1PUOA

Crystal structure of fel d 1- the major cat allergen
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
160
structure length
141
Chain Sequence
ETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSLLDKIYTSPLCLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major allergen I polypeptide, fused chain 2, chain 1
publication title The crystal structure of the major cat allergen Fel d 1, a member of the secretoglobin family.
pubmed doi rcsb
source organism Felis catus
molecule tags Allergen
total genus 64
structure length 141
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09252 Feld-I_B Allergen Fel d I-B chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.50 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Histone Acetyltransferase; Chain A 1puoA00
2EJNA 1PUOA 1ZKRA
chains in the Genus database with same CATH superfamily
5BT4A 4XY9A 4QB3A 5F60A 4TT6A 4QYLA 4UITA 4UIWA 2RFJA 3I3JA 5CUDA 4CUPA 5FFYA 4CLBA 1WUGA 5HENA 2E3KA 5C4QA 5I88A 2R0YA 3ONIA 1WUMA 5LVRA 2N9GA 5CZGA 4YYKA 4NR6A 4J0RA 4CUSA 4O7EA 4ALHA 2DVRA 5I40A 4KV4A 3P1EA 4XUBA 4UIYA 4NR4A 4XY8A 5COIA 3DWYA 4NR9A 4A9LA 3HMEA 4J3IA 4AKGA 4WIVA 5JWMA 3FKMX 4QYDA 3LXJA 4LZSA 5ETDA 5D3TA 2KTBB 4BW3A 2LSPB 5F36A 4QC3A 5D24A 4BHWA 4O78A 3UVDA 4A9EA 5II2A 5A7CA 2F6NA 5D3JA 5DX4A 5F25A 4C66A 5AD2A 4WHWA 2L84A 1ZKRA 3MB3A 4NUCA 3S92A 3MULA 5DFCA 4NR8A 5HQ5A 4KCXA 5A5SA 4NRAA 5ENCA 3MB4A 4NYXA 4QSVA 3UVXA 5C87A 5FG6A 4HBXA 4YH3A 5FG4A 5ENHA 5CGPA 4MENA 5FE0A 1N72A 4WHUA 5E9KA 5HELA 5FE2A 2DVVA 5A5NA 5DKDA 5HM0A 3P1FA 2L85A 5CQ5A 4BW4A 3UV2A 5LJ1A 4LDFA 5FFWA 5KHMA 4UYGA 5DBMA 5D3PA 5IBNA 4YK0A 3QZSA 5L8TA 1E6IA 2YEKA 3LQIA 4HXKA 4TZ2A 5A82A 5DKHA 5ENEA 5F62A 5EK9A 5EISA 5A5OA 3G0JA 5CQ7A 5LKXA 5F63A 2R0VA 5A5RA 4OGIA 5D3SA 5E9VA 4CL9A 5FE5A 5L99A 4O75A 3MXFA 4NR5A 4IOQA 5CTLA 2I7KA 2I8NA 5D3NA 2OUOA 3JVMA 5HQ6A 3TLPA 2D82A 5CQAA 3P1CA 5FG5A 4UYDA 4O74A 4NS5A 4NYVA 3UV5A 4YAXA 4CUUA 4TT4A 3P5OA 5II1A 4MR3A 5J0DA 5CQ8A 4FLPA 5LJ2A 5DLXA 4Z6HA 4QEUA 5DYUA 5DW1A 4C67A 5FH6A 4A9NA 5FH7A 4N4GA 4HBYA 3LQJA 5CUAA 4QNSA 1EQFA 3HMFA 5I86A 4O7FA 4IR6A 4YYJA 4OGJA 4O71A 5KO4A 3LJWA 4N4FA 3IU5A 4QZSA 4UIZA 4CFLA 5IIDA 3U5JA 3K2JA 2E7OA 5CU8A 4Z1SA 2YEMA 4HXSA 4QSUA 3O35A 4QBMA 5F3AA 4TZ8A 4UYFB 5HRXA 3MQMA 3U5PA 5EWVA 3UVWA 4YBSA 5EPRA 3D7CA 5CQ6A 5E9MA 4Z1QA 3GG3A 3JVLA 4HXOA 3S91A 5ENBA 5CY9A 5D0CA 4A9HA 5A5PA 3UVYA 5K29A 5E0RA 2E7NA 3U5MA 4HXNA 3D1DA 5ENFA 5DLZA 2YELA 4MR5A 4TTEA 5I7YA 1PUOA 2H60A 5C7NA 4LZRA 4TS8A 4YYMA 4LZ2A 2YW5A 4MEOA 4QSWA 5EWHA 5F1HA 4A9MA 5KTWA 1JSPB 3U5LA 4YYNA 5KTXA 3JVJA 4MEPA 5AD3A 4MR4A 5A83A 4AI6A 5A5QA 2R10A 5LJ0A 5ENIA 4YYDA 4LYIA 4BW1A 2G4AA 4A9IA 4YBTA 4F3IA 5ETBA 4Q0OA 4GPJA 4QSTA 4CUTA 5CUEA 5EP7A 4HXRA 5I1QA 5HEMA 4QR3A 5FE4A 4QR5A 5CRMA 5EQ1A 3MUKA 4HBWA 5LKZA 5EGUA 5E3DA 4AKIA 4TU6A 3U5KA 5EI4A 4A9FA 2NXBA 4YYHA 5HJCA 5TCMA 4J1PA 5DY7A 3SVHA 3QZTA 5L97A 4UIVA 5D3HA 5DYXA 4CFKA 5E9IA 5EPSA 2OSSA 4UIUA 4BJXA 1F68A 5F1LA 2EJNA 4QC1A 5EWDA 5I7XA 4PCIA 5FBXA 3D1BA 3Q2EA 5CUBA 4YY4A 4LRGA 4NRCA 4Z93A 5H1VA 5C89A 2RS9B 1X0JA 2DVQA 5L98A 4E96A 5E9LA 4A9KA 4TT2A 4QSQA 4O7AA 5CQ4A 4NUEA 4NXJA 3UV4A 3ZYUA 4YYGA 5I83A 4LR6A 5TB6A 4N4IA 4QSXA 5ENJA 5FE8A 5EV9A 4YC9A 5E9YA 4Z6IA 4KV1A 5F61A 5AMEA 5FE9A 5LVQA 3VKGA 5G4RA 2DATA 3ERRA 5L96A 5FE6A 5DYCA 2YQDA 3QZVA 5EWWA 5D25A 3IU6A 4UYEA 2DVSA 4Q0NA 4LYSA 4HXLA 3AADA 1ZS5A 4IOOA 4N3WA 5DFDA 3VKHA 2MJVB 5FE3A 5E73A 4CURA 4YH4A 5E74A 5H1TA 5HFRA 3RCWA 4IORA 4OUFA 2RNXA 4O7BA 4TQNA 5LUUA 5EPBA 5EU1A 3U5NA 2RNYA 4O76A 5IGKA 5CPEA 5FFVA 2YYNA 5FB0A 4DONA 4J0SA 5A81A 4RVRA 4LYWA 4AKNA 5EICA 5IGNA 2DWWA 2WP1A 2OO1A 2RO1A 5FH8A 4QY4A 5BT3A 5FDZA 5EWCA 4NQMA 5CS8A 5I80A 4XYAA 4PY6A 2WP2A 5CUCA 4PS5A 5BT5A 5FE7A 5DW2A 5I29A 4MR6A 5D26A 3O33A 4A9OA 5HFQA 5LKUA 5LKTA 5IG6A 2L5EA 5H85A 2FSAA 3O34A 5I89A 4NR7A 4X2IA 5HQ7A 4YATA 4Y03A 5CP5A 5HCLA 4O7CA 5EM3A 4HXMA 4QSPA 5IGLA 2GRCA 3SVFA 5AMFA 4IR3A 4IR4A 4AKHA 4YBMA 3UW9A 3G0LA 5DFBA 3DAIA 4YADA 4HXPA 5HLSA 4PKLA 4YY6A 4QSRA 4QSSA 2RI7A 5FB1A 4ZC9A 5G4SA 5E7DA 4HBVA 3JVKA 4YABA 4TU4A 2YDWA 4LC2A 4UIXA 4TYLA 4O77A 3P1DA 5KTUA 3U5OA 5IGMA 4ZW1A 4NQNA 4O72A 4PTBA 4QEVA 4PCEA 3SVGA 5JI8A 5ACYA 5F5ZA 5F2PA 2DKWA 3O36A 5CFWA 4NRBA 3O37A 5CQTA 5D3RA 4XUAA 5H1UA 3HMHA 4A9JA 5D3LA 2R0SA 4QR4A 4MEQA 4QUUA 5FE1A 4NYWA 4YYIA 2D9EA 5L8UA 4UYHA 4QUTA 4UYFA 5CUGA 5C8GA 5HRWA 2F6JA 4NUDA 3LQHA 3Q2FA 4N4HA 1JM4B 4QEWA 5CQ3A 5A85A 5EVAA 4ZQLA 5ENGA 5C85A 4BW2A 4O70A 5CRZA 3AQAA 5DKCA 5D7XA 5EA1A 4IR5A 3NXBA 4CUQA 5HRVA 5KU3A 5E3GA 4ALGA 5DYAA 2RNWA
chains in the Genus database with same CATH topology
4AKHA 4AKGA 3VKHA 3VKGA 3D1BA 1PUOA 3D1DA 1ZKRA 4AI6A 4AKIA 2EJNA 3ERRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJN A;  1PUO A;  1ZKR A; 
#chains in the Genus database with same CATH topology
 5BT4 A;  4XY9 A;  4QB3 A;  5F60 A;  4TT6 A;  4QYL A;  4UIT A;  4UIW A;  2RFJ A;  3I3J A;  5CUD A;  4CUP A;  5FFY A;  4CLB A;  1WUG A;  5HEN A;  2E3K A;  5C4Q A;  5I88 A;  2R0Y A;  3ONI A;  1WUM A;  5LVR A;  2N9G A;  5CZG A;  4YYK A;  4NR6 A;  4J0R A;  4CUS A;  4O7E A;  4ALH A;  2DVR A;  5I40 A;  4KV4 A;  3P1E A;  4XUB A;  4UIY A;  4NR4 A;  4XY8 A;  5COI A;  3DWY A;  4NR9 A;  4A9L A;  3HME A;  4J3I A;  4AKG A;  4WIV A;  5JWM A;  3FKM X;  4QYD A;  3LXJ A;  4LZS A;  5ETD A;  5D3T A;  2KTB B;  4BW3 A;  2LSP B;  5F36 A;  4QC3 A;  5D24 A;  4BHW A;  4O78 A;  3UVD A;  4A9E A;  5II2 A;  5A7C A;  2F6N A;  5D3J A;  5DX4 A;  5F25 A;  4C66 A;  5AD2 A;  4WHW A;  2L84 A;  1ZKR A;  3MB3 A;  4NUC A;  3S92 A;  3MUL A;  5DFC A;  4NR8 A;  5HQ5 A;  4KCX A;  5A5S A;  4NRA A;  5ENC A;  3MB4 A;  4NYX A;  4QSV A;  3UVX A;  5C87 A;  5FG6 A;  4HBX A;  4YH3 A;  5FG4 A;  5ENH A;  5CGP A;  4MEN A;  5FE0 A;  1N72 A;  4WHU A;  5E9K A;  5HEL A;  5FE2 A;  2DVV A;  5A5N A;  5DKD A;  5HM0 A;  3P1F A;  2L85 A;  5CQ5 A;  4BW4 A;  3UV2 A;  5LJ1 A;  4LDF A;  5FFW A;  5KHM A;  4UYG A;  5DBM A;  5D3P A;  5IBN A;  4YK0 A;  3QZS A;  5L8T A;  1E6I A;  2YEK A;  3LQI A;  4HXK A;  4TZ2 A;  5A82 A;  5DKH A;  5ENE A;  5F62 A;  5EK9 A;  5EIS A;  5A5O A;  3G0J A;  5CQ7 A;  5LKX A;  5F63 A;  2R0V A;  5A5R A;  4OGI A;  5D3S A;  5E9V A;  4CL9 A;  5FE5 A;  5L99 A;  4O75 A;  3MXF A;  4NR5 A;  4IOQ A;  5CTL A;  2I7K A;  2I8N A;  5D3N A;  2OUO A;  3JVM A;  5HQ6 A;  3TLP A;  2D82 A;  5CQA A;  3P1C A;  5FG5 A;  4UYD A;  4O74 A;  4NS5 A;  4NYV A;  3UV5 A;  4YAX A;  4CUU A;  4TT4 A;  3P5O A;  5II1 A;  4MR3 A;  5J0D A;  5CQ8 A;  4FLP A;  5LJ2 A;  5DLX A;  4Z6H A;  4QEU A;  5DYU A;  5DW1 A;  4C67 A;  5FH6 A;  4A9N A;  5FH7 A;  4N4G A;  4HBY A;  3LQJ A;  5CUA A;  4QNS A;  1EQF A;  3HMF A;  5I86 A;  4O7F A;  4IR6 A;  4YYJ A;  4OGJ A;  4O71 A;  5KO4 A;  3LJW A;  4N4F A;  3IU5 A;  4QZS A;  4UIZ A;  4CFL A;  5IID A;  3U5J A;  3K2J A;  2E7O A;  5CU8 A;  4Z1S A;  2YEM A;  4HXS A;  4QSU A;  3O35 A;  4QBM A;  5F3A A;  4TZ8 A;  4UYF B;  5HRX A;  3MQM A;  3U5P A;  5EWV A;  3UVW A;  4YBS A;  5EPR A;  3D7C A;  5CQ6 A;  5E9M A;  4Z1Q A;  3GG3 A;  3JVL A;  4HXO A;  3S91 A;  5ENB A;  5CY9 A;  5D0C A;  4A9H A;  5A5P A;  3UVY A;  5K29 A;  5E0R A;  2E7N A;  3U5M A;  4HXN A;  3D1D A;  5ENF A;  5DLZ A;  2YEL A;  4MR5 A;  4TTE A;  5I7Y A;  1PUO A;  2H60 A;  5C7N A;  4LZR A;  4TS8 A;  4YYM A;  4LZ2 A;  2YW5 A;  4MEO A;  4QSW A;  5EWH A;  5F1H A;  4A9M A;  5KTW A;  1JSP B;  3U5L A;  4YYN A;  5KTX A;  3JVJ A;  4MEP A;  5AD3 A;  4MR4 A;  5A83 A;  4AI6 A;  5A5Q A;  2R10 A;  5LJ0 A;  5ENI A;  4YYD A;  4LYI A;  4BW1 A;  2G4A A;  4A9I A;  4YBT A;  4F3I A;  5ETB A;  4Q0O A;  4GPJ A;  4QST A;  4CUT A;  5CUE A;  5EP7 A;  4HXR A;  5I1Q A;  5HEM A;  4QR3 A;  5FE4 A;  4QR5 A;  5CRM A;  5EQ1 A;  3MUK A;  4HBW A;  5LKZ A;  5EGU A;  5E3D A;  4AKI A;  4TU6 A;  3U5K A;  5EI4 A;  4A9F A;  2NXB A;  4YYH A;  5HJC A;  5TCM A;  4J1P A;  5DY7 A;  3SVH A;  3QZT A;  5L97 A;  4UIV A;  5D3H A;  5DYX A;  4CFK A;  5E9I A;  5EPS A;  2OSS A;  4UIU A;  4BJX A;  1F68 A;  5F1L A;  2EJN A;  4QC1 A;  5EWD A;  5I7X A;  4PCI A;  5FBX A;  3D1B A;  3Q2E A;  5CUB A;  4YY4 A;  4LRG A;  4NRC A;  4Z93 A;  5H1V A;  5C89 A;  2RS9 B;  1X0J A;  2DVQ A;  5L98 A;  4E96 A;  5E9L A;  4A9K A;  4TT2 A;  4QSQ A;  4O7A A;  5CQ4 A;  4NUE A;  4NXJ A;  3UV4 A;  3ZYU A;  4YYG A;  5I83 A;  4LR6 A;  5TB6 A;  4N4I A;  4QSX A;  5ENJ A;  5FE8 A;  5EV9 A;  4YC9 A;  5E9Y A;  4Z6I A;  4KV1 A;  5F61 A;  5AME A;  5FE9 A;  5LVQ A;  3VKG A;  5G4R A;  2DAT A;  3ERR A;  5L96 A;  5FE6 A;  5DYC A;  2YQD A;  3QZV A;  5EWW A;  5D25 A;  3IU6 A;  4UYE A;  2DVS A;  4Q0N A;  4LYS A;  4HXL A;  3AAD A;  1ZS5 A;  4IOO A;  4N3W A;  5DFD A;  3VKH A;  2MJV B;  5FE3 A;  5E73 A;  4CUR A;  4YH4 A;  5E74 A;  5H1T A;  5HFR A;  3RCW A;  4IOR A;  4OUF A;  2RNX A;  4O7B A;  4TQN A;  5LUU A;  5EPB A;  5EU1 A;  3U5N A;  2RNY A;  4O76 A;  5IGK A;  5CPE A;  5FFV A;  2YYN A;  5FB0 A;  4DON A;  4J0S A;  5A81 A;  4RVR A;  4LYW A;  4AKN A;  5EIC A;  5IGN A;  2DWW A;  2WP1 A;  2OO1 A;  2RO1 A;  5FH8 A;  4QY4 A;  5BT3 A;  5FDZ A;  5EWC A;  4NQM A;  5CS8 A;  5I80 A;  4XYA A;  4PY6 A;  2WP2 A;  5CUC A;  4PS5 A;  5BT5 A;  5FE7 A;  5DW2 A;  5I29 A;  4MR6 A;  5D26 A;  3O33 A;  4A9O A;  5HFQ A;  5LKU A;  5LKT A;  5IG6 A;  2L5E A;  5H85 A;  2FSA A;  3O34 A;  5I89 A;  4NR7 A;  4X2I A;  5HQ7 A;  4YAT A;  4Y03 A;  5CP5 A;  5HCL A;  4O7C A;  5EM3 A;  4HXM A;  4QSP A;  5IGL A;  2GRC A;  3SVF A;  5AMF A;  4IR3 A;  4IR4 A;  4AKH A;  4YBM A;  3UW9 A;  3G0L A;  5DFB A;  3DAI A;  4YAD A;  4HXP A;  5HLS A;  4PKL A;  4YY6 A;  4QSR A;  4QSS A;  2RI7 A;  5FB1 A;  4ZC9 A;  5G4S A;  5E7D A;  4HBV A;  3JVK A;  4YAB A;  4TU4 A;  2YDW A;  4LC2 A;  4UIX A;  4TYL A;  4O77 A;  3P1D A;  5KTU A;  3U5O A;  5IGM A;  4ZW1 A;  4NQN A;  4O72 A;  4PTB A;  4QEV A;  4PCE A;  3SVG A;  5JI8 A;  5ACY A;  5F5Z A;  5F2P A;  2DKW A;  3O36 A;  5CFW A;  4NRB A;  3O37 A;  5CQT A;  5D3R A;  4XUA A;  5H1U A;  3HMH A;  4A9J A;  5D3L A;  2R0S A;  4QR4 A;  4MEQ A;  4QUU A;  5FE1 A;  4NYW A;  4YYI A;  2D9E A;  5L8U A;  4UYH A;  4QUT A;  4UYF A;  5CUG A;  5C8G A;  5HRW A;  2F6J A;  4NUD A;  3LQH A;  3Q2F A;  4N4H A;  1JM4 B;  4QEW A;  5CQ3 A;  5A85 A;  5EVA A;  4ZQL A;  5ENG A;  5C85 A;  4BW2 A;  4O70 A;  5CRZ A;  3AQA A;  5DKC A;  5D7X A;  5EA1 A;  4IR5 A;  3NXB A;  4CUQ A;  5HRV A;  5KU3 A;  5E3G A;  4ALG A;  5DYA A;  2RNW A; 
#chains in the Genus database with same CATH homology
 4AKH A;  4AKG A;  3VKH A;  3VKG A;  3D1B A;  1PUO A;  3D1D A;  1ZKR A;  4AI6 A;  4AKI A;  2EJN A;  3ERR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...