3JVLA

Crystal structure of bromodomain 2 of mouse brd4
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
116
structure length
116
Chain Sequence
GAMGSKISEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Bromodomain-containing protein 4
publication title Structures of the Dual Bromodomains of the P-TEFb-activating Protein Brd4 at Atomic Resolution
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3jvlA00
5EISA 2F6JA 4CUSA 5II1A 4PTBA 4CUUA 5CP5A 4J0RA 5FE5A 2N9GA 5EVAA 5HRWA 5EWDA 2I7KA 4LDFA 4HBWA 2YW5A 5F60A 3U5MA 4QBMA 5E74A 5I83A 4UYDA 4YK0A 5DKCA 4O70A 4QSUA 5FE1A 5L98A 5COIA 4IR3A 4WHUA 5E0RA 4NQMA 2LSPB 5DFBA 5IGMA 3S92A 3U5PA 5FG6A 3K2JA 2R10A 4NRCA 5A5PA 4IOOA 3I3JA 5I1QA 5DYUA 5FE0A 5CQTA 5DLXA 5K29A 4UIXA 3MQMA 4MR4A 4A9OA 4UYGA 3ZYUA 3UV4A 5FE8A 3G0JA 4XY8A 2GRCA 5FH8A 5E9KA 4PS5A 5CTLA 5JI8A 4N3WA 4QSRA 2RNXA 4NR8A 1EQFA 5C7NA 5F5ZA 5D24A 4IORA 3P1DA 4NYXA 2YDWA 4TS8A 5CU8A 3G0LA 4PCIA 5IIDA 5FB0A 5DYXA 4QC3A 5HELA 2KTBB 4BJXA 2D9EA 2DVQA 1F68A 5EA1A 4PCEA 4J3IA 4YYIA 5FDZA 4QC1A 3QZSA 4QB3A 4QR5A 4LZRA 4F3IA 4NYVA 3AADA 5H85A 4YYGA 4QR4A 5E9IA 5AD2A 3U5NA 3MULA 3QZTA 4WIVA 4QSWA 5A85A 3DWYA 4BW4A 4MR5A 2MJVB 5A5NA 5FB1A 5AMFA 5A5SA 5D3HA 5BT4A 4NR9A 4MR3A 4QSVA 2RNWA 3SVGA 5II2A 5CQ4A 2E7OA 4YADA 4TT6A 5CUDA 4UYFA 5EPRA 3O37A 4O71A 4PY6A 5IBNA 5E9VA 5F62A 5I86A 3O34A 4LR6A 4Q0OA 5C87A 5A5OA 5KTXA 4NYWA 5HM0A 5F3AA 1WUGA 5J0DA 5G4RA 4O76A 3MXFA 5CQ5A 4MR6A 4GPJA 4NQNA 5DBMA 4Q0NA 2DWWA 3JVMA 5ETDA 2YEMA 5TB6A 5ENJA 2L84A 4FLPA 5F1LA 4UYHA 5EQ1A 4NR6A 2OSSA 2YELA 5FFYA 4QSXA 4YAXA 4BHWA 4TTEA 4C67A 5DFDA 4QZSA 5E9YA 4YBSA 2OUOA 5FH6A 5A83A 4QSQA 4ZW1A 5HRXA 4HXLA 3O33A 4YYDA 4N4IA 4O75A 4KV1A 4CLBA 2I8NA 5ENIA 4QNSA 4N4GA 5CS8A 4HXMA 4NXJA 4TU4A 2E7NA 5F25A 5CQAA 5FFWA 4IR6A 5FE3A 5E9LA 3LQIA 4YABA 5C8GA 4ALGA 5BT5A 2RFJA 4LZSA 5ETBA 4HXNA 5D3NA 5ACYA 5FH7A 5KTWA 3O35A 5I89A 4YY6A 5CUCA 4NUDA 4NS5A 4A9HA 4YYMA 5AD3A 5CQ7A 2YQDA 5CPEA 5LJ0A 4MENA 5CQ3A 4TZ8A 5EU1A 3LQHA 2L5EA 5I29A 3TLPA 4BW2A 2RNYA 2DVVA 2L85A 5HJCA 5TCMA 3FKMX 4MEOA 5EWVA 5I40A 3QZVA 4QSSA 3O36A 5KHMA 4UYEA 5D3SA 4CFLA 3P5OA 3Q2FA 4HXKA 5EICA 4BW3A 5DW1A 5D3LA 5LUUA 4Y03A 4HXRA 3UVYA 3HMEA 5FE4A 4Z93A 3UV2A 5CRZA 4XUBA 3U5OA 4NRBA 4A9MA 4YH3A 4QEVA 5CQ8A 5F61A 5FFVA 4QEUA 4LRGA 4CUPA 4YYNA 2YEKA 4NR7A 4UYFB 4XY9A 5IGKA 5FE2A 5LJ2A 4A9KA 2RS9B 4RVRA 5HEMA 5L8UA 2R0VA 4HXSA 5EGUA 4J0SA 5EPBA 4HBXA 5LKXA 4IR4A 1JSPB 5DYAA 5E9MA 5F36A 2G4AA 3S91A 3IU5A 5EM3A 5D0CA 5CRMA 2RI7A 5H1VA 4ALHA 4YBMA 4QYDA 5IG6A 4UIWA 4A9JA 4QEWA 5E73A 4Z6HA 4ZC9A 5D3RA 3D7CA 5E3GA 4X2IA 4IR5A 5D3JA 4NUEA 4QUTA 4YATA 4LZ2A 5KU3A 4O72A 4CUQA 5EWWA 4QY4A 5ENGA 5HFRA 4UIZA 1E6IA 5A82A 4UITA 4NR4A 5JWMA 5ENBA 4O7BA 5EK9A 4LC2A 4WHWA 4OUFA 4A9NA 4XYAA 1JM4B 4O7EA 5H1TA 3U5KA 4KV4A 3AQAA 5FE9A 5F1HA 4YBTA 4TT4A 5AMEA 3NXBA 5FE7A 4HBYA 5DYCA 5I80A 5L8TA 5DX4A 3ONIA 5C89A 3JVKA 4TT2A 4YY4A 3LJWA 4CUTA 4O7AA 4CFKA 4LYIA 4XUAA 4QUUA 2R0YA 5FE6A 4HXOA 3P1FA 4LYSA 5DW2A 5IGNA 5A5RA 5EWHA 3U5LA 4YYHA 4J1PA 1WUMA 4PKLA 3JVLA 5KTUA 2RO1A 5L96A 2WP1A 3IU6A 5D7XA 5E3DA 3MB4A 5LJ1A 5ENEA 1ZS5A 4AKNA 5H1UA 4MEPA 3LQJA 2NXBA 5I7YA 1N72A 5CFWA 5CZGA 2WP2A 4OGIA 4Z1SA 3HMHA 3SVHA 2DVSA 5CQ6A 4IOQA 5A7CA 5DFCA 3RCWA 1X0JA 5LVQA 4CL9A 4NR5A 4CURA 4O74A 4E96A 5CGPA 5FG5A 3U5JA 3UVXA 4TQNA 5DY7A 4UIUA 3LXJA 3P1CA 4YYJA 5CUAA 4O7CA 4A9FA 5LVRA 5EPSA 5HCLA 4LYWA 3MUKA 3UW9A 5HENA 5E7DA 4N4HA 4UIVA 5I88A 5BT3A 5HQ5A 4O77A 5G4SA 5FG4A 4A9IA 3UVDA 4OGJA 5EWCA 5ENFA 5HQ7A 4MEQA 5DKHA 5ENHA 3P1EA 4NRAA 5F63A 5D3TA 2E3KA 2OO1A 2YYNA 5HRVA 4A9LA 5CY9A 5IGLA 4HXPA 5EI4A 5I7XA 4TU6A 5ENCA 5CUBA 4QYLA 5DLZA 5DKDA 4YH4A 3GG3A 4NUCA 4DONA 4A9EA 5LKZA 2D82A 2DKWA 3SVFA 4C66A 3MB3A 5HLSA 4TYLA 3Q2EA 4Z1QA 4Z6IA 4YC9A 5C4QA 5C85A 5KO4A 3DAIA 4N4FA 2DVRA 4YYKA 2H60A 4UIYA 2DATA 3JVJA 3UV5A 5F2PA 4ZQLA 4QSTA 3HMFA 4QSPA 5EV9A 5HQ6A 5L99A 5LKTA 2FSAA 5A5QA 4QR3A 4BW1A 4O78A 5D3PA 2F6NA 5L97A 5EP7A 5CUEA 4KCXA 4O7FA 5D25A 5A81A 4TZ2A 5CUGA 2R0SA 5D26A 3UVWA 5FBXA 5HFQA 4HBVA 5LKUA
chains in the Genus database with same CATH superfamily
5EISA 2F6JA 4CUSA 5II1A 4AKGA 4PTBA 4CUUA 5CP5A 4J0RA 5FE5A 2N9GA 5EVAA 5HRWA 5EWDA 2I7KA 4LDFA 4HBWA 2YW5A 5F60A 3U5MA 4QBMA 5E74A 5I83A 4UYDA 4YK0A 5DKCA 4O70A 4QSUA 5FE1A 5L98A 5COIA 4IR3A 4WHUA 5E0RA 4NQMA 2LSPB 5DFBA 5IGMA 3S92A 3U5PA 5FG6A 3K2JA 2R10A 4NRCA 4AKHA 5A5PA 4IOOA 3I3JA 5I1QA 5DYUA 5FE0A 5CQTA 5DLXA 5K29A 4UIXA 3MQMA 4MR4A 4A9OA 4UYGA 3ZYUA 3UV4A 5FE8A 3G0JA 4XY8A 2GRCA 5FH8A 5E9KA 4PS5A 5CTLA 5JI8A 4N3WA 4QSRA 2RNXA 4NR8A 1EQFA 5C7NA 5F5ZA 1ZKRA 5D24A 4IORA 3P1DA 4NYXA 2YDWA 4TS8A 5CU8A 3G0LA 4PCIA 2EJNA 5IIDA 5FB0A 5DYXA 4QC3A 5HELA 2KTBB 4BJXA 2D9EA 2DVQA 1F68A 5EA1A 4PCEA 4J3IA 4YYIA 5FDZA 4QC1A 3QZSA 4QB3A 4QR5A 4LZRA 4F3IA 4NYVA 3AADA 5H85A 4YYGA 4QR4A 5E9IA 5AD2A 3U5NA 3MULA 3QZTA 4WIVA 4QSWA 5A85A 3DWYA 4BW4A 4MR5A 2MJVB 5A5NA 5FB1A 5AMFA 5A5SA 5D3HA 5BT4A 4NR9A 4MR3A 4QSVA 2RNWA 3SVGA 5II2A 5CQ4A 2E7OA 4YADA 4TT6A 5CUDA 4UYFA 5EPRA 3O37A 4O71A 4PY6A 5IBNA 5E9VA 5F62A 5I86A 3O34A 4LR6A 4Q0OA 5C87A 5A5OA 5KTXA 4NYWA 5HM0A 5F3AA 1WUGA 5J0DA 5G4RA 4O76A 3MXFA 5CQ5A 4MR6A 4GPJA 4NQNA 5DBMA 4Q0NA 2DWWA 3JVMA 5ETDA 2YEMA 5TB6A 5ENJA 2L84A 4FLPA 5F1LA 4UYHA 5EQ1A 4NR6A 2OSSA 2YELA 5FFYA 4QSXA 4YAXA 4BHWA 4TTEA 4C67A 5DFDA 4QZSA 5E9YA 4YBSA 2OUOA 5FH6A 5A83A 4QSQA 4ZW1A 5HRXA 4HXLA 3VKHA 3O33A 4YYDA 4N4IA 4O75A 4KV1A 4CLBA 2I8NA 5ENIA 4QNSA 4N4GA 5CS8A 4HXMA 4NXJA 4TU4A 2E7NA 5F25A 5CQAA 5FFWA 4IR6A 5FE3A 5E9LA 3LQIA 4YABA 5C8GA 4ALGA 5BT5A 2RFJA 4LZSA 5ETBA 4HXNA 5D3NA 5ACYA 5FH7A 5KTWA 3O35A 5I89A 4YY6A 5CUCA 4NUDA 4NS5A 4A9HA 4YYMA 5AD3A 5CQ7A 2YQDA 5CPEA 5LJ0A 4MENA 5CQ3A 4TZ8A 5EU1A 3LQHA 2L5EA 5I29A 3TLPA 4BW2A 2RNYA 2DVVA 2L85A 5HJCA 5TCMA 3FKMX 4MEOA 5EWVA 5I40A 3QZVA 4QSSA 3O36A 5KHMA 4UYEA 5D3SA 4CFLA 3P5OA 3Q2FA 4HXKA 5EICA 4BW3A 5DW1A 5D3LA 5LUUA 4Y03A 4HXRA 3UVYA 3HMEA 5FE4A 3ERRA 4Z93A 3UV2A 5CRZA 4XUBA 3U5OA 4NRBA 4A9MA 4YH3A 4QEVA 5CQ8A 5F61A 3D1BA 5FFVA 4QEUA 4LRGA 4CUPA 4YYNA 2YEKA 4NR7A 4UYFB 4XY9A 5IGKA 5FE2A 5LJ2A 4A9KA 2RS9B 4RVRA 5HEMA 5L8UA 2R0VA 4HXSA 5EGUA 4J0SA 5EPBA 4HBXA 5LKXA 4IR4A 1JSPB 5DYAA 5E9MA 5F36A 4AKIA 2G4AA 3S91A 3IU5A 5EM3A 3VKGA 5D0CA 5CRMA 2RI7A 5H1VA 4ALHA 4YBMA 4QYDA 5IG6A 4UIWA 4A9JA 4QEWA 5E73A 4Z6HA 4ZC9A 5D3RA 3D7CA 5E3GA 4X2IA 4IR5A 5D3JA 4NUEA 4QUTA 4YATA 4LZ2A 5KU3A 4O72A 4CUQA 5EWWA 4QY4A 5ENGA 5HFRA 4UIZA 1E6IA 5A82A 4UITA 4NR4A 5JWMA 5ENBA 4O7BA 5EK9A 4LC2A 4WHWA 4OUFA 4A9NA 4XYAA 1JM4B 4O7EA 5H1TA 3U5KA 4KV4A 3AQAA 5FE9A 5F1HA 4YBTA 3D1DA 4TT4A 5AMEA 3NXBA 5FE7A 4HBYA 5DYCA 5I80A 5L8TA 5DX4A 3ONIA 5C89A 3JVKA 4TT2A 4YY4A 3LJWA 4CUTA 4O7AA 4CFKA 4LYIA 4XUAA 4QUUA 2R0YA 5FE6A 4HXOA 3P1FA 4LYSA 5DW2A 5IGNA 5A5RA 5EWHA 3U5LA 4YYHA 4J1PA 1WUMA 4PKLA 3JVLA 5KTUA 2RO1A 5L96A 2WP1A 3IU6A 5D7XA 5E3DA 3MB4A 5LJ1A 5ENEA 1ZS5A 4AKNA 5H1UA 4MEPA 3LQJA 2NXBA 1PUOA 5I7YA 1N72A 5CFWA 5CZGA 2WP2A 4OGIA 4Z1SA 3HMHA 3SVHA 2DVSA 5CQ6A 4IOQA 5A7CA 5DFCA 3RCWA 1X0JA 5LVQA 4CL9A 4NR5A 4CURA 4O74A 4E96A 5CGPA 5FG5A 3U5JA 3UVXA 4TQNA 5DY7A 4UIUA 3LXJA 3P1CA 4YYJA 5CUAA 4O7CA 4A9FA 5LVRA 5EPSA 5HCLA 4LYWA 3MUKA 3UW9A 5HENA 5E7DA 4N4HA 4UIVA 5I88A 5BT3A 5HQ5A 4O77A 5G4SA 5FG4A 4A9IA 3UVDA 4OGJA 5EWCA 5ENFA 5HQ7A 4MEQA 5DKHA 5ENHA 3P1EA 4NRAA 5F63A 5D3TA 2E3KA 2OO1A 2YYNA 5HRVA 4A9LA 5CY9A 5IGLA 4HXPA 5EI4A 5I7XA 4TU6A 5ENCA 5CUBA 4QYLA 5DLZA 5DKDA 4YH4A 3GG3A 4NUCA 4DONA 4A9EA 5LKZA 2D82A 2DKWA 3SVFA 4C66A 3MB3A 5HLSA 4TYLA 3Q2EA 4Z1QA 4Z6IA 4YC9A 5C4QA 5C85A 5KO4A 3DAIA 4N4FA 2DVRA 4YYKA 2H60A 4UIYA 2DATA 3JVJA 3UV5A 5F2PA 4ZQLA 4QSTA 3HMFA 4QSPA 5EV9A 5HQ6A 5L99A 5LKTA 4AI6A 2FSAA 5A5QA 4QR3A 4BW1A 4O78A 5D3PA 2F6NA 5L97A 5EP7A 5CUEA 4KCXA 4O7FA 5D25A 5A81A 4TZ2A 5CUGA 2R0SA 5D26A 3UVWA 5FBXA 5HFQA 4HBVA 5LKUA
chains in the Genus database with same CATH topology
5EISA 2F6JA 4CUSA 5II1A 4PTBA 4CUUA 5CP5A 4J0RA 5FE5A 2N9GA 5EVAA 5HRWA 5EWDA 2I7KA 4LDFA 4HBWA 2YW5A 5F60A 3U5MA 4QBMA 5E74A 5I83A 4UYDA 4YK0A 5DKCA 4O70A 4QSUA 5FE1A 5L98A 5COIA 4IR3A 4WHUA 5E0RA 4NQMA 2LSPB 5DFBA 5IGMA 3S92A 3U5PA 5FG6A 3K2JA 2R10A 4NRCA 5A5PA 4IOOA 3I3JA 5I1QA 5DYUA 5FE0A 5CQTA 5DLXA 5K29A 4UIXA 3MQMA 4MR4A 4A9OA 4UYGA 3ZYUA 3UV4A 5FE8A 3G0JA 4XY8A 2GRCA 5FH8A 5E9KA 4PS5A 5CTLA 5JI8A 4N3WA 4QSRA 2RNXA 4NR8A 1EQFA 5C7NA 5F5ZA 5D24A 4IORA 3P1DA 4NYXA 2YDWA 4TS8A 5CU8A 3G0LA 4PCIA 5IIDA 5FB0A 5DYXA 4QC3A 5HELA 2KTBB 4BJXA 2D9EA 2DVQA 1F68A 5EA1A 4PCEA 4J3IA 4YYIA 5FDZA 4QC1A 3QZSA 4QB3A 4QR5A 4LZRA 4F3IA 4NYVA 3AADA 5H85A 4YYGA 4QR4A 5E9IA 5AD2A 3U5NA 3MULA 3QZTA 4WIVA 4QSWA 5A85A 3DWYA 4BW4A 4MR5A 2MJVB 5A5NA 5FB1A 5AMFA 5A5SA 5D3HA 5BT4A 4NR9A 4MR3A 4QSVA 2RNWA 3SVGA 5II2A 5CQ4A 2E7OA 4YADA 4TT6A 5CUDA 4UYFA 5EPRA 3O37A 4O71A 4PY6A 5IBNA 5E9VA 5F62A 5I86A 3O34A 4LR6A 4Q0OA 5C87A 5A5OA 5KTXA 4NYWA 5HM0A 5F3AA 1WUGA 5J0DA 5G4RA 4O76A 3MXFA 5CQ5A 4MR6A 4GPJA 4NQNA 5DBMA 4Q0NA 2DWWA 3JVMA 5ETDA 2YEMA 5TB6A 5ENJA 2L84A 4FLPA 5F1LA 4UYHA 5EQ1A 4NR6A 2OSSA 2YELA 5FFYA 4QSXA 4YAXA 4BHWA 4TTEA 4C67A 5DFDA 4QZSA 5E9YA 4YBSA 2OUOA 5FH6A 5A83A 4QSQA 4ZW1A 5HRXA 4HXLA 3O33A 4YYDA 4N4IA 4O75A 4KV1A 4CLBA 2I8NA 5ENIA 4QNSA 4N4GA 5CS8A 4HXMA 4NXJA 4TU4A 2E7NA 5F25A 5CQAA 5FFWA 4IR6A 5FE3A 5E9LA 3LQIA 4YABA 5C8GA 4ALGA 5BT5A 2RFJA 4LZSA 5ETBA 4HXNA 5D3NA 5ACYA 5FH7A 5KTWA 3O35A 5I89A 4YY6A 5CUCA 4NUDA 4NS5A 4A9HA 4YYMA 5AD3A 5CQ7A 2YQDA 5CPEA 5LJ0A 4MENA 5CQ3A 4TZ8A 5EU1A 3LQHA 2L5EA 5I29A 3TLPA 4BW2A 2RNYA 2DVVA 2L85A 5HJCA 5TCMA 3FKMX 4MEOA 5EWVA 5I40A 3QZVA 4QSSA 3O36A 5KHMA 4UYEA 5D3SA 4CFLA 3P5OA 3Q2FA 4HXKA 5EICA 4BW3A 5DW1A 5D3LA 5LUUA 4Y03A 4HXRA 3UVYA 3HMEA 5FE4A 4Z93A 3UV2A 5CRZA 4XUBA 3U5OA 4NRBA 4A9MA 4YH3A 4QEVA 5CQ8A 5F61A 5FFVA 4QEUA 4LRGA 4CUPA 4YYNA 2YEKA 4NR7A 4UYFB 4XY9A 5IGKA 5FE2A 5LJ2A 4A9KA 2RS9B 4RVRA 5HEMA 5L8UA 2R0VA 4HXSA 5EGUA 4J0SA 5EPBA 4HBXA 5LKXA 4IR4A 1JSPB 5DYAA 5E9MA 5F36A 2G4AA 3S91A 3IU5A 5EM3A 5D0CA 5CRMA 2RI7A 5H1VA 4ALHA 4YBMA 4QYDA 5IG6A 4UIWA 4A9JA 4QEWA 5E73A 4Z6HA 4ZC9A 5D3RA 3D7CA 5E3GA 4X2IA 4IR5A 5D3JA 4NUEA 4QUTA 4YATA 4LZ2A 5KU3A 4O72A 4CUQA 5EWWA 4QY4A 5ENGA 5HFRA 4UIZA 1E6IA 5A82A 4UITA 4NR4A 5JWMA 5ENBA 4O7BA 5EK9A 4LC2A 4WHWA 4OUFA 4A9NA 4XYAA 1JM4B 4O7EA 5H1TA 3U5KA 4KV4A 3AQAA 5FE9A 5F1HA 4YBTA 4TT4A 5AMEA 3NXBA 5FE7A 4HBYA 5DYCA 5I80A 5L8TA 5DX4A 3ONIA 5C89A 3JVKA 4TT2A 4YY4A 3LJWA 4CUTA 4O7AA 4CFKA 4LYIA 4XUAA 4QUUA 2R0YA 5FE6A 4HXOA 3P1FA 4LYSA 5DW2A 5IGNA 5A5RA 5EWHA 3U5LA 4YYHA 4J1PA 1WUMA 4PKLA 3JVLA 5KTUA 2RO1A 5L96A 2WP1A 3IU6A 5D7XA 5E3DA 3MB4A 5LJ1A 5ENEA 1ZS5A 4AKNA 5H1UA 4MEPA 3LQJA 2NXBA 5I7YA 1N72A 5CFWA 5CZGA 2WP2A 4OGIA 4Z1SA 3HMHA 3SVHA 2DVSA 5CQ6A 4IOQA 5A7CA 5DFCA 3RCWA 1X0JA 5LVQA 4CL9A 4NR5A 4CURA 4O74A 4E96A 5CGPA 5FG5A 3U5JA 3UVXA 4TQNA 5DY7A 4UIUA 3LXJA 3P1CA 4YYJA 5CUAA 4O7CA 4A9FA 5LVRA 5EPSA 5HCLA 4LYWA 3MUKA 3UW9A 5HENA 5E7DA 4N4HA 4UIVA 5I88A 5BT3A 5HQ5A 4O77A 5G4SA 5FG4A 4A9IA 3UVDA 4OGJA 5EWCA 5ENFA 5HQ7A 4MEQA 5DKHA 5ENHA 3P1EA 4NRAA 5F63A 5D3TA 2E3KA 2OO1A 2YYNA 5HRVA 4A9LA 5CY9A 5IGLA 4HXPA 5EI4A 5I7XA 4TU6A 5ENCA 5CUBA 4QYLA 5DLZA 5DKDA 4YH4A 3GG3A 4NUCA 4DONA 4A9EA 5LKZA 2D82A 2DKWA 3SVFA 4C66A 3MB3A 5HLSA 4TYLA 3Q2EA 4Z1QA 4Z6IA 4YC9A 5C4QA 5C85A 5KO4A 3DAIA 4N4FA 2DVRA 4YYKA 2H60A 4UIYA 2DATA 3JVJA 3UV5A 5F2PA 4ZQLA 4QSTA 3HMFA 4QSPA 5EV9A 5HQ6A 5L99A 5LKTA 2FSAA 5A5QA 4QR3A 4BW1A 4O78A 5D3PA 2F6NA 5L97A 5EP7A 5CUEA 4KCXA 4O7FA 5D25A 5A81A 4TZ2A 5CUGA 2R0SA 5D26A 3UVWA 5FBXA 5HFQA 4HBVA 5LKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EIS A;  2F6J A;  4CUS A;  5II1 A;  4PTB A;  4CUU A;  5CP5 A;  4J0R A;  5FE5 A;  2N9G A;  5EVA A;  5HRW A;  5EWD A;  2I7K A;  4LDF A;  4HBW A;  2YW5 A;  5F60 A;  3U5M A;  4QBM A;  5E74 A;  5I83 A;  4UYD A;  4YK0 A;  5DKC A;  4O70 A;  4QSU A;  5FE1 A;  5L98 A;  5COI A;  4IR3 A;  4WHU A;  5E0R A;  4NQM A;  2LSP B;  5DFB A;  5IGM A;  3S92 A;  3U5P A;  5FG6 A;  3K2J A;  2R10 A;  4NRC A;  5A5P A;  4IOO A;  3I3J A;  5I1Q A;  5DYU A;  5FE0 A;  5CQT A;  5DLX A;  5K29 A;  4UIX A;  3MQM A;  4MR4 A;  4A9O A;  4UYG A;  3ZYU A;  3UV4 A;  5FE8 A;  3G0J A;  4XY8 A;  2GRC A;  5FH8 A;  5E9K A;  4PS5 A;  5CTL A;  5JI8 A;  4N3W A;  4QSR A;  2RNX A;  4NR8 A;  1EQF A;  5C7N A;  5F5Z A;  5D24 A;  4IOR A;  3P1D A;  4NYX A;  2YDW A;  4TS8 A;  5CU8 A;  3G0L A;  4PCI A;  5IID A;  5FB0 A;  5DYX A;  4QC3 A;  5HEL A;  2KTB B;  4BJX A;  2D9E A;  2DVQ A;  1F68 A;  5EA1 A;  4PCE A;  4J3I A;  4YYI A;  5FDZ A;  4QC1 A;  3QZS A;  4QB3 A;  4QR5 A;  4LZR A;  4F3I A;  4NYV A;  3AAD A;  5H85 A;  4YYG A;  4QR4 A;  5E9I A;  5AD2 A;  3U5N A;  3MUL A;  3QZT A;  4WIV A;  4QSW A;  5A85 A;  3DWY A;  4BW4 A;  4MR5 A;  2MJV B;  5A5N A;  5FB1 A;  5AMF A;  5A5S A;  5D3H A;  5BT4 A;  4NR9 A;  4MR3 A;  4QSV A;  2RNW A;  3SVG A;  5II2 A;  5CQ4 A;  2E7O A;  4YAD A;  4TT6 A;  5CUD A;  4UYF A;  5EPR A;  3O37 A;  4O71 A;  4PY6 A;  5IBN A;  5E9V A;  5F62 A;  5I86 A;  3O34 A;  4LR6 A;  4Q0O A;  5C87 A;  5A5O A;  5KTX A;  4NYW A;  5HM0 A;  5F3A A;  1WUG A;  5J0D A;  5G4R A;  4O76 A;  3MXF A;  5CQ5 A;  4MR6 A;  4GPJ A;  4NQN A;  5DBM A;  4Q0N A;  2DWW A;  3JVM A;  5ETD A;  2YEM A;  5TB6 A;  5ENJ A;  2L84 A;  4FLP A;  5F1L A;  4UYH A;  5EQ1 A;  4NR6 A;  2OSS A;  2YEL A;  5FFY A;  4QSX A;  4YAX A;  4BHW A;  4TTE A;  4C67 A;  5DFD A;  4QZS A;  5E9Y A;  4YBS A;  2OUO A;  5FH6 A;  5A83 A;  4QSQ A;  4ZW1 A;  5HRX A;  4HXL A;  3O33 A;  4YYD A;  4N4I A;  4O75 A;  4KV1 A;  4CLB A;  2I8N A;  5ENI A;  4QNS A;  4N4G A;  5CS8 A;  4HXM A;  4NXJ A;  4TU4 A;  2E7N A;  5F25 A;  5CQA A;  5FFW A;  4IR6 A;  5FE3 A;  5E9L A;  3LQI A;  4YAB A;  5C8G A;  4ALG A;  5BT5 A;  2RFJ A;  4LZS A;  5ETB A;  4HXN A;  5D3N A;  5ACY A;  5FH7 A;  5KTW A;  3O35 A;  5I89 A;  4YY6 A;  5CUC A;  4NUD A;  4NS5 A;  4A9H A;  4YYM A;  5AD3 A;  5CQ7 A;  2YQD A;  5CPE A;  5LJ0 A;  4MEN A;  5CQ3 A;  4TZ8 A;  5EU1 A;  3LQH A;  2L5E A;  5I29 A;  3TLP A;  4BW2 A;  2RNY A;  2DVV A;  2L85 A;  5HJC A;  5TCM A;  3FKM X;  4MEO A;  5EWV A;  5I40 A;  3QZV A;  4QSS A;  3O36 A;  5KHM A;  4UYE A;  5D3S A;  4CFL A;  3P5O A;  3Q2F A;  4HXK A;  5EIC A;  4BW3 A;  5DW1 A;  5D3L A;  5LUU A;  4Y03 A;  4HXR A;  3UVY A;  3HME A;  5FE4 A;  4Z93 A;  3UV2 A;  5CRZ A;  4XUB A;  3U5O A;  4NRB A;  4A9M A;  4YH3 A;  4QEV A;  5CQ8 A;  5F61 A;  5FFV A;  4QEU A;  4LRG A;  4CUP A;  4YYN A;  2YEK A;  4NR7 A;  4UYF B;  4XY9 A;  5IGK A;  5FE2 A;  5LJ2 A;  4A9K A;  2RS9 B;  4RVR A;  5HEM A;  5L8U A;  2R0V A;  4HXS A;  5EGU A;  4J0S A;  5EPB A;  4HBX A;  5LKX A;  4IR4 A;  1JSP B;  5DYA A;  5E9M A;  5F36 A;  2G4A A;  3S91 A;  3IU5 A;  5EM3 A;  5D0C A;  5CRM A;  2RI7 A;  5H1V A;  4ALH A;  4YBM A;  4QYD A;  5IG6 A;  4UIW A;  4A9J A;  4QEW A;  5E73 A;  4Z6H A;  4ZC9 A;  5D3R A;  3D7C A;  5E3G A;  4X2I A;  4IR5 A;  5D3J A;  4NUE A;  4QUT A;  4YAT A;  4LZ2 A;  5KU3 A;  4O72 A;  4CUQ A;  5EWW A;  4QY4 A;  5ENG A;  5HFR A;  4UIZ A;  1E6I A;  5A82 A;  4UIT A;  4NR4 A;  5JWM A;  5ENB A;  4O7B A;  5EK9 A;  4LC2 A;  4WHW A;  4OUF A;  4A9N A;  4XYA A;  1JM4 B;  4O7E A;  5H1T A;  3U5K A;  4KV4 A;  3AQA A;  5FE9 A;  5F1H A;  4YBT A;  4TT4 A;  5AME A;  3NXB A;  5FE7 A;  4HBY A;  5DYC A;  5I80 A;  5L8T A;  5DX4 A;  3ONI A;  5C89 A;  3JVK A;  4TT2 A;  4YY4 A;  3LJW A;  4CUT A;  4O7A A;  4CFK A;  4LYI A;  4XUA A;  4QUU A;  2R0Y A;  5FE6 A;  4HXO A;  3P1F A;  4LYS A;  5DW2 A;  5IGN A;  5A5R A;  5EWH A;  3U5L A;  4YYH A;  4J1P A;  1WUM A;  4PKL A;  3JVL A;  5KTU A;  2RO1 A;  5L96 A;  2WP1 A;  3IU6 A;  5D7X A;  5E3D A;  3MB4 A;  5LJ1 A;  5ENE A;  1ZS5 A;  4AKN A;  5H1U A;  4MEP A;  3LQJ A;  2NXB A;  5I7Y A;  1N72 A;  5CFW A;  5CZG A;  2WP2 A;  4OGI A;  4Z1S A;  3HMH A;  3SVH A;  2DVS A;  5CQ6 A;  4IOQ A;  5A7C A;  5DFC A;  3RCW A;  1X0J A;  5LVQ A;  4CL9 A;  4NR5 A;  4CUR A;  4O74 A;  4E96 A;  5CGP A;  5FG5 A;  3U5J A;  3UVX A;  4TQN A;  5DY7 A;  4UIU A;  3LXJ A;  3P1C A;  4YYJ A;  5CUA A;  4O7C A;  4A9F A;  5LVR A;  5EPS A;  5HCL A;  4LYW A;  3MUK A;  3UW9 A;  5HEN A;  5E7D A;  4N4H A;  4UIV A;  5I88 A;  5BT3 A;  5HQ5 A;  4O77 A;  5G4S A;  5FG4 A;  4A9I A;  3UVD A;  4OGJ A;  5EWC A;  5ENF A;  5HQ7 A;  4MEQ A;  5DKH A;  5ENH A;  3P1E A;  4NRA A;  5F63 A;  5D3T A;  2E3K A;  2OO1 A;  2YYN A;  5HRV A;  4A9L A;  5CY9 A;  5IGL A;  4HXP A;  5EI4 A;  5I7X A;  4TU6 A;  5ENC A;  5CUB A;  4QYL A;  5DLZ A;  5DKD A;  4YH4 A;  3GG3 A;  4NUC A;  4DON A;  4A9E A;  5LKZ A;  2D82 A;  2DKW A;  3SVF A;  4C66 A;  3MB3 A;  5HLS A;  4TYL A;  3Q2E A;  4Z1Q A;  4Z6I A;  4YC9 A;  5C4Q A;  5C85 A;  5KO4 A;  3DAI A;  4N4F A;  2DVR A;  4YYK A;  2H60 A;  4UIY A;  2DAT A;  3JVJ A;  3UV5 A;  5F2P A;  4ZQL A;  4QST A;  3HMF A;  4QSP A;  5EV9 A;  5HQ6 A;  5L99 A;  5LKT A;  2FSA A;  5A5Q A;  4QR3 A;  4BW1 A;  4O78 A;  5D3P A;  2F6N A;  5L97 A;  5EP7 A;  5CUE A;  4KCX A;  4O7F A;  5D25 A;  5A81 A;  4TZ2 A;  5CUG A;  2R0S A;  5D26 A;  3UVW A;  5FBX A;  5HFQ A;  4HBV A;  5LKU A; 
#chains in the Genus database with same CATH topology
 5EIS A;  2F6J A;  4CUS A;  5II1 A;  4AKG A;  4PTB A;  4CUU A;  5CP5 A;  4J0R A;  5FE5 A;  2N9G A;  5EVA A;  5HRW A;  5EWD A;  2I7K A;  4LDF A;  4HBW A;  2YW5 A;  5F60 A;  3U5M A;  4QBM A;  5E74 A;  5I83 A;  4UYD A;  4YK0 A;  5DKC A;  4O70 A;  4QSU A;  5FE1 A;  5L98 A;  5COI A;  4IR3 A;  4WHU A;  5E0R A;  4NQM A;  2LSP B;  5DFB A;  5IGM A;  3S92 A;  3U5P A;  5FG6 A;  3K2J A;  2R10 A;  4NRC A;  4AKH A;  5A5P A;  4IOO A;  3I3J A;  5I1Q A;  5DYU A;  5FE0 A;  5CQT A;  5DLX A;  5K29 A;  4UIX A;  3MQM A;  4MR4 A;  4A9O A;  4UYG A;  3ZYU A;  3UV4 A;  5FE8 A;  3G0J A;  4XY8 A;  2GRC A;  5FH8 A;  5E9K A;  4PS5 A;  5CTL A;  5JI8 A;  4N3W A;  4QSR A;  2RNX A;  4NR8 A;  1EQF A;  5C7N A;  5F5Z A;  1ZKR A;  5D24 A;  4IOR A;  3P1D A;  4NYX A;  2YDW A;  4TS8 A;  5CU8 A;  3G0L A;  4PCI A;  2EJN A;  5IID A;  5FB0 A;  5DYX A;  4QC3 A;  5HEL A;  2KTB B;  4BJX A;  2D9E A;  2DVQ A;  1F68 A;  5EA1 A;  4PCE A;  4J3I A;  4YYI A;  5FDZ A;  4QC1 A;  3QZS A;  4QB3 A;  4QR5 A;  4LZR A;  4F3I A;  4NYV A;  3AAD A;  5H85 A;  4YYG A;  4QR4 A;  5E9I A;  5AD2 A;  3U5N A;  3MUL A;  3QZT A;  4WIV A;  4QSW A;  5A85 A;  3DWY A;  4BW4 A;  4MR5 A;  2MJV B;  5A5N A;  5FB1 A;  5AMF A;  5A5S A;  5D3H A;  5BT4 A;  4NR9 A;  4MR3 A;  4QSV A;  2RNW A;  3SVG A;  5II2 A;  5CQ4 A;  2E7O A;  4YAD A;  4TT6 A;  5CUD A;  4UYF A;  5EPR A;  3O37 A;  4O71 A;  4PY6 A;  5IBN A;  5E9V A;  5F62 A;  5I86 A;  3O34 A;  4LR6 A;  4Q0O A;  5C87 A;  5A5O A;  5KTX A;  4NYW A;  5HM0 A;  5F3A A;  1WUG A;  5J0D A;  5G4R A;  4O76 A;  3MXF A;  5CQ5 A;  4MR6 A;  4GPJ A;  4NQN A;  5DBM A;  4Q0N A;  2DWW A;  3JVM A;  5ETD A;  2YEM A;  5TB6 A;  5ENJ A;  2L84 A;  4FLP A;  5F1L A;  4UYH A;  5EQ1 A;  4NR6 A;  2OSS A;  2YEL A;  5FFY A;  4QSX A;  4YAX A;  4BHW A;  4TTE A;  4C67 A;  5DFD A;  4QZS A;  5E9Y A;  4YBS A;  2OUO A;  5FH6 A;  5A83 A;  4QSQ A;  4ZW1 A;  5HRX A;  4HXL A;  3VKH A;  3O33 A;  4YYD A;  4N4I A;  4O75 A;  4KV1 A;  4CLB A;  2I8N A;  5ENI A;  4QNS A;  4N4G A;  5CS8 A;  4HXM A;  4NXJ A;  4TU4 A;  2E7N A;  5F25 A;  5CQA A;  5FFW A;  4IR6 A;  5FE3 A;  5E9L A;  3LQI A;  4YAB A;  5C8G A;  4ALG A;  5BT5 A;  2RFJ A;  4LZS A;  5ETB A;  4HXN A;  5D3N A;  5ACY A;  5FH7 A;  5KTW A;  3O35 A;  5I89 A;  4YY6 A;  5CUC A;  4NUD A;  4NS5 A;  4A9H A;  4YYM A;  5AD3 A;  5CQ7 A;  2YQD A;  5CPE A;  5LJ0 A;  4MEN A;  5CQ3 A;  4TZ8 A;  5EU1 A;  3LQH A;  2L5E A;  5I29 A;  3TLP A;  4BW2 A;  2RNY A;  2DVV A;  2L85 A;  5HJC A;  5TCM A;  3FKM X;  4MEO A;  5EWV A;  5I40 A;  3QZV A;  4QSS A;  3O36 A;  5KHM A;  4UYE A;  5D3S A;  4CFL A;  3P5O A;  3Q2F A;  4HXK A;  5EIC A;  4BW3 A;  5DW1 A;  5D3L A;  5LUU A;  4Y03 A;  4HXR A;  3UVY A;  3HME A;  5FE4 A;  3ERR A;  4Z93 A;  3UV2 A;  5CRZ A;  4XUB A;  3U5O A;  4NRB A;  4A9M A;  4YH3 A;  4QEV A;  5CQ8 A;  5F61 A;  3D1B A;  5FFV A;  4QEU A;  4LRG A;  4CUP A;  4YYN A;  2YEK A;  4NR7 A;  4UYF B;  4XY9 A;  5IGK A;  5FE2 A;  5LJ2 A;  4A9K A;  2RS9 B;  4RVR A;  5HEM A;  5L8U A;  2R0V A;  4HXS A;  5EGU A;  4J0S A;  5EPB A;  4HBX A;  5LKX A;  4IR4 A;  1JSP B;  5DYA A;  5E9M A;  5F36 A;  4AKI A;  2G4A A;  3S91 A;  3IU5 A;  5EM3 A;  3VKG A;  5D0C A;  5CRM A;  2RI7 A;  5H1V A;  4ALH A;  4YBM A;  4QYD A;  5IG6 A;  4UIW A;  4A9J A;  4QEW A;  5E73 A;  4Z6H A;  4ZC9 A;  5D3R A;  3D7C A;  5E3G A;  4X2I A;  4IR5 A;  5D3J A;  4NUE A;  4QUT A;  4YAT A;  4LZ2 A;  5KU3 A;  4O72 A;  4CUQ A;  5EWW A;  4QY4 A;  5ENG A;  5HFR A;  4UIZ A;  1E6I A;  5A82 A;  4UIT A;  4NR4 A;  5JWM A;  5ENB A;  4O7B A;  5EK9 A;  4LC2 A;  4WHW A;  4OUF A;  4A9N A;  4XYA A;  1JM4 B;  4O7E A;  5H1T A;  3U5K A;  4KV4 A;  3AQA A;  5FE9 A;  5F1H A;  4YBT A;  3D1D A;  4TT4 A;  5AME A;  3NXB A;  5FE7 A;  4HBY A;  5DYC A;  5I80 A;  5L8T A;  5DX4 A;  3ONI A;  5C89 A;  3JVK A;  4TT2 A;  4YY4 A;  3LJW A;  4CUT A;  4O7A A;  4CFK A;  4LYI A;  4XUA A;  4QUU A;  2R0Y A;  5FE6 A;  4HXO A;  3P1F A;  4LYS A;  5DW2 A;  5IGN A;  5A5R A;  5EWH A;  3U5L A;  4YYH A;  4J1P A;  1WUM A;  4PKL A;  3JVL A;  5KTU A;  2RO1 A;  5L96 A;  2WP1 A;  3IU6 A;  5D7X A;  5E3D A;  3MB4 A;  5LJ1 A;  5ENE A;  1ZS5 A;  4AKN A;  5H1U A;  4MEP A;  3LQJ A;  2NXB A;  1PUO A;  5I7Y A;  1N72 A;  5CFW A;  5CZG A;  2WP2 A;  4OGI A;  4Z1S A;  3HMH A;  3SVH A;  2DVS A;  5CQ6 A;  4IOQ A;  5A7C A;  5DFC A;  3RCW A;  1X0J A;  5LVQ A;  4CL9 A;  4NR5 A;  4CUR A;  4O74 A;  4E96 A;  5CGP A;  5FG5 A;  3U5J A;  3UVX A;  4TQN A;  5DY7 A;  4UIU A;  3LXJ A;  3P1C A;  4YYJ A;  5CUA A;  4O7C A;  4A9F A;  5LVR A;  5EPS A;  5HCL A;  4LYW A;  3MUK A;  3UW9 A;  5HEN A;  5E7D A;  4N4H A;  4UIV A;  5I88 A;  5BT3 A;  5HQ5 A;  4O77 A;  5G4S A;  5FG4 A;  4A9I A;  3UVD A;  4OGJ A;  5EWC A;  5ENF A;  5HQ7 A;  4MEQ A;  5DKH A;  5ENH A;  3P1E A;  4NRA A;  5F63 A;  5D3T A;  2E3K A;  2OO1 A;  2YYN A;  5HRV A;  4A9L A;  5CY9 A;  5IGL A;  4HXP A;  5EI4 A;  5I7X A;  4TU6 A;  5ENC A;  5CUB A;  4QYL A;  5DLZ A;  5DKD A;  4YH4 A;  3GG3 A;  4NUC A;  4DON A;  4A9E A;  5LKZ A;  2D82 A;  2DKW A;  3SVF A;  4C66 A;  3MB3 A;  5HLS A;  4TYL A;  3Q2E A;  4Z1Q A;  4Z6I A;  4YC9 A;  5C4Q A;  5C85 A;  5KO4 A;  3DAI A;  4N4F A;  2DVR A;  4YYK A;  2H60 A;  4UIY A;  2DAT A;  3JVJ A;  3UV5 A;  5F2P A;  4ZQL A;  4QST A;  3HMF A;  4QSP A;  5EV9 A;  5HQ6 A;  5L99 A;  5LKT A;  4AI6 A;  2FSA A;  5A5Q A;  4QR3 A;  4BW1 A;  4O78 A;  5D3P A;  2F6N A;  5L97 A;  5EP7 A;  5CUE A;  4KCX A;  4O7F A;  5D25 A;  5A81 A;  4TZ2 A;  5CUG A;  2R0S A;  5D26 A;  3UVW A;  5FBX A;  5HFQ A;  4HBV A;  5LKU A; 
#chains in the Genus database with same CATH homology
 5EIS A;  2F6J A;  4CUS A;  5II1 A;  4PTB A;  4CUU A;  5CP5 A;  4J0R A;  5FE5 A;  2N9G A;  5EVA A;  5HRW A;  5EWD A;  2I7K A;  4LDF A;  4HBW A;  2YW5 A;  5F60 A;  3U5M A;  4QBM A;  5E74 A;  5I83 A;  4UYD A;  4YK0 A;  5DKC A;  4O70 A;  4QSU A;  5FE1 A;  5L98 A;  5COI A;  4IR3 A;  4WHU A;  5E0R A;  4NQM A;  2LSP B;  5DFB A;  5IGM A;  3S92 A;  3U5P A;  5FG6 A;  3K2J A;  2R10 A;  4NRC A;  5A5P A;  4IOO A;  3I3J A;  5I1Q A;  5DYU A;  5FE0 A;  5CQT A;  5DLX A;  5K29 A;  4UIX A;  3MQM A;  4MR4 A;  4A9O A;  4UYG A;  3ZYU A;  3UV4 A;  5FE8 A;  3G0J A;  4XY8 A;  2GRC A;  5FH8 A;  5E9K A;  4PS5 A;  5CTL A;  5JI8 A;  4N3W A;  4QSR A;  2RNX A;  4NR8 A;  1EQF A;  5C7N A;  5F5Z A;  5D24 A;  4IOR A;  3P1D A;  4NYX A;  2YDW A;  4TS8 A;  5CU8 A;  3G0L A;  4PCI A;  5IID A;  5FB0 A;  5DYX A;  4QC3 A;  5HEL A;  2KTB B;  4BJX A;  2D9E A;  2DVQ A;  1F68 A;  5EA1 A;  4PCE A;  4J3I A;  4YYI A;  5FDZ A;  4QC1 A;  3QZS A;  4QB3 A;  4QR5 A;  4LZR A;  4F3I A;  4NYV A;  3AAD A;  5H85 A;  4YYG A;  4QR4 A;  5E9I A;  5AD2 A;  3U5N A;  3MUL A;  3QZT A;  4WIV A;  4QSW A;  5A85 A;  3DWY A;  4BW4 A;  4MR5 A;  2MJV B;  5A5N A;  5FB1 A;  5AMF A;  5A5S A;  5D3H A;  5BT4 A;  4NR9 A;  4MR3 A;  4QSV A;  2RNW A;  3SVG A;  5II2 A;  5CQ4 A;  2E7O A;  4YAD A;  4TT6 A;  5CUD A;  4UYF A;  5EPR A;  3O37 A;  4O71 A;  4PY6 A;  5IBN A;  5E9V A;  5F62 A;  5I86 A;  3O34 A;  4LR6 A;  4Q0O A;  5C87 A;  5A5O A;  5KTX A;  4NYW A;  5HM0 A;  5F3A A;  1WUG A;  5J0D A;  5G4R A;  4O76 A;  3MXF A;  5CQ5 A;  4MR6 A;  4GPJ A;  4NQN A;  5DBM A;  4Q0N A;  2DWW A;  3JVM A;  5ETD A;  2YEM A;  5TB6 A;  5ENJ A;  2L84 A;  4FLP A;  5F1L A;  4UYH A;  5EQ1 A;  4NR6 A;  2OSS A;  2YEL A;  5FFY A;  4QSX A;  4YAX A;  4BHW A;  4TTE A;  4C67 A;  5DFD A;  4QZS A;  5E9Y A;  4YBS A;  2OUO A;  5FH6 A;  5A83 A;  4QSQ A;  4ZW1 A;  5HRX A;  4HXL A;  3O33 A;  4YYD A;  4N4I A;  4O75 A;  4KV1 A;  4CLB A;  2I8N A;  5ENI A;  4QNS A;  4N4G A;  5CS8 A;  4HXM A;  4NXJ A;  4TU4 A;  2E7N A;  5F25 A;  5CQA A;  5FFW A;  4IR6 A;  5FE3 A;  5E9L A;  3LQI A;  4YAB A;  5C8G A;  4ALG A;  5BT5 A;  2RFJ A;  4LZS A;  5ETB A;  4HXN A;  5D3N A;  5ACY A;  5FH7 A;  5KTW A;  3O35 A;  5I89 A;  4YY6 A;  5CUC A;  4NUD A;  4NS5 A;  4A9H A;  4YYM A;  5AD3 A;  5CQ7 A;  2YQD A;  5CPE A;  5LJ0 A;  4MEN A;  5CQ3 A;  4TZ8 A;  5EU1 A;  3LQH A;  2L5E A;  5I29 A;  3TLP A;  4BW2 A;  2RNY A;  2DVV A;  2L85 A;  5HJC A;  5TCM A;  3FKM X;  4MEO A;  5EWV A;  5I40 A;  3QZV A;  4QSS A;  3O36 A;  5KHM A;  4UYE A;  5D3S A;  4CFL A;  3P5O A;  3Q2F A;  4HXK A;  5EIC A;  4BW3 A;  5DW1 A;  5D3L A;  5LUU A;  4Y03 A;  4HXR A;  3UVY A;  3HME A;  5FE4 A;  4Z93 A;  3UV2 A;  5CRZ A;  4XUB A;  3U5O A;  4NRB A;  4A9M A;  4YH3 A;  4QEV A;  5CQ8 A;  5F61 A;  5FFV A;  4QEU A;  4LRG A;  4CUP A;  4YYN A;  2YEK A;  4NR7 A;  4UYF B;  4XY9 A;  5IGK A;  5FE2 A;  5LJ2 A;  4A9K A;  2RS9 B;  4RVR A;  5HEM A;  5L8U A;  2R0V A;  4HXS A;  5EGU A;  4J0S A;  5EPB A;  4HBX A;  5LKX A;  4IR4 A;  1JSP B;  5DYA A;  5E9M A;  5F36 A;  2G4A A;  3S91 A;  3IU5 A;  5EM3 A;  5D0C A;  5CRM A;  2RI7 A;  5H1V A;  4ALH A;  4YBM A;  4QYD A;  5IG6 A;  4UIW A;  4A9J A;  4QEW A;  5E73 A;  4Z6H A;  4ZC9 A;  5D3R A;  3D7C A;  5E3G A;  4X2I A;  4IR5 A;  5D3J A;  4NUE A;  4QUT A;  4YAT A;  4LZ2 A;  5KU3 A;  4O72 A;  4CUQ A;  5EWW A;  4QY4 A;  5ENG A;  5HFR A;  4UIZ A;  1E6I A;  5A82 A;  4UIT A;  4NR4 A;  5JWM A;  5ENB A;  4O7B A;  5EK9 A;  4LC2 A;  4WHW A;  4OUF A;  4A9N A;  4XYA A;  1JM4 B;  4O7E A;  5H1T A;  3U5K A;  4KV4 A;  3AQA A;  5FE9 A;  5F1H A;  4YBT A;  4TT4 A;  5AME A;  3NXB A;  5FE7 A;  4HBY A;  5DYC A;  5I80 A;  5L8T A;  5DX4 A;  3ONI A;  5C89 A;  3JVK A;  4TT2 A;  4YY4 A;  3LJW A;  4CUT A;  4O7A A;  4CFK A;  4LYI A;  4XUA A;  4QUU A;  2R0Y A;  5FE6 A;  4HXO A;  3P1F A;  4LYS A;  5DW2 A;  5IGN A;  5A5R A;  5EWH A;  3U5L A;  4YYH A;  4J1P A;  1WUM A;  4PKL A;  3JVL A;  5KTU A;  2RO1 A;  5L96 A;  2WP1 A;  3IU6 A;  5D7X A;  5E3D A;  3MB4 A;  5LJ1 A;  5ENE A;  1ZS5 A;  4AKN A;  5H1U A;  4MEP A;  3LQJ A;  2NXB A;  5I7Y A;  1N72 A;  5CFW A;  5CZG A;  2WP2 A;  4OGI A;  4Z1S A;  3HMH A;  3SVH A;  2DVS A;  5CQ6 A;  4IOQ A;  5A7C A;  5DFC A;  3RCW A;  1X0J A;  5LVQ A;  4CL9 A;  4NR5 A;  4CUR A;  4O74 A;  4E96 A;  5CGP A;  5FG5 A;  3U5J A;  3UVX A;  4TQN A;  5DY7 A;  4UIU A;  3LXJ A;  3P1C A;  4YYJ A;  5CUA A;  4O7C A;  4A9F A;  5LVR A;  5EPS A;  5HCL A;  4LYW A;  3MUK A;  3UW9 A;  5HEN A;  5E7D A;  4N4H A;  4UIV A;  5I88 A;  5BT3 A;  5HQ5 A;  4O77 A;  5G4S A;  5FG4 A;  4A9I A;  3UVD A;  4OGJ A;  5EWC A;  5ENF A;  5HQ7 A;  4MEQ A;  5DKH A;  5ENH A;  3P1E A;  4NRA A;  5F63 A;  5D3T A;  2E3K A;  2OO1 A;  2YYN A;  5HRV A;  4A9L A;  5CY9 A;  5IGL A;  4HXP A;  5EI4 A;  5I7X A;  4TU6 A;  5ENC A;  5CUB A;  4QYL A;  5DLZ A;  5DKD A;  4YH4 A;  3GG3 A;  4NUC A;  4DON A;  4A9E A;  5LKZ A;  2D82 A;  2DKW A;  3SVF A;  4C66 A;  3MB3 A;  5HLS A;  4TYL A;  3Q2E A;  4Z1Q A;  4Z6I A;  4YC9 A;  5C4Q A;  5C85 A;  5KO4 A;  3DAI A;  4N4F A;  2DVR A;  4YYK A;  2H60 A;  4UIY A;  2DAT A;  3JVJ A;  3UV5 A;  5F2P A;  4ZQL A;  4QST A;  3HMF A;  4QSP A;  5EV9 A;  5HQ6 A;  5L99 A;  5LKT A;  2FSA A;  5A5Q A;  4QR3 A;  4BW1 A;  4O78 A;  5D3P A;  2F6N A;  5L97 A;  5EP7 A;  5CUE A;  4KCX A;  4O7F A;  5D25 A;  5A81 A;  4TZ2 A;  5CUG A;  2R0S A;  5D26 A;  3UVW A;  5FBX A;  5HFQ A;  4HBV A;  5LKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...