;  2D82 A;  5D3T A;  3MXF A;  4QYD A;  4UIT A;  3LXJ A;  5AMF A;  2RNX A;  4BHW A;  5A5R A;  4A9I A;  5I7X A;  4F3I A;  5D3P A;  5EK9 A;  5LJ2 A;  2N9G A;  5DW2 A;  5IGN A;  5CGP A;  5CZG A;  4CUU A;  4IR5 A;  3MB4 A;  4Z93 A;  3MQM A;  4ZW1 A;  5A5Q A;  5FE8 A;  5DKH A;  5EWH A;  4NR7 A;  2RS9 B;  5AD3 A;  5F1H A;  4RVR A;  4UIW A;  4CUS A;  4UYF A;  4A9O A;  4Y03 A;  4E96 A;  4HBV A;  4CUQ A;  5C4Q A;  5LVR A;  5FG5 A;  2DWW A;  3TLP A;  2OSS A;  5I86 A;  2DVS A;  3O33 A;  4Q0N A;  4QSS A;  4LRG A;  4DON A;  5DKD A;  2I7K A;  5A5N A;  4LZS A;  5I80 A;  3DWY A;  5HM0 A;  5DBM A;  5CUA A;  3MUK A;  1N72 A;  4MR5 A; 
#chains in the Genus database with same CATH topology
 4QZS A;  5D3N A;  3AQA A;  5F3A A;  4QBM A;  3ERR A;  3O34 A;  3LJW A;  3UVD A;  2RO1 A;  4QST A;  4QY4 A;  4X2I A;  4LZR A;  5HQ7 A;  2RFJ A;  4CFL A;  4YYJ A;  5A5S A;  5ENC A;  3G0L A;  5ACY A;  5EIS A;  3D7C A;  4O74 A;  5D3R A;  5KTW A;  5FE4 A;  4A9J A;  5DFB A;  4Q0O A;  4TT2 A;  5EM3 A;  5EWD A;  5CUC A;  4WHU A;  5LJ1 A;  3HMH A;  3IU5 A;  4A9K A;  3K2J A;  4WHW A;  5DFC A;  4MEQ A;  5G4R A;  5FE1 A;  5FH7 A;  5ENF A;  2DVR A;  5KTX A;  4AKN A;  4NRB A;  2RNY A;  3Q2F A;  5DYX A;  5LUU A;  5II1 A;  4N4G A;  4ALG A;  4YAX A;  5TB6 A;  5FBX A;  4HBX A;  5A81 A;  3O36 A;  4YYK A;  3DAI A;  4QSX A;  5E0R A;  4O7C A;  5TCM A;  4YC9 A;  4Z1Q A;  5LKX A;  5C8G A;  2I8N A;  4TS8 A;  5CQ4 A;  5F25 A;  5CQT A;  2YDW A;  4O72 A;  5H1U A;  4O70 A;  5ENI A;  5II2 A;  1JM4 B;  4YYN A;  1X0J A;  3LQJ A;  5KU3 A;  4NQM A;  3UW9 A;  3U5P A;  5F60 A;  5FDZ A;  4BW1 A;  3G0J A;  3LQI A;  5CPE A;  4IR3 A;  4WIV A;  2WP1 A;  2R0S A;  5CQ7 A;  3I3J A;  2YYN A;  5CQA A;  5CS8 A;  4PKL A;  3S91 A;  5A85 A;  4IR6 A;  5EWW A;  4AKI A;  3HME A;  4J1P A;  4YK0 A;  5DLZ A;  5E73 A;  3UV2 A;  4MEP A;  5D7X A;  5E9Y A;  2G4A A;  4XUA A;  4A9H A;  4CLB A;  4YYH A;  4BW4 A;  5I1Q A;  4PS5 A;  5JI8 A;  4J0R A;  5L96 A;  5DYU A;  4QEW A;  5EPR A;  3S92 A;  4UIU A;  5E9I A;  4TQN A;  4O77 A;  5D24 A;  4YY6 A;  4LYS A;  3SVH A;  5E9K A;  5F63 A;  3P1E A;  4LYW A;  5FB0 A;  5CY9 A;  5HQ6 A;  5ETD A;  5EVA A;  5HRW A;  4XY9 A;  2DVQ A;  5HCL A;  4O7B A;  4UYH A;  4GPJ A;  4ZQL A;  3UVW A;  5IID A;  4NXJ A;  5LKZ A;  1F68 A;  4LR6 A;  3FKM X;  5H1T A;  5KTU A;  4O78 A;  5FE9 A;  4YYD A;  5CFW A;  4CL9 A;  4TTE A;  4NUD A;  5DLX A;  3RCW A;  5EA1 A;  4BW3 A;  4QYL A;  3UV5 A;  4CUP A;  4MR4 A;  4NR5 A;  5C85 A;  5EGU A;  1JSP B;  4XY8 A;  5L97 A;  5DW1 A;  4QR3 A;  4A9L A;  5A5O A;  5HRV A;  3IU6 A;  5DX4 A;  5E7D A;  2RNW A;  2YEM A;  4MR6 A;  1ZS5 A;  5E9L A;  3ZYU A;  4QR4 A;  4QSW A;  4UIX A;  2MJV B;  2YQD A;  4NUE A;  5FFV A;  4LYI A;  3MB3 A;  4XYA A;  4HXO A;  5FE7 A;  3SVF A;  5I29 A;  4AKG A;  4HXP A;  2KTB B;  4HBW A;  4YH3 A;  5HEN A;  5H1V A;  5A7C A;  5EI4 A;  5I88 A;  4IR4 A;  5F1L A;  5DYC A;  5CQ3 A;  4C67 A;  5HLS A;  5HRX A;  5IBN A;  4XUB A;  4AI6 A;  4TYL A;  5CQ8 A;  5D25 A;  5AME A;  3P1C A;  3QZT A;  4HXR A;  4QNS A;  2L85 A;  3O37 A;  4QEU A;  5DY7 A;  3MUL A;  4QSQ A;  5BT5 A;  2WP2 A;  5ENB A;  4CFK A;  3JVK A;  5E9M A;  4TT4 A;  5CUB A;  4A9E A;  3QZV A;  4FLP A;  5DYA A;  2RI7 A;  4CUR A;  5CRM A;  5L8U A;  5CUD A;  5EWC A;  3U5M A;  4LC2 A;  4O7A A;  5EPS A;  4PTB A;  3NXB A;  5CU8 A;  2E7N A;  5I40 A;  5I83 A;  4TZ8 A;  4HXL A;  4N3W A;  4Z6H A;  4Z6I A;  4ZC9 A;  4TU4 A;  5C7N A;  5LKU A;  1WUM A;  3LQH A;  2LSP B;  3P5O A;  5CRZ A;  5DKC A;  5FE6 A;  5L8T A;  4QB3 A;  5D3H A;  4LZ2 A;  4NYV A;  5HFQ A;  4YBM A;  5ENJ A;  3D1B A;  3JVM A;  4IOO A;  4PY6 A;  3U5N A;  4MR3 A;  4QEV A;  5HJC A;  4UYD A;  3O35 A;  2DAT A;  2FSA A;  5EIC A;  2GRC A;  5F2P A;  3U5J A;  4NYX A;  2E7O A;  4J0S A;  4UIY A;  5EPB A;  2R0Y A;  4NQN A;  4QSV A;  3UVY A;  4QUT A;  5LKT A;  5EWV A;  2EJN A;  4A9M A;  4BJX A;  3P1D A;  5F62 A;  4QC3 A;  5BT4 A;  5HQ5 A;  2YEK A;  4PCE A;  2YEL A;  5F36 A;  4MEN A;  3UV4 A;  4YBS A;  4NR8 A;  4O76 A;  5I89 A;  5HEM A;  5L99 A;  2F6N A;  2DKW A;  3Q2E A;  5L98 A;  3GG3 A;  4HBY A;  4O7E A;  5FE2 A;  5JWM A;  3U5K A;  3JVL A;  2R10 A;  5EP7 A;  5A82 A;  2L84 A;  5FH8 A;  3VKG A;  3ONI A;  2DVV A;  1E6I A;  4HXN A;  5FG6 A;  3SVG A;  3U5L A;  4NRA A;  4YY4 A;  5H85 A;  5ETB A;  4KCX A;  4UYG A;  5F61 A;  4OGI A;  4YYM A;  4QSP A;  4NRC A;  5CP5 A;  4NR6 A;  4O71 A;  4NUC A;  4YYG A;  2L5E A;  5CQ6 A;  2YW5 A;  5F5Z A;  5FE0 A;  4QUU A;  3VKH A;  4LDF A;  4YBT A;  3D1D A;  4HXK A;  2R0V A;  4KV4 A;  4UIZ A;  3QZS A;  5E3D A;  4O7F A;  2H60 A;  4UIV A;  4Z1S A;  5IG6 A;  2NXB A;  5CTL A;  4A9N A;  5LVQ A;  5ENH A;  5A5P A;  5DFD A;  4UYF B;  3U5O A;  4N4F A;  4J3I A;  5IGL A;  5I7Y A;  4NR9 A;  5KHM A;  4IOQ A;  5D26 A;  4QSU A;  1ZKR A;  4CUT A;  5D3L A;  5EV9 A;  4OGJ A;  2OUO A;  5K29 A;  5IGM A;  5CQ5 A;  5HFR A;  4A9F A;  4YYI A;  4YAB A;  3UVX A;  2OO1 A;  4MEO A;  5BT3 A;  4NYW A;  1WUG A;  5E9V A;  5COI A;  4TT6 A;  5HEL A;  5ENG A;  3JVJ A;  4O75 A;  1EQF A;  4YAT A;  4ALH A;  4HXS A;  5CUG A;  5EQ1 A;  4YH4 A;  5EU1 A;  4QSR A;  4AKH A;  2E3K A;  5LJ0 A;  4TZ2 A;  3HMF A;  4QR5 A;  5ENE A;  5FFY A;  5FH6 A;  5C89 A;  5FE5 A;  5KO4 A;  5IGK A;  4NS5 A;  4N4H A;  5G4S A;  4PCI A;  3AAD A;  5FG4 A;  4N4I A;  5FE3 A;  5FB1 A;  3P1F A;  5D3S A;  5D0C A;  5C87 A;  5AD2 A;  4C66 A;  4QC1 A;  5E3G A;  1PUO A;  5CUE A;  5E74 A;  5J0D A;  5D3J A;  4BW2 A;  2D9E A;  4YAD A;  4KV1 A;  4IOR A;  2F6J A;  5A83 A;  4TU6 A;  5FFW A;  4OUF A;  4NR4 A;  4UYE A;  4HXM A;  2D82 A;  5D3T A;  3MXF A;  4QYD A;  4UIT A;  3LXJ A;  5AMF A;  2RNX A;  4BHW A;  5A5R A;  4A9I A;  5I7X A;  4F3I A;  5D3P A;  5EK9 A;  5LJ2 A;  2N9G A;  5DW2 A;  5IGN A;  5CGP A;  5CZG A;  4CUU A;  4IR5 A;  3MB4 A;  4Z93 A;  3MQM A;  4ZW1 A;  5A5Q A;  5FE8 A;  5DKH A;  5EWH A;  4NR7 A;  2RS9 B;  5AD3 A;  5F1H A;  4RVR A;  4UIW A;  4CUS A;  4UYF A;  4A9O A;  4Y03 A;  4E96 A;  4HBV A;  4CUQ A;  5C4Q A;  5LVR A;  5FG5 A;  2DWW A;  3TLP A;  2OSS A;  5I86 A;  2DVS A;  3O33 A;  4Q0N A;  4QSS A;  4LRG A;  4DON A;  5DKD A;  2I7K A;  5A5N A;  4LZS A;  5I80 A;  3DWY A;  5HM0 A;  5DBM A;  5CUA A;  3MUK A;  1N72 A;  4MR5 A; 
#chains in the Genus database with same CATH homology
 4QZS A;  5D3N A;  3AQA A;  5F3A A;  4QBM A;  3O34 A;  3LJW A;  3UVD A;  2RO1 A;  4QST A;  4QY4 A;  4X2I A;  4LZR A;  5HQ7 A;  2RFJ A;  4CFL A;  4YYJ A;  5A5S A;  5ENC A;  3G0L A;  5ACY A;  5EIS A;  3D7C A;  4O74 A;  5D3R A;  5KTW A;  5FE4 A;  4A9J A;  5DFB A;  4Q0O A;  4TT2 A;  5EM3 A;  5EWD A;  5CUC A;  4WHU A;  5LJ1 A;  3HMH A;  3IU5 A;  4A9K A;  3K2J A;  4WHW A;  5DFC A;  4MEQ A;  5G4R A;  5FE1 A;  5FH7 A;  5ENF A;  2DVR A;  5KTX A;  4AKN A;  4NRB A;  2RNY A;  3Q2F A;  5DYX A;  5LUU A;  5II1 A;  4N4G A;  4ALG A;  4YAX A;  5TB6 A;  5FBX A;  4HBX A;  5A81 A;  3O36 A;  4YYK A;  3DAI A;  4QSX A;  5E0R A;  4O7C A;  5TCM A;  4YC9 A;  4Z1Q A;  5LKX A;  5C8G A;  2I8N A;  4TS8 A;  5CQ4 A;  5F25 A;  5CQT A;  2YDW A;  4O72 A;  5H1U A;  4O70 A;  5ENI A;  5II2 A;  1JM4 B;  4YYN A;  1X0J A;  3LQJ A;  5KU3 A;  4NQM A;  3UW9 A;  3U5P A;  5F60 A;  5FDZ A;  4BW1 A;  3G0J A;  3LQI A;  5CPE A;  4IR3 A;  4WIV A;  2WP1 A;  2R0S A;  5CQ7 A;  3I3J A;  2YYN A;  5CQA A;  5CS8 A;  4PKL A;  3S91 A;  5A85 A;  4IR6 A;  5EWW A;  3HME A;  4J1P A;  4YK0 A;  5DLZ A;  5E73 A;  3UV2 A;  4MEP A;  5D7X A;  5E9Y A;  2G4A A;  4XUA A;  4A9H A;  4CLB A;  4YYH A;  4BW4 A;  5I1Q A;  4PS5 A;  5JI8 A;  4J0R A;  5L96 A;  5DYU A;  4QEW A;  5EPR A;  3S92 A;  4UIU A;  5E9I A;  4TQN A;  4O77 A;  5D24 A;  4YY6 A;  4LYS A;  3SVH A;  5E9K A;  5F63 A;  3P1E A;  4LYW A;  5FB0 A;  5CY9 A;  5HQ6 A;  5ETD A;  5EVA A;  5HRW A;  4XY9 A;  2DVQ A;  5HCL A;  4O7B A;  4UYH A;  4GPJ A;  4ZQL A;  3UVW A;  5IID A;  4NXJ A;  5LKZ A;  1F68 A;  4LR6 A;  3FKM X;  5H1T A;  5KTU A;  4O78 A;  5FE9 A;  4YYD A;  5CFW A;  4CL9 A;  4TTE A;  4NUD A;  5DLX A;  3RCW A;  5EA1 A;  4BW3 A;  4QYL A;  3UV5 A;  4CUP A;  4MR4 A;  4NR5 A;  5C85 A;  5EGU A;  1JSP B;  4XY8 A;  5L97 A;  5DW1 A;  4QR3 A;  4A9L A;  5A5O A;  5HRV A;  3IU6 A;  5DX4 A;  5E7D A;  2RNW A;  2YEM A;  4MR6 A;  1ZS5 A;  5E9L A;  3ZYU A;  4QR4 A;  4QSW A;  4UIX A;  2MJV B;  2YQD A;  4NUE A;  5FFV A;  4LYI A;  3MB3 A;  4XYA A;  4HXO A;  5FE7 A;  3SVF A;  5I29 A;  4HXP A;  2KTB B;  4HBW A;  4YH3 A;  5HEN A;  5H1V A;  5A7C A;  5EI4 A;  5I88 A;  4IR4 A;  5F1L A;  5DYC A;  5CQ3 A;  4C67 A;  5HLS A;  5HRX A;  5IBN A;  4XUB A;  4TYL A;  5CQ8 A;  5D25 A;  5AME A;  3P1C A;  3QZT A;  4HXR A;  4QNS A;  2L85 A;  3O37 A;  4QEU A;  5DY7 A;  3MUL A;  4QSQ A;  5BT5 A;  2WP2 A;  5ENB A;  4CFK A;  3JVK A;  5E9M A;  4TT4 A;  5CUB A;  4A9E A;  3QZV A;  4FLP A;  5DYA A;  2RI7 A;  4CUR A;  5CRM A;  5L8U A;  5CUD A;  5EWC A;  3U5M A;  4LC2 A;  4O7A A;  5EPS A;  4PTB A;  3NXB A;  5CU8 A;  2E7N A;  5I40 A;  5I83 A;  4TZ8 A;  4HXL A;  4N3W A;  4Z6H A;  4Z6I A;  4ZC9 A;  4TU4 A;  5C7N A;  5LKU A;  1WUM A;  3LQH A;  2LSP B;  3P5O A;  5CRZ A;  5DKC A;  5FE6 A;  5L8T A;  4QB3 A;  5D3H A;  4LZ2 A;  4NYV A;  5HFQ A;  4YBM A;  5ENJ A;  3JVM A;  4IOO A;  4PY6 A;  3U5N A;  4MR3 A;  4QEV A;  5HJC A;  4UYD A;  3O35 A;  2DAT A;  2FSA A;  5EIC A;  2GRC A;  5F2P A;  3U5J A;  4NYX A;  2E7O A;  4J0S A;  4UIY A;  5EPB A;  2R0Y A;  4NQN A;  4QSV A;  3UVY A;  4QUT A;  5LKT A;  5EWV A;  4A9M A;  4BJX A;  3P1D A;  5F62 A;  4QC3 A;  5BT4 A;  5HQ5 A;  2YEK A;  4PCE A;  2YEL A;  5F36 A;  4MEN A;  3UV4 A;  4YBS A;  4NR8 A;  4O76 A;  5I89 A;  5HEM A;  5L99 A;  2F6N A;  2DKW A;  3Q2E A;  5L98 A;  3GG3 A;  4HBY A;  4O7E A;  5FE2 A;  5JWM A;  3U5K A;  3JVL A;  2R10 A;  5EP7 A;  5A82 A;  2L84 A;  5FH8 A;  3ONI A;  2DVV A;  1E6I A;  4HXN A;  5FG6 A;  3SVG A;  3U5L A;  4NRA A;  4YY4 A;  5H85 A;  5ETB A;  4KCX A;  4UYG A;  5F61 A;  4OGI A;  4YYM A;  4QSP A;  4NRC A;  5CP5 A;  4NR6 A;  4O71 A;  4NUC A;  4YYG A;  2L5E A;  5CQ6 A;  2YW5 A;  5F5Z A;  5FE0 A;  4QUU A;  4LDF A;  4YBT A;  4HXK A;  2R0V A;  4KV4 A;  4UIZ A;  3QZS A;  5E3D A;  4O7F A;  2H60 A;  4UIV A;  4Z1S A;  5IG6 A;  2NXB A;  5CTL A;  4A9N A;  5LVQ A;  5ENH A;  5A5P A;  5DFD A;  4UYF B;  3U5O A;  4N4F A;  4J3I A;  5IGL A;  5I7Y A;  4NR9 A;  5KHM A;  4IOQ A;  5D26 A;  4QSU A;  4CUT A;  5D3L A;  5EV9 A;  4OGJ A;  2OUO A;  5K29 A;  5IGM A;  5CQ5 A;  5HFR A;  4A9F A;  4YYI A;  4YAB A;  3UVX A;  2OO1 A;  4MEO A;  5BT3 A;  4NYW A;  1WUG A;  5E9V A;  5COI A;  4TT6 A;  5HEL A;  5ENG A;  3JVJ A;  4O75 A;  1EQF A;  4YAT A;  4ALH A;  4HXS A;  5CUG A;  5EQ1 A;  4YH4 A;  5EU1 A;  4QSR A;  2E3K A;  5LJ0 A;  4TZ2 A;  3HMF A;  4QR5 A;  5ENE A;  5FFY A;  5FH6 A;  5C89 A;  5FE5 A;  5KO4 A;  5IGK A;  4NS5 A;  4N4H A;  5G4S A;  4PCI A;  3AAD A;  5FG4 A;  4N4I A;  5FE3 A;  5FB1 A;  3P1F A;  5D3S A;  5D0C A;  5C87 A;  5AD2 A;  4C66 A;  4QC1 A;  5E3G A;  5CUE A;  5E74 A;  5J0D A;  5D3J A;  4BW2 A;  2D9E A;  4YAD A;  4KV1 A;  4IOR A;  2F6J A;  5A83 A;  4TU6 A;  5FFW A;  4OUF A;  4NR4 A;  4UYE A;  4HXM A;  2D82 A;  5D3T A;  3MXF A;  4QYD A;  4UIT A;  3LXJ A;  5AMF A;  2RNX A;  4BHW A;  5A5R A;  4A9I A;  5I7X A;  4F3I A;  5D3P A;  5EK9 A;  5LJ2 A;  2N9G A;  5DW2 A;  5IGN A;  5CGP A;  5CZG A;  4CUU A;  4IR5 A;  3MB4 A;  4Z93 A;  3MQM A;  4ZW1 A;  5A5Q A;  5FE8 A;  5DKH A;  5EWH A;  4NR7 A;  2RS9 B;  5AD3 A;  5F1H A;  4RVR A;  4UIW A;  4CUS A;  4UYF A;  4A9O A;  4Y03 A;  4E96 A;  4HBV A;  4CUQ A;  5C4Q A;  5LVR A;  5FG5 A;  2DWW A;  3TLP A;  2OSS A;  5I86 A;  2DVS A;  3O33 A;  4Q0N A;  4QSS A;  4LRG A;  4DON A;  5DKD A;  2I7K A;  5A5N A;  4LZS A;  5I80 A;  3DWY A;  5HM0 A;  5DBM A;  5CUA A;  3MUK A;  1N72 A;  4MR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...