1PUOA

Crystal structure of fel d 1- the major cat allergen
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
160
structure length
141
Chain Sequence
ETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSLLDKIYTSPLCLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Major allergen I polypeptide, fused chain 2, chain 1
publication title The crystal structure of the major cat allergen Fel d 1, a member of the secretoglobin family.
pubmed doi rcsb
source organism Felis catus
total genus 64
structure length 141
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09252 Feld-I_B Allergen Fel d I-B chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.50 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Histone Acetyltransferase; Chain A 1puoA00
1PUOA 1ZKRA 2EJNA
chains in the Genus database with same CATH superfamily
5F61A 4HBVA 4X2IA 3MQMA 5DW1A 4A9LA 4AI6A 4Y03A 5LKTA 3Q2EA 2MJVB 5ACYA 5I7YA 4TYLA 1WUGA 4UYFA 5CGPA 2DVVA 4O74A 4QYLA 5D3TA 5E7DA 4QSPA 5BT5A 4LRGA 5F1LA 3JVJA 3K2JA 3S92A 3MB4A 4QSUA 4LR6A 3D1DA 5FE0A 3I3JA 5KU3A 4CURA 4QSSA 1WUMA 5II1A 4KV1A 4QR4A 2F6JA 5DYXA 4IR6A 5FE3A 4MEPA 3ERRA 4UIZA 1E6IA 3MB3A 4HXLA 4QZSA 5EVAA 3QZSA 2NXBA 4NYXA 4WHUA 1ZS5A 4HXSA 4UITA 2R0YA 4PCIA 4A9IA 4Q0NA 4MEOA 4NRAA 5FE2A 4UIYA 3MXFA 3P1DA 5I7XA 4O72A 4UYEA 4BW4A 4ALGA 4MR5A 4WIVA 5FDZA 2D9EA 4YYIA 5EWHA 5CP5A 5EV9A 4YH3A 4YYGA 4NQMA 4UYHA 4UIXA 5A5PA 5CFWA 2YEMA 4UYFB 5EGUA 5FE1A 4A9HA 5A5SA 4TS8A 5DFDA 5LJ1A 5HFQA 5J0DA 5D7XA 5IBNA 5KTWA 5HJCA 4UIVA 4LYSA 4O7BA 3U5OA 5DFCA 5F63A 5EWWA 4NYWA 4Z6HA 5DY7A 4LDFA 5G4SA 5FG4A 3HMFA 2F6NA 4LZRA 5E3GA 4PKLA 3UV5A 3VKGA 4YYHA 1JSPB 3U5MA 4A9EA 5ENCA 2G4AA 3LXJA 2RI7A 5EPRA 4QR5A 5FE4A 5ENFA 4A9KA 4NR8A 4TT2A 4CLBA 5DLZA 5HQ6A 5L97A 5DYCA 4O70A 4O71A 4PY6A 4PCEA 4MENA 4AKHA 1X0JA 2DVSA 5ETDA 4HBYA 2OSSA 5HRWA 3ZYUA 4CUSA 5HEMA 5ETBA 5DLXA 2E7OA 3Q2FA 4IORA 5EI4A 5EWVA 2YYNA 5CUAA 2WP1A 4NRBA 4A9OA 5DFBA 4XY8A 5H1TA 4QY4A 5CQTA 2I8NA 5E9VA 5FH8A 5C87A 5H1UA 4HXKA 5I40A 5D0CA 4IR4A 2DATA 5BT4A 5A5QA 4QC3A 5KTXA 5ENIA 1ZKRA 1PUOA 4TTEA 5A5OA 4NUDA 5A5NA 4TT6A 5E9LA 3D7CA 4YK0A 5CQ8A 4J1PA 4CFKA 2R10A 4QEVA 5F3AA 5A85A 3LQIA 4BW2A 4QYDA 4IR3A 2OO1A 4XUAA 3P1FA 4A9MA 5A82A 5HCLA 5CTLA 5A81A 3SVGA 2FSAA 4NXJA 3U5PA 4NS5A 5IG6A 5DKHA 5FE6A 5E9MA 4A9NA 4O77A 3JVLA 4QSVA 4GPJA 5EM3A 4BHWA 3HMHA 3IU5A 4YYKA 5JI8A 2GRCA 2I7KA 5HRVA 5EP7A 5FH7A 4XYAA 5F2PA 5CQ6A 5CRMA 3JVMA 4E96A 4BW1A 4Z1QA 4CFLA 5CZGA 4HBWA 2RNWA 4J0RA 5EA1A 4QSTA 5DKCA 3O36A 5LKZA 4TU6A 4LC2A 4TZ8A 5LVRA 4DONA 5CS8A 5HFRA 5LJ0A 5LJ2A 4UYDA 3U5KA 4LZSA 5DX4A 4AKGA 3LQJA 5FBXA 4YYJA 5CRZA 5F1HA 2KTBB 4YC9A 2RFJA 4HXNA 5CQ4A 5CQ5A 4YADA 5EQ1A 2OUOA 5IGLA 4NR6A 4N4GA 4HXPA 5BT3A 2R0VA 2H60A 3U5NA 4QBMA 5CUDA 3RCWA 5I80A 5FE7A 4O75A 5TB6A 4YY4A 4QC1A 3AADA 5EPBA 4QR3A 3HMEA 2L5EA 5EISA 5I83A 2RS9B 4ZW1A 5D24A 4N4HA 4XUBA 1EQFA 5DKDA 5LKXA 2DWWA 2YELA 5H85A 5F25A 4YH4A 5FFYA 5HRXA 5JWMA 5D3RA 4NUEA 4PTBA 5D3LA 4CUPA 5D3PA 2E3KA 1F68A 3O37A 4YATA 2RO1A 4A9FA 2WP2A 4LYIA 4NUCA 5A5RA 5D3NA 4HXMA 3MULA 4UIUA 5ENGA 5G4RA 5L96A 5C7NA 5KO4A 4CUQA 5ENJA 5HQ7A 5DYAA 3VKHA 5C8GA 4CUTA 4QUTA 3G0LA 5FFWA 5E3DA 5KHMA 5DBMA 4J0SA 5D26A 4AKIA 3NXBA 5C85A 4XY9A 4HBXA 5FG6A 5A83A 4TZ2A 4YYDA 5L99A 2N9GA 4OGIA 3LQHA 4O7CA 5CQ7A 5C89A 4YBMA 5II2A 5I88A 4QSRA 5HM0A 3S91A 5E9IA 2E7NA 4UYGA 5COIA 5FG5A 3FKMX 4YBTA 5I1QA 3P1EA 4NR4A 4OUFA 5TCMA 4TQNA 4RVRA 3SVFA 5CUGA 5HLSA 4NYVA 4O76A 3TLPA 2DKWA 4ALHA 5LVQA 4O7AA 4NR5A 3UV2A 5E74A 3QZVA 4NR9A 4IOOA 4LYWA 4N4FA 4HXOA 5FE9A 5CUEA 4BJXA 5EWCA 5FB0A 4MEQA 5KTUA 5LKUA 3O35A 5DW2A 4A9JA 2YEKA 5EICA 4QNSA 4MR3A 5AD2A 5F60A 4AKNA 5HELA 3AQAA 5I89A 4OGJA 5L98A 5CUBA 4MR6A 2EJNA 4QEWA 4Q0OA 5L8UA 5E9YA 5CPEA 3UVWA 5DYUA 5E0RA 2YW5A 4F3IA 2YDWA 4YYMA 5IGMA 3MUKA 4UIWA 5EWDA 5I29A 3SVHA 5EU1A 4QSWA 5CY9A 5K29A 4NQNA 4Z1SA 4ZQLA 5FE5A 3DAIA 4IR5A 5F62A 5D3JA 4QEUA 5HQ5A 2RNXA 5FFVA 2LSPB 4MR4A 5ENBA 3G0JA 4QSQA 3U5LA 5CU8A 4TU4A 4HXRA 5H1VA 3JVKA 5FB1A 2R0SA 4O78A 3ONIA 5E73A 2DVRA 1JM4B 4Z6IA 5HENA 4BW3A 5E9KA 3O33A 2D82A 5EPSA 4YY6A 4Z93A 4PS5A 5F36A 5EK9A 3D1BA 2L84A 4WHWA 5ENEA 4IOQA 4O7FA 3UVYA 5D3SA 4LZ2A 3P5OA 5CQ3A 3P1CA 5LUUA 4O7EA 3UW9A 4YBSA 4N4IA 4FLPA 3QZTA 5AMEA 5A7CA 4CUUA 5I86A 3IU6A 5CUCA 4KCXA 2YQDA 4QUUA 5IIDA 3GG3A 5C4QA 1N72A 5ENHA 5D25A 4C67A 4NRCA 4J3IA 3UVDA 5FE8A 2L85A 4CL9A 4N3WA 4NR7A 4YABA 3UV4A 4YAXA 4ZC9A 4C66A 5AD3A 5AMFA 4YYNA 4KV4A 3O34A 2RNYA 3LJWA 3DWYA 5CQAA 5D3HA 5L8TA 3UVXA 5FH6A 3U5JA 4QSXA 4TT4A 4QB3A 5F5ZA 5IGNA 5IGKA 2DVQA
chains in the Genus database with same CATH topology
3D1DA 4AKIA 4AKHA 3VKHA 1ZKRA 3VKGA 4AI6A 1PUOA 3ERRA 2EJNA 4AKGA 3D1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUO A;  1ZKR A;  2EJN A; 
#chains in the Genus database with same CATH topology
 5F61 A;  4HBV A;  4X2I A;  3MQM A;  5DW1 A;  4A9L A;  4AI6 A;  4Y03 A;  5LKT A;  3Q2E A;  2MJV B;  5ACY A;  5I7Y A;  4TYL A;  1WUG A;  4UYF A;  5CGP A;  2DVV A;  4O74 A;  4QYL A;  5D3T A;  5E7D A;  4QSP A;  5BT5 A;  4LRG A;  5F1L A;  3JVJ A;  3K2J A;  3S92 A;  3MB4 A;  4QSU A;  4LR6 A;  3D1D A;  5FE0 A;  3I3J A;  5KU3 A;  4CUR A;  4QSS A;  1WUM A;  5II1 A;  4KV1 A;  4QR4 A;  2F6J A;  5DYX A;  4IR6 A;  5FE3 A;  4MEP A;  3ERR A;  4UIZ A;  1E6I A;  3MB3 A;  4HXL A;  4QZS A;  5EVA A;  3QZS A;  2NXB A;  4NYX A;  4WHU A;  1ZS5 A;  4HXS A;  4UIT A;  2R0Y A;  4PCI A;  4A9I A;  4Q0N A;  4MEO A;  4NRA A;  5FE2 A;  4UIY A;  3MXF A;  3P1D A;  5I7X A;  4O72 A;  4UYE A;  4BW4 A;  4ALG A;  4MR5 A;  4WIV A;  5FDZ A;  2D9E A;  4YYI A;  5EWH A;  5CP5 A;  5EV9 A;  4YH3 A;  4YYG A;  4NQM A;  4UYH A;  4UIX A;  5A5P A;  5CFW A;  2YEM A;  4UYF B;  5EGU A;  5FE1 A;  4A9H A;  5A5S A;  4TS8 A;  5DFD A;  5LJ1 A;  5HFQ A;  5J0D A;  5D7X A;  5IBN A;  5KTW A;  5HJC A;  4UIV A;  4LYS A;  4O7B A;  3U5O A;  5DFC A;  5F63 A;  5EWW A;  4NYW A;  4Z6H A;  5DY7 A;  4LDF A;  5G4S A;  5FG4 A;  3HMF A;  2F6N A;  4LZR A;  5E3G A;  4PKL A;  3UV5 A;  3VKG A;  4YYH A;  1JSP B;  3U5M A;  4A9E A;  5ENC A;  2G4A A;  3LXJ A;  2RI7 A;  5EPR A;  4QR5 A;  5FE4 A;  5ENF A;  4A9K A;  4NR8 A;  4TT2 A;  4CLB A;  5DLZ A;  5HQ6 A;  5L97 A;  5DYC A;  4O70 A;  4O71 A;  4PY6 A;  4PCE A;  4MEN A;  4AKH A;  1X0J A;  2DVS A;  5ETD A;  4HBY A;  2OSS A;  5HRW A;  3ZYU A;  4CUS A;  5HEM A;  5ETB A;  5DLX A;  2E7O A;  3Q2F A;  4IOR A;  5EI4 A;  5EWV A;  2YYN A;  5CUA A;  2WP1 A;  4NRB A;  4A9O A;  5DFB A;  4XY8 A;  5H1T A;  4QY4 A;  5CQT A;  2I8N A;  5E9V A;  5FH8 A;  5C87 A;  5H1U A;  4HXK A;  5I40 A;  5D0C A;  4IR4 A;  2DAT A;  5BT4 A;  5A5Q A;  4QC3 A;  5KTX A;  5ENI A;  1ZKR A;  1PUO A;  4TTE A;  5A5O A;  4NUD A;  5A5N A;  4TT6 A;  5E9L A;  3D7C A;  4YK0 A;  5CQ8 A;  4J1P A;  4CFK A;  2R10 A;  4QEV A;  5F3A A;  5A85 A;  3LQI A;  4BW2 A;  4QYD A;  4IR3 A;  2OO1 A;  4XUA A;  3P1F A;  4A9M A;  5A82 A;  5HCL A;  5CTL A;  5A81 A;  3SVG A;  2FSA A;  4NXJ A;  3U5P A;  4NS5 A;  5IG6 A;  5DKH A;  5FE6 A;  5E9M A;  4A9N A;  4O77 A;  3JVL A;  4QSV A;  4GPJ A;  5EM3 A;  4BHW A;  3HMH A;  3IU5 A;  4YYK A;  5JI8 A;  2GRC A;  2I7K A;  5HRV A;  5EP7 A;  5FH7 A;  4XYA A;  5F2P A;  5CQ6 A;  5CRM A;  3JVM A;  4E96 A;  4BW1 A;  4Z1Q A;  4CFL A;  5CZG A;  4HBW A;  2RNW A;  4J0R A;  5EA1 A;  4QST A;  5DKC A;  3O36 A;  5LKZ A;  4TU6 A;  4LC2 A;  4TZ8 A;  5LVR A;  4DON A;  5CS8 A;  5HFR A;  5LJ0 A;  5LJ2 A;  4UYD A;  3U5K A;  4LZS A;  5DX4 A;  4AKG A;  3LQJ A;  5FBX A;  4YYJ A;  5CRZ A;  5F1H A;  2KTB B;  4YC9 A;  2RFJ A;  4HXN A;  5CQ4 A;  5CQ5 A;  4YAD A;  5EQ1 A;  2OUO A;  5IGL A;  4NR6 A;  4N4G A;  4HXP A;  5BT3 A;  2R0V A;  2H60 A;  3U5N A;  4QBM A;  5CUD A;  3RCW A;  5I80 A;  5FE7 A;  4O75 A;  5TB6 A;  4YY4 A;  4QC1 A;  3AAD A;  5EPB A;  4QR3 A;  3HME A;  2L5E A;  5EIS A;  5I83 A;  2RS9 B;  4ZW1 A;  5D24 A;  4N4H A;  4XUB A;  1EQF A;  5DKD A;  5LKX A;  2DWW A;  2YEL A;  5H85 A;  5F25 A;  4YH4 A;  5FFY A;  5HRX A;  5JWM A;  5D3R A;  4NUE A;  4PTB A;  5D3L A;  4CUP A;  5D3P A;  2E3K A;  1F68 A;  3O37 A;  4YAT A;  2RO1 A;  4A9F A;  2WP2 A;  4LYI A;  4NUC A;  5A5R A;  5D3N A;  4HXM A;  3MUL A;  4UIU A;  5ENG A;  5G4R A;  5L96 A;  5C7N A;  5KO4 A;  4CUQ A;  5ENJ A;  5HQ7 A;  5DYA A;  3VKH A;  5C8G A;  4CUT A;  4QUT A;  3G0L A;  5FFW A;  5E3D A;  5KHM A;  5DBM A;  4J0S A;  5D26 A;  4AKI A;  3NXB A;  5C85 A;  4XY9 A;  4HBX A;  5FG6 A;  5A83 A;  4TZ2 A;  4YYD A;  5L99 A;  2N9G A;  4OGI A;  3LQH A;  4O7C A;  5CQ7 A;  5C89 A;  4YBM A;  5II2 A;  5I88 A;  4QSR A;  5HM0 A;  3S91 A;  5E9I A;  2E7N A;  4UYG A;  5COI A;  5FG5 A;  3FKM X;  4YBT A;  5I1Q A;  3P1E A;  4NR4 A;  4OUF A;  5TCM A;  4TQN A;  4RVR A;  3SVF A;  5CUG A;  5HLS A;  4NYV A;  4O76 A;  3TLP A;  2DKW A;  4ALH A;  5LVQ A;  4O7A A;  4NR5 A;  3UV2 A;  5E74 A;  3QZV A;  4NR9 A;  4IOO A;  4LYW A;  4N4F A;  4HXO A;  5FE9 A;  5CUE A;  4BJX A;  5EWC A;  5FB0 A;  4MEQ A;  5KTU A;  5LKU A;  3O35 A;  5DW2 A;  4A9J A;  2YEK A;  5EIC A;  4QNS A;  4MR3 A;  5AD2 A;  5F60 A;  4AKN A;  5HEL A;  3AQA A;  5I89 A;  4OGJ A;  5L98 A;  5CUB A;  4MR6 A;  2EJN A;  4QEW A;  4Q0O A;  5L8U A;  5E9Y A;  5CPE A;  3UVW A;  5DYU A;  5E0R A;  2YW5 A;  4F3I A;  2YDW A;  4YYM A;  5IGM A;  3MUK A;  4UIW A;  5EWD A;  5I29 A;  3SVH A;  5EU1 A;  4QSW A;  5CY9 A;  5K29 A;  4NQN A;  4Z1S A;  4ZQL A;  5FE5 A;  3DAI A;  4IR5 A;  5F62 A;  5D3J A;  4QEU A;  5HQ5 A;  2RNX A;  5FFV A;  2LSP B;  4MR4 A;  5ENB A;  3G0J A;  4QSQ A;  3U5L A;  5CU8 A;  4TU4 A;  4HXR A;  5H1V A;  3JVK A;  5FB1 A;  2R0S A;  4O78 A;  3ONI A;  5E73 A;  2DVR A;  1JM4 B;  4Z6I A;  5HEN A;  4BW3 A;  5E9K A;  3O33 A;  2D82 A;  5EPS A;  4YY6 A;  4Z93 A;  4PS5 A;  5F36 A;  5EK9 A;  3D1B A;  2L84 A;  4WHW A;  5ENE A;  4IOQ A;  4O7F A;  3UVY A;  5D3S A;  4LZ2 A;  3P5O A;  5CQ3 A;  3P1C A;  5LUU A;  4O7E A;  3UW9 A;  4YBS A;  4N4I A;  4FLP A;  3QZT A;  5AME A;  5A7C A;  4CUU A;  5I86 A;  3IU6 A;  5CUC A;  4KCX A;  2YQD A;  4QUU A;  5IID A;  3GG3 A;  5C4Q A;  1N72 A;  5ENH A;  5D25 A;  4C67 A;  4NRC A;  4J3I A;  3UVD A;  5FE8 A;  2L85 A;  4CL9 A;  4N3W A;  4NR7 A;  4YAB A;  3UV4 A;  4YAX A;  4ZC9 A;  4C66 A;  5AD3 A;  5AMF A;  4YYN A;  4KV4 A;  3O34 A;  2RNY A;  3LJW A;  3DWY A;  5CQA A;  5D3H A;  5L8T A;  3UVX A;  5FH6 A;  3U5J A;  4QSX A;  4TT4 A;  4QB3 A;  5F5Z A;  5IGN A;  5IGK A;  2DVQ A; 
#chains in the Genus database with same CATH homology
 3D1D A;  4AKI A;  4AKH A;  3VKH A;  1ZKR A;  3VKG A;  4AI6 A;  1PUO A;  3ERR A;  2EJN A;  4AKG A;  3D1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...