3JVLA

Crystal structure of bromodomain 2 of mouse brd4
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
116
structure length
116
Chain Sequence
GAMGSKISEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 4
publication title Structures of the Dual Bromodomains of the P-TEFb-activating Protein Brd4 at Atomic Resolution
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 43
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3jvlA00
2N9GA 5FE3A 5BT3A 5EVAA 3U5MA 4UIZA 4HXNA 5DFCA 1ZS5A 4ZW1A 4OGIA 5IGLA 2R0YA 5EWCA 5F1LA 5COIA 4J0SA 3IU6A 5LKUA 5I7YA 5FFYA 5ENFA 4YABA 3U5NA 4F3IA 5KU3A 4QUTA 5CQTA 5EPSA 5DKHA 3JVKA 5DBMA 5FFWA 4UYGA 4NQNA 2E3KA 5IBNA 4QSSA 5D3LA 5HFQA 4RVRA 5HFRA 4QR3A 5L96A 5I83A 4YATA 4A9IA 3O36A 3LJWA 4KV4A 5FFVA 4O76A 5K29A 5HJCA 3GG3A 5ENJA 1X0JA 4HXKA 3U5KA 4NYWA 5IGKA 2D82A 4CURA 4HBYA 4Q0NA 4QEVA 5DYAA 2RO1A 5CQ4A 4YBTA 2R10A 4NR8A 5E9YA 5I86A 5CUEA 5AMFA 3O37A 2OUOA 2DWWA 4N4IA 4YH4A 2MJVB 4O7BA 2FSAA 2DVRA 2YDWA 4XUAA 4UIVA 3U5OA 3O33A 4LYSA 5E3GA 1EQFA 2R0SA 2WP2A 3ONIA 3UVDA 3RCWA 3DAIA 5G4SA 5D3HA 4CUTA 5EP7A 2DATA 5EGUA 4DONA 4O78A 4HXOA 5HRVA 5IGNA 5L8TA 2E7NA 5LUUA 4HXPA 5A81A 4A9OA 1WUMA 5E74A 4O74A 4Y03A 4O7AA 4BJXA 5AD2A 3MULA 4NR5A 4WHUA 2YW5A 5HEMA 4UITA 5FE8A 2I8NA 2G4AA 5JI8A 5H1TA 4YYJA 4TU6A 3ZYUA 4NR4A 4LZSA 5C87A 1E6IA 5HCLA 5ENGA 5CRZA 4IORA 3LQIA 3P1DA 5HENA 2I7KA 5ENHA 5F63A 4QYDA 4O7CA 5ETBA 5FE0A 3UV4A 4N3WA 5DLZA 4YYKA 5LJ0A 5F25A 2E7OA 3SVGA 3AQAA 2D9EA 5I29A 5E9IA 4ZQLA 3D7CA 2NXBA 5E9KA 5F3AA 4TS8A 5AD3A 5DYUA 5I7XA 4YC9A 5I1QA 5L8UA 3Q2FA 4XUBA 4YAXA 3U5PA 4YY4A 5L99A 1JSPB 5CQ6A 4WHWA 5A5PA 1F68A 5D3JA 4YYMA 5KTWA 5A85A 5ENEA 4BW4A 4O71A 1JM4B 5F36A 5EA1A 5FB1A 4NRCA 3QZSA 2OSSA 4NR9A 5FE5A 4HXRA 5DW1A 5F1HA 4Z6HA 5IGMA 5EWWA 5LVRA 4MR3A 3G0LA 4ALGA 5FE1A 4QEWA 2L84A 2GRCA 5E9MA 4YK0A 4QSXA 4C67A 3K2JA 4Z1SA 5ACYA 4O75A 4NYVA 4TT2A 4MR6A 4BHWA 4MENA 5EPRA 5ETDA 4CUQA 4J1PA 3MB3A 5AMEA 5FG4A 5KTUA 5HRXA 2KTBB 5EV9A 3U5LA 5DW2A 4QNSA 5HQ5A 4YYGA 5H1UA 4E96A 4YBMA 5H85A 5CUBA 4QC1A 3HMEA 5BT5A 4NRBA 4PS5A 4A9FA 5C89A 5DX4A 4KV1A 5HM0A 2YEKA 3P1FA 5CP5A 4QZSA 5J0DA 4NS5A 5LKZA 4QSTA 4PCEA 4HBXA 4UIWA 3MXFA 4UIXA 2DKWA 4MR5A 4CFKA 4TZ2A 5CUAA 4PKLA 4AKNA 5EWVA 5D26A 4NR7A 5F60A 4LDFA 4YH3A 4ZC9A 5LVQA 3JVJA 4IR4A 5CUDA 5E0RA 5FE6A 4N4HA 4YY6A 4CLBA 3LQJA 2YYNA 5DKDA 5FBXA 3O35A 5CQ8A 5I40A 3JVMA 4LC2A 3UVWA 5FE4A 4MEOA 3FKMX 5II1A 4ALHA 5F5ZA 4QSRA 5D3PA 5EI4A 5A83A 4UYHA 5EISA 5G4RA 3P1EA 2H60A 2OO1A 3U5JA 3JVLA 4NYXA 4A9EA 5EPBA 5I89A 3MQMA 4LR6A 5L98A 4YYDA 4OUFA 4O77A 4A9MA 5KO4A 5FE9A 2DVQA 4TTEA 4HXLA 4HXMA 5C4QA 4HBWA 5D3RA 5HRWA 5EWHA 4Z1QA 1N72A 4IOQA 2DVVA 4A9NA 4MR4A 5C8GA 2WP1A 4N4GA 4LYWA 5HQ6A 4IR5A 4QB3A 5FDZA 3LXJA 5E9LA 4O7FA 3S92A 5CGPA 5E3DA 2DVSA 5LKTA 3LQHA 4O72A 5DLXA 4Z93A 3AADA 4IR3A 5D25A 4CUSA 4TYLA 4YBSA 5D3TA 5CQ7A 5E9VA 5CU8A 5DKCA 4A9HA 3UV5A 5CUCA 4A9JA 5I88A 4LYIA 2YEMA 4BW1A 2L5EA 5HQ7A 5EICA 4UIYA 5EWDA 5FH8A 4CFLA 5IG6A 4N4FA 3QZVA 5E73A 5CQAA 3HMFA 3Q2EA 4QUUA 4UYEA 5CRMA 4BW3A 5DYXA 5A5RA 4YYIA 5A5OA 4QSVA 5DFDA 4KCXA 5A5NA 5A7CA 5HLSA 4HBVA 4J3IA 4PY6A 5KHMA 3SVHA 4PCIA 4C66A 4QSUA 5ENCA 3SVFA 3QZTA 2RNXA 3TLPA 5II2A 3P1CA 5D3SA 2L85A 5H1VA 4NUEA 4LZ2A 2YQDA 5A5QA 5L97A 4FLPA 4QR4A 5LJ1A 4XY8A 5EQ1A 3NXBA 5CZGA 5EK9A 5D24A 5A5SA 4YYNA 5TCMA 2F6NA 5C85A 5D7XA 5FH6A 2R0VA 5CPEA 3MB4A 5C7NA 4WIVA 4QC3A 4NUDA 4UIUA 5F61A 5EM3A 5F2PA 4TQNA 2F6JA 3HMHA 3P5OA 5EU1A 4LZRA 4O70A 4TT6A 4CUPA 5CS8A 4IR6A 4NUCA 4MEQA 4QSPA 4TZ8A 4BW2A 4X2IA 2RFJA 4QR5A 5DY7A 4CUUA 4GPJA 2RNWA 4J0RA 5E7DA 5TB6A 5D0CA 3G0JA 4QY4A 4YADA 4OGJA 3DWYA 5DYCA 5F62A 4A9LA 5LKXA 4IOOA 4YYHA 4XYAA 5CTLA 5A82A 4Q0OA 2YELA 4PTBA 4O7EA 5ENIA 4NXJA 5CUGA 4A9KA 4MEPA 4Z6IA 4QYLA 3UV2A 5CFWA 2RI7A 1WUGA 5CQ3A 5CQ5A 5FG5A 4TT4A 4XY9A 3O34A 5FH7A 4TU4A 4UYFA 3IU5A 4NR6A 5FE2A 4LRGA 4QSQA 3UW9A 3I3JA 2RS9B 3UVYA 2LSPB 5KTXA 5D3NA 5FE7A 5FB0A 5JWMA 4HXSA 4QEUA 5IIDA 4UYFB 4CL9A 5DFBA 5ENBA 4NRAA 4QBMA 4QSWA 3S91A 5BT4A 4UYDA 5CY9A 3MUKA 3UVXA 5HELA 5LJ2A 5I80A 5FG6A 2RNYA 4NQMA
chains in the Genus database with same CATH superfamily
2N9GA 5FE3A 5BT3A 5EVAA 3U5MA 4UIZA 4HXNA 5DFCA 1ZS5A 4ZW1A 4OGIA 5IGLA 2R0YA 5EWCA 5F1LA 4AKIA 5COIA 4J0SA 3IU6A 5LKUA 5I7YA 5FFYA 5ENFA 4YABA 3U5NA 4F3IA 5KU3A 4QUTA 5CQTA 5EPSA 5DKHA 2EJNA 3JVKA 5DBMA 5FFWA 4UYGA 4NQNA 2E3KA 5IBNA 4QSSA 5D3LA 5HFQA 4RVRA 5HFRA 4QR3A 5L96A 5I83A 4YATA 4A9IA 3O36A 3LJWA 4KV4A 5FFVA 4O76A 5K29A 5HJCA 3GG3A 5ENJA 1X0JA 4HXKA 3U5KA 4NYWA 5IGKA 2D82A 4CURA 4HBYA 4Q0NA 4QEVA 5DYAA 2RO1A 5CQ4A 4YBTA 2R10A 4NR8A 5E9YA 5I86A 5CUEA 5AMFA 3O37A 2OUOA 2DWWA 4N4IA 4YH4A 2MJVB 4O7BA 2FSAA 2DVRA 2YDWA 4XUAA 4UIVA 3U5OA 3O33A 4LYSA 5E3GA 1EQFA 2R0SA 2WP2A 3ONIA 3UVDA 3RCWA 3DAIA 5G4SA 5D3HA 4CUTA 5EP7A 2DATA 5EGUA 4DONA 4O78A 4HXOA 5HRVA 5IGNA 5L8TA 2E7NA 5LUUA 4HXPA 5A81A 4A9OA 1WUMA 5E74A 4O74A 4Y03A 4O7AA 4BJXA 5AD2A 3MULA 4NR5A 4WHUA 2YW5A 5HEMA 4UITA 5FE8A 2I8NA 2G4AA 5JI8A 5H1TA 4YYJA 4TU6A 3ZYUA 4NR4A 4LZSA 5C87A 1E6IA 3ERRA 5ENGA 5HCLA 5CRZA 4IORA 3LQIA 3P1DA 5HENA 2I7KA 5ENHA 5F63A 4QYDA 4O7CA 5ETBA 5FE0A 3UV4A 4N3WA 5DLZA 4AKHA 4YYKA 5LJ0A 5F25A 2E7OA 3SVGA 3AQAA 2D9EA 5I29A 5E9IA 4ZQLA 3D7CA 2NXBA 5E9KA 5F3AA 4TS8A 5AD3A 5DYUA 5I7XA 4YC9A 5I1QA 5L8UA 3Q2FA 4XUBA 4YAXA 3U5PA 4YY4A 5L99A 1JSPB 5CQ6A 4WHWA 5A5PA 1F68A 5D3JA 4YYMA 5KTWA 5A85A 5ENEA 4BW4A 4O71A 1JM4B 5F36A 5EA1A 5FB1A 4NRCA 3QZSA 2OSSA 4NR9A 5FE5A 4HXRA 5DW1A 5F1HA 4Z6HA 5IGMA 5EWWA 5LVRA 4MR3A 3G0LA 4ALGA 5FE1A 4QEWA 2L84A 2GRCA 5E9MA 4YK0A 4QSXA 4C67A 3K2JA 4Z1SA 5ACYA 4O75A 4NYVA 4TT2A 4MR6A 4BHWA 4MENA 5EPRA 5ETDA 4CUQA 4J1PA 3MB3A 5AMEA 5FG4A 5KTUA 5HRXA 2KTBB 5EV9A 3U5LA 5DW2A 4QNSA 5HQ5A 4YYGA 5H1UA 4E96A 4YBMA 5H85A 5CUBA 4QC1A 3HMEA 5BT5A 4NRBA 4PS5A 4A9FA 5C89A 5DX4A 4KV1A 4AKGA 5HM0A 2YEKA 3P1FA 5CP5A 4QZSA 5J0DA 4NS5A 5LKZA 4QSTA 4PCEA 4HBXA 4UIWA 3MXFA 4UIXA 2DKWA 4MR5A 4CFKA 4TZ2A 5CUAA 4PKLA 4AKNA 5EWVA 5D26A 4NR7A 5F60A 4LDFA 4YH3A 4ZC9A 5LVQA 3JVJA 4IR4A 5CUDA 5E0RA 5FE6A 4N4HA 4YY6A 4CLBA 3LQJA 2YYNA 5DKDA 5FBXA 3O35A 5CQ8A 5I40A 3JVMA 4LC2A 3UVWA 5FE4A 4MEOA 3FKMX 5II1A 4ALHA 5F5ZA 4QSRA 5D3PA 5EI4A 5A83A 4UYHA 5EISA 5G4RA 3P1EA 2H60A 2OO1A 3U5JA 3JVLA 4NYXA 4A9EA 5EPBA 5I89A 3MQMA 4LR6A 4AI6A 5L98A 4YYDA 4OUFA 4O77A 4A9MA 5KO4A 5FE9A 2DVQA 4TTEA 4HXLA 4HXMA 5C4QA 4HBWA 5D3RA 5HRWA 5EWHA 4Z1QA 1N72A 4IOQA 2DVVA 4A9NA 4MR4A 5C8GA 2WP1A 4N4GA 4LYWA 5HQ6A 4IR5A 4QB3A 5FDZA 3LXJA 5E9LA 4O7FA 3S92A 5CGPA 5E3DA 2DVSA 5LKTA 3VKGA 3LQHA 4O72A 5DLXA 4Z93A 3AADA 4IR3A 5D25A 4CUSA 4TYLA 4YBSA 5D3TA 5CQ7A 5E9VA 5CU8A 5DKCA 4A9HA 3UV5A 5CUCA 4A9JA 5I88A 4LYIA 2YEMA 4BW1A 2L5EA 5HQ7A 5EICA 4UIYA 5EWDA 5FH8A 4CFLA 5IG6A 4N4FA 3QZVA 5E73A 5CQAA 3HMFA 3Q2EA 4QUUA 4UYEA 5CRMA 4BW3A 5DYXA 5A5RA 4YYIA 5A5OA 4QSVA 5DFDA 4KCXA 5A5NA 5A7CA 5HLSA 4HBVA 4J3IA 4PY6A 5KHMA 3SVHA 4PCIA 4C66A 4QSUA 3VKHA 5ENCA 3SVFA 3QZTA 2RNXA 3TLPA 5II2A 3P1CA 5D3SA 2L85A 5H1VA 4NUEA 4LZ2A 2YQDA 3D1DA 5L97A 5A5QA 4FLPA 3D1BA 4QR4A 5LJ1A 4XY8A 5EQ1A 3NXBA 5CZGA 5EK9A 5D24A 5A5SA 4YYNA 5TCMA 2F6NA 5C85A 5D7XA 5FH6A 2R0VA 5CPEA 3MB4A 5C7NA 4WIVA 4QC3A 4NUDA 4UIUA 5F61A 5EM3A 5F2PA 4TQNA 2F6JA 3HMHA 3P5OA 5EU1A 4LZRA 4O70A 4TT6A 4CUPA 5CS8A 4IR6A 4NUCA 4MEQA 4QSPA 4TZ8A 4BW2A 4X2IA 2RFJA 4QR5A 5DY7A 4CUUA 4GPJA 2RNWA 4J0RA 5E7DA 5TB6A 5D0CA 3G0JA 4QY4A 4YADA 4OGJA 3DWYA 5DYCA 5F62A 1PUOA 4A9LA 5LKXA 4IOOA 4YYHA 4XYAA 1ZKRA 5CTLA 5A82A 4Q0OA 2YELA 4PTBA 4O7EA 5ENIA 4NXJA 5CUGA 4A9KA 4MEPA 4Z6IA 4QYLA 3UV2A 5CFWA 2RI7A 1WUGA 5CQ3A 5CQ5A 5FG5A 4TT4A 4XY9A 3O34A 5FH7A 4TU4A 4UYFA 3IU5A 4NR6A 5FE2A 4LRGA 4QSQA 3UW9A 3I3JA 2RS9B 3UVYA 2LSPB 5KTXA 5D3NA 5FE7A 5FB0A 5JWMA 4HXSA 4QEUA 5IIDA 4UYFB 4CL9A 5DFBA 5ENBA 4NRAA 4QBMA 4QSWA 3S91A 5BT4A 4UYDA 5CY9A 3MUKA 3UVXA 5HELA 5LJ2A 5I80A 5FG6A 2RNYA 4NQMA
chains in the Genus database with same CATH topology
2N9GA 5FE3A 5BT3A 5EVAA 3U5MA 4UIZA 4HXNA 5DFCA 1ZS5A 4ZW1A 4OGIA 5IGLA 2R0YA 5EWCA 5F1LA 5COIA 4J0SA 3IU6A 5LKUA 5I7YA 5FFYA 5ENFA 4YABA 3U5NA 4F3IA 5KU3A 4QUTA 5CQTA 5EPSA 5DKHA 3JVKA 5DBMA 5FFWA 4UYGA 4NQNA 2E3KA 5IBNA 4QSSA 5D3LA 5HFQA 4RVRA 5HFRA 4QR3A 5L96A 5I83A 4YATA 4A9IA 3O36A 3LJWA 4KV4A 5FFVA 4O76A 5K29A 5HJCA 3GG3A 5ENJA 1X0JA 4HXKA 3U5KA 4NYWA 5IGKA 2D82A 4CURA 4HBYA 4Q0NA 4QEVA 5DYAA 2RO1A 5CQ4A 4YBTA 2R10A 4NR8A 5E9YA 5I86A 5CUEA 5AMFA 3O37A 2OUOA 2DWWA 4N4IA 4YH4A 2MJVB 4O7BA 2FSAA 2DVRA 2YDWA 4XUAA 4UIVA 3U5OA 3O33A 4LYSA 5E3GA 1EQFA 2R0SA 2WP2A 3ONIA 3UVDA 3RCWA 3DAIA 5G4SA 5D3HA 4CUTA 5EP7A 2DATA 5EGUA 4DONA 4O78A 4HXOA 5HRVA 5IGNA 5L8TA 2E7NA 5LUUA 4HXPA 5A81A 4A9OA 1WUMA 5E74A 4O74A 4Y03A 4O7AA 4BJXA 5AD2A 3MULA 4NR5A 4WHUA 2YW5A 5HEMA 4UITA 5FE8A 2I8NA 2G4AA 5JI8A 5H1TA 4YYJA 4TU6A 3ZYUA 4NR4A 4LZSA 5C87A 1E6IA 5HCLA 5ENGA 5CRZA 4IORA 3LQIA 3P1DA 5HENA 2I7KA 5ENHA 5F63A 4QYDA 4O7CA 5ETBA 5FE0A 3UV4A 4N3WA 5DLZA 4YYKA 5LJ0A 5F25A 2E7OA 3SVGA 3AQAA 2D9EA 5I29A 5E9IA 4ZQLA 3D7CA 2NXBA 5E9KA 5F3AA 4TS8A 5AD3A 5DYUA 5I7XA 4YC9A 5I1QA 5L8UA 3Q2FA 4XUBA 4YAXA 3U5PA 4YY4A 5L99A 1JSPB 5CQ6A 4WHWA 5A5PA 1F68A 5D3JA 4YYMA 5KTWA 5A85A 5ENEA 4BW4A 4O71A 1JM4B 5F36A 5EA1A 5FB1A 4NRCA 3QZSA 2OSSA 4NR9A 5FE5A 4HXRA 5DW1A 5F1HA 4Z6HA 5IGMA 5EWWA 5LVRA 4MR3A 3G0LA 4ALGA 5FE1A 4QEWA 2L84A 2GRCA 5E9MA 4YK0A 4QSXA 4C67A 3K2JA 4Z1SA 5ACYA 4O75A 4NYVA 4TT2A 4MR6A 4BHWA 4MENA 5EPRA 5ETDA 4CUQA 4J1PA 3MB3A 5AMEA 5FG4A 5KTUA 5HRXA 2KTBB 5EV9A 3U5LA 5DW2A 4QNSA 5HQ5A 4YYGA 5H1UA 4E96A 4YBMA 5H85A 5CUBA 4QC1A 3HMEA 5BT5A 4NRBA 4PS5A 4A9FA 5C89A 5DX4A 4KV1A 5HM0A 2YEKA 3P1FA 5CP5A 4QZSA 5J0DA 4NS5A 5LKZA 4QSTA 4PCEA 4HBXA 4UIWA 3MXFA 4UIXA 2DKWA 4MR5A 4CFKA 4TZ2A 5CUAA 4PKLA 4AKNA 5EWVA 5D26A 4NR7A 5F60A 4LDFA 4YH3A 4ZC9A 5LVQA 3JVJA 4IR4A 5CUDA 5E0RA 5FE6A 4N4HA 4YY6A 4CLBA 3LQJA 2YYNA 5DKDA 5FBXA 3O35A 5CQ8A 5I40A 3JVMA 4LC2A 3UVWA 5FE4A 4MEOA 3FKMX 5II1A 4ALHA 5F5ZA 4QSRA 5D3PA 5EI4A 5A83A 4UYHA 5EISA 5G4RA 3P1EA 2H60A 2OO1A 3U5JA 3JVLA 4NYXA 4A9EA 5EPBA 5I89A 3MQMA 4LR6A 5L98A 4YYDA 4OUFA 4O77A 4A9MA 5KO4A 5FE9A 2DVQA 4TTEA 4HXLA 4HXMA 5C4QA 4HBWA 5D3RA 5HRWA 5EWHA 4Z1QA 1N72A 4IOQA 2DVVA 4A9NA 4MR4A 5C8GA 2WP1A 4N4GA 4LYWA 5HQ6A 4IR5A 4QB3A 5FDZA 3LXJA 5E9LA 4O7FA 3S92A 5CGPA 5E3DA 2DVSA 5LKTA 3LQHA 4O72A 5DLXA 4Z93A 3AADA 4IR3A 5D25A 4CUSA 4TYLA 4YBSA 5D3TA 5CQ7A 5E9VA 5CU8A 5DKCA 4A9HA 3UV5A 5CUCA 4A9JA 5I88A 4LYIA 2YEMA 4BW1A 2L5EA 5HQ7A 5EICA 4UIYA 5EWDA 5FH8A 4CFLA 5IG6A 4N4FA 3QZVA 5E73A 5CQAA 3HMFA 3Q2EA 4QUUA 4UYEA 5CRMA 4BW3A 5DYXA 5A5RA 4YYIA 5A5OA 4QSVA 5DFDA 4KCXA 5A5NA 5A7CA 5HLSA 4HBVA 4J3IA 4PY6A 5KHMA 3SVHA 4PCIA 4C66A 4QSUA 5ENCA 3SVFA 3QZTA 2RNXA 3TLPA 5II2A 3P1CA 5D3SA 2L85A 5H1VA 4NUEA 4LZ2A 2YQDA 5A5QA 5L97A 4FLPA 4QR4A 5LJ1A 4XY8A 5EQ1A 3NXBA 5CZGA 5EK9A 5D24A 5A5SA 4YYNA 5TCMA 2F6NA 5C85A 5D7XA 5FH6A 2R0VA 5CPEA 3MB4A 5C7NA 4WIVA 4QC3A 4NUDA 4UIUA 5F61A 5EM3A 5F2PA 4TQNA 2F6JA 3HMHA 3P5OA 5EU1A 4LZRA 4O70A 4TT6A 4CUPA 5CS8A 4IR6A 4NUCA 4MEQA 4QSPA 4TZ8A 4BW2A 4X2IA 2RFJA 4QR5A 5DY7A 4CUUA 4GPJA 2RNWA 4J0RA 5E7DA 5TB6A 5D0CA 3G0JA 4QY4A 4YADA 4OGJA 3DWYA 5DYCA 5F62A 4A9LA 5LKXA 4IOOA 4YYHA 4XYAA 5CTLA 5A82A 4Q0OA 2YELA 4PTBA 4O7EA 5ENIA 4NXJA 5CUGA 4A9KA 4MEPA 4Z6IA 4QYLA 3UV2A 5CFWA 2RI7A 1WUGA 5CQ3A 5CQ5A 5FG5A 4TT4A 4XY9A 3O34A 5FH7A 4TU4A 4UYFA 3IU5A 4NR6A 5FE2A 4LRGA 4QSQA 3UW9A 3I3JA 2RS9B 3UVYA 2LSPB 5KTXA 5D3NA 5FE7A 5FB0A 5JWMA 4HXSA 4QEUA 5IIDA 4UYFB 4CL9A 5DFBA 5ENBA 4NRAA 4QBMA 4QSWA 3S91A 5BT4A 4UYDA 5CY9A 3MUKA 3UVXA 5HELA 5LJ2A 5I80A 5FG6A 2RNYA 4NQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9G A;  5FE3 A;  5BT3 A;  5EVA A;  3U5M A;  4UIZ A;  4HXN A;  5DFC A;  1ZS5 A;  4ZW1 A;  4OGI A;  5IGL A;  2R0Y A;  5EWC A;  5F1L A;  5COI A;  4J0S A;  3IU6 A;  5LKU A;  5I7Y A;  5FFY A;  5ENF A;  4YAB A;  3U5N A;  4F3I A;  5KU3 A;  4QUT A;  5CQT A;  5EPS A;  5DKH A;  3JVK A;  5DBM A;  5FFW A;  4UYG A;  4NQN A;  2E3K A;  5IBN A;  4QSS A;  5D3L A;  5HFQ A;  4RVR A;  5HFR A;  4QR3 A;  5L96 A;  5I83 A;  4YAT A;  4A9I A;  3O36 A;  3LJW A;  4KV4 A;  5FFV A;  4O76 A;  5K29 A;  5HJC A;  3GG3 A;  5ENJ A;  1X0J A;  4HXK A;  3U5K A;  4NYW A;  5IGK A;  2D82 A;  4CUR A;  4HBY A;  4Q0N A;  4QEV A;  5DYA A;  2RO1 A;  5CQ4 A;  4YBT A;  2R10 A;  4NR8 A;  5E9Y A;  5I86 A;  5CUE A;  5AMF A;  3O37 A;  2OUO A;  2DWW A;  4N4I A;  4YH4 A;  2MJV B;  4O7B A;  2FSA A;  2DVR A;  2YDW A;  4XUA A;  4UIV A;  3U5O A;  3O33 A;  4LYS A;  5E3G A;  1EQF A;  2R0S A;  2WP2 A;  3ONI A;  3UVD A;  3RCW A;  3DAI A;  5G4S A;  5D3H A;  4CUT A;  5EP7 A;  2DAT A;  5EGU A;  4DON A;  4O78 A;  4HXO A;  5HRV A;  5IGN A;  5L8T A;  2E7N A;  5LUU A;  4HXP A;  5A81 A;  4A9O A;  1WUM A;  5E74 A;  4O74 A;  4Y03 A;  4O7A A;  4BJX A;  5AD2 A;  3MUL A;  4NR5 A;  4WHU A;  2YW5 A;  5HEM A;  4UIT A;  5FE8 A;  2I8N A;  2G4A A;  5JI8 A;  5H1T A;  4YYJ A;  4TU6 A;  3ZYU A;  4NR4 A;  4LZS A;  5C87 A;  1E6I A;  5HCL A;  5ENG A;  5CRZ A;  4IOR A;  3LQI A;  3P1D A;  5HEN A;  2I7K A;  5ENH A;  5F63 A;  4QYD A;  4O7C A;  5ETB A;  5FE0 A;  3UV4 A;  4N3W A;  5DLZ A;  4YYK A;  5LJ0 A;  5F25 A;  2E7O A;  3SVG A;  3AQA A;  2D9E A;  5I29 A;  5E9I A;  4ZQL A;  3D7C A;  2NXB A;  5E9K A;  5F3A A;  4TS8 A;  5AD3 A;  5DYU A;  5I7X A;  4YC9 A;  5I1Q A;  5L8U A;  3Q2F A;  4XUB A;  4YAX A;  3U5P A;  4YY4 A;  5L99 A;  1JSP B;  5CQ6 A;  4WHW A;  5A5P A;  1F68 A;  5D3J A;  4YYM A;  5KTW A;  5A85 A;  5ENE A;  4BW4 A;  4O71 A;  1JM4 B;  5F36 A;  5EA1 A;  5FB1 A;  4NRC A;  3QZS A;  2OSS A;  4NR9 A;  5FE5 A;  4HXR A;  5DW1 A;  5F1H A;  4Z6H A;  5IGM A;  5EWW A;  5LVR A;  4MR3 A;  3G0L A;  4ALG A;  5FE1 A;  4QEW A;  2L84 A;  2GRC A;  5E9M A;  4YK0 A;  4QSX A;  4C67 A;  3K2J A;  4Z1S A;  5ACY A;  4O75 A;  4NYV A;  4TT2 A;  4MR6 A;  4BHW A;  4MEN A;  5EPR A;  5ETD A;  4CUQ A;  4J1P A;  3MB3 A;  5AME A;  5FG4 A;  5KTU A;  5HRX A;  2KTB B;  5EV9 A;  3U5L A;  5DW2 A;  4QNS A;  5HQ5 A;  4YYG A;  5H1U A;  4E96 A;  4YBM A;  5H85 A;  5CUB A;  4QC1 A;  3HME A;  5BT5 A;  4NRB A;  4PS5 A;  4A9F A;  5C89 A;  5DX4 A;  4KV1 A;  5HM0 A;  2YEK A;  3P1F A;  5CP5 A;  4QZS A;  5J0D A;  4NS5 A;  5LKZ A;  4QST A;  4PCE A;  4HBX A;  4UIW A;  3MXF A;  4UIX A;  2DKW A;  4MR5 A;  4CFK A;  4TZ2 A;  5CUA A;  4PKL A;  4AKN A;  5EWV A;  5D26 A;  4NR7 A;  5F60 A;  4LDF A;  4YH3 A;  4ZC9 A;  5LVQ A;  3JVJ A;  4IR4 A;  5CUD A;  5E0R A;  5FE6 A;  4N4H A;  4YY6 A;  4CLB A;  3LQJ A;  2YYN A;  5DKD A;  5FBX A;  3O35 A;  5CQ8 A;  5I40 A;  3JVM A;  4LC2 A;  3UVW A;  5FE4 A;  4MEO A;  3FKM X;  5II1 A;  4ALH A;  5F5Z A;  4QSR A;  5D3P A;  5EI4 A;  5A83 A;  4UYH A;  5EIS A;  5G4R A;  3P1E A;  2H60 A;  2OO1 A;  3U5J A;  3JVL A;  4NYX A;  4A9E A;  5EPB A;  5I89 A;  3MQM A;  4LR6 A;  5L98 A;  4YYD A;  4OUF A;  4O77 A;  4A9M A;  5KO4 A;  5FE9 A;  2DVQ A;  4TTE A;  4HXL A;  4HXM A;  5C4Q A;  4HBW A;  5D3R A;  5HRW A;  5EWH A;  4Z1Q A;  1N72 A;  4IOQ A;  2DVV A;  4A9N A;  4MR4 A;  5C8G A;  2WP1 A;  4N4G A;  4LYW A;  5HQ6 A;  4IR5 A;  4QB3 A;  5FDZ A;  3LXJ A;  5E9L A;  4O7F A;  3S92 A;  5CGP A;  5E3D A;  2DVS A;  5LKT A;  3LQH A;  4O72 A;  5DLX A;  4Z93 A;  3AAD A;  4IR3 A;  5D25 A;  4CUS A;  4TYL A;  4YBS A;  5D3T A;  5CQ7 A;  5E9V A;  5CU8 A;  5DKC A;  4A9H A;  3UV5 A;  5CUC A;  4A9J A;  5I88 A;  4LYI A;  2YEM A;  4BW1 A;  2L5E A;  5HQ7 A;  5EIC A;  4UIY A;  5EWD A;  5FH8 A;  4CFL A;  5IG6 A;  4N4F A;  3QZV A;  5E73 A;  5CQA A;  3HMF A;  3Q2E A;  4QUU A;  4UYE A;  5CRM A;  4BW3 A;  5DYX A;  5A5R A;  4YYI A;  5A5O A;  4QSV A;  5DFD A;  4KCX A;  5A5N A;  5A7C A;  5HLS A;  4HBV A;  4J3I A;  4PY6 A;  5KHM A;  3SVH A;  4PCI A;  4C66 A;  4QSU A;  5ENC A;  3SVF A;  3QZT A;  2RNX A;  3TLP A;  5II2 A;  3P1C A;  5D3S A;  2L85 A;  5H1V A;  4NUE A;  4LZ2 A;  2YQD A;  5A5Q A;  5L97 A;  4FLP A;  4QR4 A;  5LJ1 A;  4XY8 A;  5EQ1 A;  3NXB A;  5CZG A;  5EK9 A;  5D24 A;  5A5S A;  4YYN A;  5TCM A;  2F6N A;  5C85 A;  5D7X A;  5FH6 A;  2R0V A;  5CPE A;  3MB4 A;  5C7N A;  4WIV A;  4QC3 A;  4NUD A;  4UIU A;  5F61 A;  5EM3 A;  5F2P A;  4TQN A;  2F6J A;  3HMH A;  3P5O A;  5EU1 A;  4LZR A;  4O70 A;  4TT6 A;  4CUP A;  5CS8 A;  4IR6 A;  4NUC A;  4MEQ A;  4QSP A;  4TZ8 A;  4BW2 A;  4X2I A;  2RFJ A;  4QR5 A;  5DY7 A;  4CUU A;  4GPJ A;  2RNW A;  4J0R A;  5E7D A;  5TB6 A;  5D0C A;  3G0J A;  4QY4 A;  4YAD A;  4OGJ A;  3DWY A;  5DYC A;  5F62 A;  4A9L A;  5LKX A;  4IOO A;  4YYH A;  4XYA A;  5CTL A;  5A82 A;  4Q0O A;  2YEL A;  4PTB A;  4O7E A;  5ENI A;  4NXJ A;  5CUG A;  4A9K A;  4MEP A;  4Z6I A;  4QYL A;  3UV2 A;  5CFW A;  2RI7 A;  1WUG A;  5CQ3 A;  5CQ5 A;  5FG5 A;  4TT4 A;  4XY9 A;  3O34 A;  5FH7 A;  4TU4 A;  4UYF A;  3IU5 A;  4NR6 A;  5FE2 A;  4LRG A;  4QSQ A;  3UW9 A;  3I3J A;  2RS9 B;  3UVY A;  2LSP B;  5KTX A;  5D3N A;  5FE7 A;  5FB0 A;  5JWM A;  4HXS A;  4QEU A;  5IID A;  4UYF B;  4CL9 A;  5DFB A;  5ENB A;  4NRA A;  4QBM A;  4QSW A;  3S91 A;  5BT4 A;  4UYD A;  5CY9 A;  3MUK A;  3UVX A;  5HEL A;  5LJ2 A;  5I80 A;  5FG6 A;  2RNY A;  4NQM A; 
#chains in the Genus database with same CATH topology
 2N9G A;  5FE3 A;  5BT3 A;  5EVA A;  3U5M A;  4UIZ A;  4HXN A;  5DFC A;  1ZS5 A;  4ZW1 A;  4OGI A;  5IGL A;  2R0Y A;  5EWC A;  5F1L A;  4AKI A;  5COI A;  4J0S A;  3IU6 A;  5LKU A;  5I7Y A;  5FFY A;  5ENF A;  4YAB A;  3U5N A;  4F3I A;  5KU3 A;  4QUT A;  5CQT A;  5EPS A;  5DKH A;  2EJN A;  3JVK A;  5DBM A;  5FFW A;  4UYG A;  4NQN A;  2E3K A;  5IBN A;  4QSS A;  5D3L A;  5HFQ A;  4RVR A;  5HFR A;  4QR3 A;  5L96 A;  5I83 A;  4YAT A;  4A9I A;  3O36 A;  3LJW A;  4KV4 A;  5FFV A;  4O76 A;  5K29 A;  5HJC A;  3GG3 A;  5ENJ A;  1X0J A;  4HXK A;  3U5K A;  4NYW A;  5IGK A;  2D82 A;  4CUR A;  4HBY A;  4Q0N A;  4QEV A;  5DYA A;  2RO1 A;  5CQ4 A;  4YBT A;  2R10 A;  4NR8 A;  5E9Y A;  5I86 A;  5CUE A;  5AMF A;  3O37 A;  2OUO A;  2DWW A;  4N4I A;  4YH4 A;  2MJV B;  4O7B A;  2FSA A;  2DVR A;  2YDW A;  4XUA A;  4UIV A;  3U5O A;  3O33 A;  4LYS A;  5E3G A;  1EQF A;  2R0S A;  2WP2 A;  3ONI A;  3UVD A;  3RCW A;  3DAI A;  5G4S A;  5D3H A;  4CUT A;  5EP7 A;  2DAT A;  5EGU A;  4DON A;  4O78 A;  4HXO A;  5HRV A;  5IGN A;  5L8T A;  2E7N A;  5LUU A;  4HXP A;  5A81 A;  4A9O A;  1WUM A;  5E74 A;  4O74 A;  4Y03 A;  4O7A A;  4BJX A;  5AD2 A;  3MUL A;  4NR5 A;  4WHU A;  2YW5 A;  5HEM A;  4UIT A;  5FE8 A;  2I8N A;  2G4A A;  5JI8 A;  5H1T A;  4YYJ A;  4TU6 A;  3ZYU A;  4NR4 A;  4LZS A;  5C87 A;  1E6I A;  3ERR A;  5ENG A;  5HCL A;  5CRZ A;  4IOR A;  3LQI A;  3P1D A;  5HEN A;  2I7K A;  5ENH A;  5F63 A;  4QYD A;  4O7C A;  5ETB A;  5FE0 A;  3UV4 A;  4N3W A;  5DLZ A;  4AKH A;  4YYK A;  5LJ0 A;  5F25 A;  2E7O A;  3SVG A;  3AQA A;  2D9E A;  5I29 A;  5E9I A;  4ZQL A;  3D7C A;  2NXB A;  5E9K A;  5F3A A;  4TS8 A;  5AD3 A;  5DYU A;  5I7X A;  4YC9 A;  5I1Q A;  5L8U A;  3Q2F A;  4XUB A;  4YAX A;  3U5P A;  4YY4 A;  5L99 A;  1JSP B;  5CQ6 A;  4WHW A;  5A5P A;  1F68 A;  5D3J A;  4YYM A;  5KTW A;  5A85 A;  5ENE A;  4BW4 A;  4O71 A;  1JM4 B;  5F36 A;  5EA1 A;  5FB1 A;  4NRC A;  3QZS A;  2OSS A;  4NR9 A;  5FE5 A;  4HXR A;  5DW1 A;  5F1H A;  4Z6H A;  5IGM A;  5EWW A;  5LVR A;  4MR3 A;  3G0L A;  4ALG A;  5FE1 A;  4QEW A;  2L84 A;  2GRC A;  5E9M A;  4YK0 A;  4QSX A;  4C67 A;  3K2J A;  4Z1S A;  5ACY A;  4O75 A;  4NYV A;  4TT2 A;  4MR6 A;  4BHW A;  4MEN A;  5EPR A;  5ETD A;  4CUQ A;  4J1P A;  3MB3 A;  5AME A;  5FG4 A;  5KTU A;  5HRX A;  2KTB B;  5EV9 A;  3U5L A;  5DW2 A;  4QNS A;  5HQ5 A;  4YYG A;  5H1U A;  4E96 A;  4YBM A;  5H85 A;  5CUB A;  4QC1 A;  3HME A;  5BT5 A;  4NRB A;  4PS5 A;  4A9F A;  5C89 A;  5DX4 A;  4KV1 A;  4AKG A;  5HM0 A;  2YEK A;  3P1F A;  5CP5 A;  4QZS A;  5J0D A;  4NS5 A;  5LKZ A;  4QST A;  4PCE A;  4HBX A;  4UIW A;  3MXF A;  4UIX A;  2DKW A;  4MR5 A;  4CFK A;  4TZ2 A;  5CUA A;  4PKL A;  4AKN A;  5EWV A;  5D26 A;  4NR7 A;  5F60 A;  4LDF A;  4YH3 A;  4ZC9 A;  5LVQ A;  3JVJ A;  4IR4 A;  5CUD A;  5E0R A;  5FE6 A;  4N4H A;  4YY6 A;  4CLB A;  3LQJ A;  2YYN A;  5DKD A;  5FBX A;  3O35 A;  5CQ8 A;  5I40 A;  3JVM A;  4LC2 A;  3UVW A;  5FE4 A;  4MEO A;  3FKM X;  5II1 A;  4ALH A;  5F5Z A;  4QSR A;  5D3P A;  5EI4 A;  5A83 A;  4UYH A;  5EIS A;  5G4R A;  3P1E A;  2H60 A;  2OO1 A;  3U5J A;  3JVL A;  4NYX A;  4A9E A;  5EPB A;  5I89 A;  3MQM A;  4LR6 A;  4AI6 A;  5L98 A;  4YYD A;  4OUF A;  4O77 A;  4A9M A;  5KO4 A;  5FE9 A;  2DVQ A;  4TTE A;  4HXL A;  4HXM A;  5C4Q A;  4HBW A;  5D3R A;  5HRW A;  5EWH A;  4Z1Q A;  1N72 A;  4IOQ A;  2DVV A;  4A9N A;  4MR4 A;  5C8G A;  2WP1 A;  4N4G A;  4LYW A;  5HQ6 A;  4IR5 A;  4QB3 A;  5FDZ A;  3LXJ A;  5E9L A;  4O7F A;  3S92 A;  5CGP A;  5E3D A;  2DVS A;  5LKT A;  3VKG A;  3LQH A;  4O72 A;  5DLX A;  4Z93 A;  3AAD A;  4IR3 A;  5D25 A;  4CUS A;  4TYL A;  4YBS A;  5D3T A;  5CQ7 A;  5E9V A;  5CU8 A;  5DKC A;  4A9H A;  3UV5 A;  5CUC A;  4A9J A;  5I88 A;  4LYI A;  2YEM A;  4BW1 A;  2L5E A;  5HQ7 A;  5EIC A;  4UIY A;  5EWD A;  5FH8 A;  4CFL A;  5IG6 A;  4N4F A;  3QZV A;  5E73 A;  5CQA A;  3HMF A;  3Q2E A;  4QUU A;  4UYE A;  5CRM A;  4BW3 A;  5DYX A;  5A5R A;  4YYI A;  5A5O A;  4QSV A;  5DFD A;  4KCX A;  5A5N A;  5A7C A;  5HLS A;  4HBV A;  4J3I A;  4PY6 A;  5KHM A;  3SVH A;  4PCI A;  4C66 A;  4QSU A;  3VKH A;  5ENC A;  3SVF A;  3QZT A;  2RNX A;  3TLP A;  5II2 A;  3P1C A;  5D3S A;  2L85 A;  5H1V A;  4NUE A;  4LZ2 A;  2YQD A;  3D1D A;  5L97 A;  5A5Q A;  4FLP A;  3D1B A;  4QR4 A;  5LJ1 A;  4XY8 A;  5EQ1 A;  3NXB A;  5CZG A;  5EK9 A;  5D24 A;  5A5S A;  4YYN A;  5TCM A;  2F6N A;  5C85 A;  5D7X A;  5FH6 A;  2R0V A;  5CPE A;  3MB4 A;  5C7N A;  4WIV A;  4QC3 A;  4NUD A;  4UIU A;  5F61 A;  5EM3 A;  5F2P A;  4TQN A;  2F6J A;  3HMH A;  3P5O A;  5EU1 A;  4LZR A;  4O70 A;  4TT6 A;  4CUP A;  5CS8 A;  4IR6 A;  4NUC A;  4MEQ A;  4QSP A;  4TZ8 A;  4BW2 A;  4X2I A;  2RFJ A;  4QR5 A;  5DY7 A;  4CUU A;  4GPJ A;  2RNW A;  4J0R A;  5E7D A;  5TB6 A;  5D0C A;  3G0J A;  4QY4 A;  4YAD A;  4OGJ A;  3DWY A;  5DYC A;  5F62 A;  1PUO A;  4A9L A;  5LKX A;  4IOO A;  4YYH A;  4XYA A;  1ZKR A;  5CTL A;  5A82 A;  4Q0O A;  2YEL A;  4PTB A;  4O7E A;  5ENI A;  4NXJ A;  5CUG A;  4A9K A;  4MEP A;  4Z6I A;  4QYL A;  3UV2 A;  5CFW A;  2RI7 A;  1WUG A;  5CQ3 A;  5CQ5 A;  5FG5 A;  4TT4 A;  4XY9 A;  3O34 A;  5FH7 A;  4TU4 A;  4UYF A;  3IU5 A;  4NR6 A;  5FE2 A;  4LRG A;  4QSQ A;  3UW9 A;  3I3J A;  2RS9 B;  3UVY A;  2LSP B;  5KTX A;  5D3N A;  5FE7 A;  5FB0 A;  5JWM A;  4HXS A;  4QEU A;  5IID A;  4UYF B;  4CL9 A;  5DFB A;  5ENB A;  4NRA A;  4QBM A;  4QSW A;  3S91 A;  5BT4 A;  4UYD A;  5CY9 A;  3MUK A;  3UVX A;  5HEL A;  5LJ2 A;  5I80 A;  5FG6 A;  2RNY A;  4NQM A; 
#chains in the Genus database with same CATH homology
 2N9G A;  5FE3 A;  5BT3 A;  5EVA A;  3U5M A;  4UIZ A;  4HXN A;  5DFC A;  1ZS5 A;  4ZW1 A;  4OGI A;  5IGL A;  2R0Y A;  5EWC A;  5F1L A;  5COI A;  4J0S A;  3IU6 A;  5LKU A;  5I7Y A;  5FFY A;  5ENF A;  4YAB A;  3U5N A;  4F3I A;  5KU3 A;  4QUT A;  5CQT A;  5EPS A;  5DKH A;  3JVK A;  5DBM A;  5FFW A;  4UYG A;  4NQN A;  2E3K A;  5IBN A;  4QSS A;  5D3L A;  5HFQ A;  4RVR A;  5HFR A;  4QR3 A;  5L96 A;  5I83 A;  4YAT A;  4A9I A;  3O36 A;  3LJW A;  4KV4 A;  5FFV A;  4O76 A;  5K29 A;  5HJC A;  3GG3 A;  5ENJ A;  1X0J A;  4HXK A;  3U5K A;  4NYW A;  5IGK A;  2D82 A;  4CUR A;  4HBY A;  4Q0N A;  4QEV A;  5DYA A;  2RO1 A;  5CQ4 A;  4YBT A;  2R10 A;  4NR8 A;  5E9Y A;  5I86 A;  5CUE A;  5AMF A;  3O37 A;  2OUO A;  2DWW A;  4N4I A;  4YH4 A;  2MJV B;  4O7B A;  2FSA A;  2DVR A;  2YDW A;  4XUA A;  4UIV A;  3U5O A;  3O33 A;  4LYS A;  5E3G A;  1EQF A;  2R0S A;  2WP2 A;  3ONI A;  3UVD A;  3RCW A;  3DAI A;  5G4S A;  5D3H A;  4CUT A;  5EP7 A;  2DAT A;  5EGU A;  4DON A;  4O78 A;  4HXO A;  5HRV A;  5IGN A;  5L8T A;  2E7N A;  5LUU A;  4HXP A;  5A81 A;  4A9O A;  1WUM A;  5E74 A;  4O74 A;  4Y03 A;  4O7A A;  4BJX A;  5AD2 A;  3MUL A;  4NR5 A;  4WHU A;  2YW5 A;  5HEM A;  4UIT A;  5FE8 A;  2I8N A;  2G4A A;  5JI8 A;  5H1T A;  4YYJ A;  4TU6 A;  3ZYU A;  4NR4 A;  4LZS A;  5C87 A;  1E6I A;  5HCL A;  5ENG A;  5CRZ A;  4IOR A;  3LQI A;  3P1D A;  5HEN A;  2I7K A;  5ENH A;  5F63 A;  4QYD A;  4O7C A;  5ETB A;  5FE0 A;  3UV4 A;  4N3W A;  5DLZ A;  4YYK A;  5LJ0 A;  5F25 A;  2E7O A;  3SVG A;  3AQA A;  2D9E A;  5I29 A;  5E9I A;  4ZQL A;  3D7C A;  2NXB A;  5E9K A;  5F3A A;  4TS8 A;  5AD3 A;  5DYU A;  5I7X A;  4YC9 A;  5I1Q A;  5L8U A;  3Q2F A;  4XUB A;  4YAX A;  3U5P A;  4YY4 A;  5L99 A;  1JSP B;  5CQ6 A;  4WHW A;  5A5P A;  1F68 A;  5D3J A;  4YYM A;  5KTW A;  5A85 A;  5ENE A;  4BW4 A;  4O71 A;  1JM4 B;  5F36 A;  5EA1 A;  5FB1 A;  4NRC A;  3QZS A;  2OSS A;  4NR9 A;  5FE5 A;  4HXR A;  5DW1 A;  5F1H A;  4Z6H A;  5IGM A;  5EWW A;  5LVR A;  4MR3 A;  3G0L A;  4ALG A;  5FE1 A;  4QEW A;  2L84 A;  2GRC A;  5E9M A;  4YK0 A;  4QSX A;  4C67 A;  3K2J A;  4Z1S A;  5ACY A;  4O75 A;  4NYV A;  4TT2 A;  4MR6 A;  4BHW A;  4MEN A;  5EPR A;  5ETD A;  4CUQ A;  4J1P A;  3MB3 A;  5AME A;  5FG4 A;  5KTU A;  5HRX A;  2KTB B;  5EV9 A;  3U5L A;  5DW2 A;  4QNS A;  5HQ5 A;  4YYG A;  5H1U A;  4E96 A;  4YBM A;  5H85 A;  5CUB A;  4QC1 A;  3HME A;  5BT5 A;  4NRB A;  4PS5 A;  4A9F A;  5C89 A;  5DX4 A;  4KV1 A;  5HM0 A;  2YEK A;  3P1F A;  5CP5 A;  4QZS A;  5J0D A;  4NS5 A;  5LKZ A;  4QST A;  4PCE A;  4HBX A;  4UIW A;  3MXF A;  4UIX A;  2DKW A;  4MR5 A;  4CFK A;  4TZ2 A;  5CUA A;  4PKL A;  4AKN A;  5EWV A;  5D26 A;  4NR7 A;  5F60 A;  4LDF A;  4YH3 A;  4ZC9 A;  5LVQ A;  3JVJ A;  4IR4 A;  5CUD A;  5E0R A;  5FE6 A;  4N4H A;  4YY6 A;  4CLB A;  3LQJ A;  2YYN A;  5DKD A;  5FBX A;  3O35 A;  5CQ8 A;  5I40 A;  3JVM A;  4LC2 A;  3UVW A;  5FE4 A;  4MEO A;  3FKM X;  5II1 A;  4ALH A;  5F5Z A;  4QSR A;  5D3P A;  5EI4 A;  5A83 A;  4UYH A;  5EIS A;  5G4R A;  3P1E A;  2H60 A;  2OO1 A;  3U5J A;  3JVL A;  4NYX A;  4A9E A;  5EPB A;  5I89 A;  3MQM A;  4LR6 A;  5L98 A;  4YYD A;  4OUF A;  4O77 A;  4A9M A;  5KO4 A;  5FE9 A;  2DVQ A;  4TTE A;  4HXL A;  4HXM A;  5C4Q A;  4HBW A;  5D3R A;  5HRW A;  5EWH A;  4Z1Q A;  1N72 A;  4IOQ A;  2DVV A;  4A9N A;  4MR4 A;  5C8G A;  2WP1 A;  4N4G A;  4LYW A;  5HQ6 A;  4IR5 A;  4QB3 A;  5FDZ A;  3LXJ A;  5E9L A;  4O7F A;  3S92 A;  5CGP A;  5E3D A;  2DVS A;  5LKT A;  3LQH A;  4O72 A;  5DLX A;  4Z93 A;  3AAD A;  4IR3 A;  5D25 A;  4CUS A;  4TYL A;  4YBS A;  5D3T A;  5CQ7 A;  5E9V A;  5CU8 A;  5DKC A;  4A9H A;  3UV5 A;  5CUC A;  4A9J A;  5I88 A;  4LYI A;  2YEM A;  4BW1 A;  2L5E A;  5HQ7 A;  5EIC A;  4UIY A;  5EWD A;  5FH8 A;  4CFL A;  5IG6 A;  4N4F A;  3QZV A;  5E73 A;  5CQA A;  3HMF A;  3Q2E A;  4QUU A;  4UYE A;  5CRM A;  4BW3 A;  5DYX A;  5A5R A;  4YYI A;  5A5O A;  4QSV A;  5DFD A;  4KCX A;  5A5N A;  5A7C A;  5HLS A;  4HBV A;  4J3I A;  4PY6 A;  5KHM A;  3SVH A;  4PCI A;  4C66 A;  4QSU A;  5ENC A;  3SVF A;  3QZT A;  2RNX A;  3TLP A;  5II2 A;  3P1C A;  5D3S A;  2L85 A;  5H1V A;  4NUE A;  4LZ2 A;  2YQD A;  5A5Q A;  5L97 A;  4FLP A;  4QR4 A;  5LJ1 A;  4XY8 A;  5EQ1 A;  3NXB A;  5CZG A;  5EK9 A;  5D24 A;  5A5S A;  4YYN A;  5TCM A;  2F6N A;  5C85 A;  5D7X A;  5FH6 A;  2R0V A;  5CPE A;  3MB4 A;  5C7N A;  4WIV A;  4QC3 A;  4NUD A;  4UIU A;  5F61 A;  5EM3 A;  5F2P A;  4TQN A;  2F6J A;  3HMH A;  3P5O A;  5EU1 A;  4LZR A;  4O70 A;  4TT6 A;  4CUP A;  5CS8 A;  4IR6 A;  4NUC A;  4MEQ A;  4QSP A;  4TZ8 A;  4BW2 A;  4X2I A;  2RFJ A;  4QR5 A;  5DY7 A;  4CUU A;  4GPJ A;  2RNW A;  4J0R A;  5E7D A;  5TB6 A;  5D0C A;  3G0J A;  4QY4 A;  4YAD A;  4OGJ A;  3DWY A;  5DYC A;  5F62 A;  4A9L A;  5LKX A;  4IOO A;  4YYH A;  4XYA A;  5CTL A;  5A82 A;  4Q0O A;  2YEL A;  4PTB A;  4O7E A;  5ENI A;  4NXJ A;  5CUG A;  4A9K A;  4MEP A;  4Z6I A;  4QYL A;  3UV2 A;  5CFW A;  2RI7 A;  1WUG A;  5CQ3 A;  5CQ5 A;  5FG5 A;  4TT4 A;  4XY9 A;  3O34 A;  5FH7 A;  4TU4 A;  4UYF A;  3IU5 A;  4NR6 A;  5FE2 A;  4LRG A;  4QSQ A;  3UW9 A;  3I3J A;  2RS9 B;  3UVY A;  2LSP B;  5KTX A;  5D3N A;  5FE7 A;  5FB0 A;  5JWM A;  4HXS A;  4QEU A;  5IID A;  4UYF B;  4CL9 A;  5DFB A;  5ENB A;  4NRA A;  4QBM A;  4QSW A;  3S91 A;  5BT4 A;  4UYD A;  5CY9 A;  3MUK A;  3UVX A;  5HEL A;  5LJ2 A;  5I80 A;  5FG6 A;  2RNY A;  4NQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...