4QEVA

Crystal structure of brd2(bd2) mutant with ligand me bound (methyl (2r)- 2-[(4s)-6-(4-chlorophenyl)-8-methoxy-1-methyl-4h-[1,2,4]triazolo[4,3-a][1, 4]benzodiazepin-4-yl]propanoate)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
110
structure length
110
Chain Sequence
LSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGAHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 2
publication title Chemical biology. A bump-and-hole approach to engineer controlled selectivity of BET bromodomain chemical probes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 42
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qevA00
4XUBA 4NS5A 4NUCA 4NQNA 4NR7A 4A9MA 4TZ8A 5ENIA 4O77A 5DX4A 4MEQA 4UYDA 4QR4A 5E9LA 5FH8A 3O33A 3S92A 4J0RA 5HQ5A 2E7NA 2L85A 4UYFB 4NR8A 4O78A 5EQ1A 5F63A 5CQ8A 5L98A 5EWDA 5HEMA 3U5MA 3UV4A 5DW1A 1EQFA 2G4AA 5A5NA 2DATA 5CUCA 5G4RA 4QSTA 4YH4A 3IU6A 3K2JA 4UIUA 3MQMA 5A5RA 5CUDA 2RFJA 4NRBA 5I83A 4BHWA 3JVLA 3P1FA 4QSQA 5DKDA 2WP1A 4F3IA 5FH7A 4QYLA 4N4HA 4QSXA 4UYFA 5CUGA 5DLXA 5EA1A 5IGKA 4TZ2A 4TS8A 4QSPA 4DONA 4QEVA 4WIVA 5A85A 5LKXA 4BW1A 4O7CA 3DAIA 3P1DA 4PY6A 5A83A 5C85A 4GPJA 4WHWA 5TCMA 4FLPA 4QNSA 5AD3A 4LR6A 5FFWA 4YABA 3U5PA 5EP7A 5AD2A 5A7CA 5KTXA 5CGPA 5D3HA 5I40A 4Z6HA 5FG6A 2L84A 3NXBA 5D26A 4CUUA 5D3RA 5L99A 5EWVA 5L97A 4QEUA 4O74A 4BW4A 4BJXA 3O37A 4QBMA 5DW2A 3QZVA 4IR6A 1E6IA 5II1A 3O36A 5A5QA 4HXKA 5D3TA 3O34A 5LKTA 4O71A 4TT4A 5D3JA 5DYXA 3JVKA 5CQTA 5E73A 5C8GA 3U5LA 5D0CA 5I1QA 5A5OA 2DKWA 5BT5A 4ZC9A 4MR5A 5HQ7A 4YH3A 5DYUA 4J0SA 2RO1A 2RNWA 4YBSA 5I89A 5F61A 4HXPA 5I80A 5CRZA 4HXSA 4YYNA 3O35A 3I3JA 4QY4A 4WHUA 3MXFA 4NR9A 3U5JA 3FKMX 5CUEA 4YATA 5E74A 4QUUA 2F6JA 4O7EA 4J1PA 2YW5A 5FH6A 4LRGA 4CUQA 5D3PA 5CTLA 5FE5A 5KO4A 4Y03A 4QSVA 4YYHA 2KTBB 5C7NA 2WP2A 4IOQA 5H1UA 3MB4A 5H85A 5LKUA 2YYNA 3UV2A 4Q0NA 5JI8A 4YC9A 4O75A 4NRAA 5D7XA 5DBMA 3LQHA 4HXOA 5H1VA 4PS5A 2R0SA 4LYIA 4N4GA 4IOOA 4MEOA 4A9NA 5DY7A 2DWWA 2NXBA 2F6NA 4Q0OA 3S91A 4ZQLA 4QC1A 3SVHA 5HRWA 4YYGA 4O7AA 5FE0A 4Z1SA 5CS8A 2YQDA 3UVWA 5JWMA 4YBTA 4CUSA 5EU1A 5FBXA 4TTEA 1X0JA 4NR4A 5KTUA 5D3SA 4TQNA 4NR6A 5LVRA 3UVDA 5DYAA 5HJCA 3IU5A 4YYDA 5A5PA 4UIXA 2E7OA 4A9JA 5F1HA 4KCXA 5CQ3A 4A9EA 5ENBA 4UIYA 5DFDA 1N72A 3MUKA 5AMEA 2YEKA 5TB6A 4YY6A 5ENGA 4Z93A 4QSRA 5HENA 4HBYA 4LDFA 5CQ4A 2RNXA 4LYSA 5FE2A 4OGIA 2OSSA 5L8UA 4KV4A 5BT4A 4OUFA 4UYHA 5F5ZA 4YBMA 5DKHA 5FE9A 5IIDA 5HFQA 4QSWA 2YDWA 4NQMA 5LJ1A 5IGNA 4CLBA 4O72A 1WUGA 5FE1A 5C89A 4TT2A 4NUDA 3HMHA 2GRCA 3QZSA 4QC3A 5ACYA 5F1LA 5G4SA 3QZTA 4TYLA 5A81A 4Z6IA 5EI4A 5ENHA 2OUOA 5LVQA 5FB0A 5E9KA 5CFWA 3GG3A 4A9KA 4HBVA 5CPEA 4A9LA 2R0YA 4KV1A 4N3WA 5FE7A 4A9FA 4CURA 4J3IA 5FFYA 5D3LA 5CY9A 4LZRA 5EPBA 4QUTA 2D9EA 3ONIA 5ENFA 5FG5A 5HM0A 3UVXA 4OGJA 4XY8A 4QEWA 2RS9B 5FE6A 4QSUA 5K29A 5KTWA 1ZS5A 4YK0A 4IR3A 4LC2A 5FE3A 4IR5A 3P1EA 3P5OA 5IBNA 5H1TA 5EWCA 5COIA 5HQ6A 3UW9A 5J0DA 4XYAA 4A9OA 4CUPA 5EM3A 4YAXA 5F3AA 3U5OA 4NYXA 5F62A 5D25A 5LJ0A 4HBXA 5A5SA 2YELA 5F36A 4IORA 4CL9A 5HRXA 4XY9A 4UITA 2DVRA 5CZGA 5E9VA 2I8NA 5IGMA 5DYCA 5FB1A 2D82A 3UV5A 4HXRA 3Q2EA 5ETDA 4C66A 4TU4A 3P1CA 2I7KA 4ZW1A 3D7CA 5D3NA 5FG4A 5I86A 1JSPB 5I7XA 5EPRA 2FSAA 5IGLA 4AKNA 4PCEA 4PTBA 4HBWA 4NXJA 4TT6A 3DWYA 4NYWA 4HXMA 4XUAA 5DKCA 5EGUA 1WUMA 5ENCA 4YYKA 2YEMA 4LZ2A 5ENJA 5CQAA 5D24A 4QB3A 5C87A 2RNYA 5E9IA 4MR6A 4UIWA 5CUBA 5EWWA 3LQIA 5FDZA 5L8TA 5HCLA 2DVVA 3RCWA 4CUTA 3SVGA 5CQ6A 4LYWA 5EISA 4Z1QA 4UIVA 5KU3A 2DVSA 4MR4A 4MEPA 3U5KA 4QZSA 4YYIA 2N9GA 5A82A 5I88A 5EPSA 5HELA 2RI7A 3HMEA 3LXJA 5KHMA 3ZYUA 4YYMA 2L5EA 4YY4A 2R0VA 5DFCA 4C67A 4NYVA 4N4IA 4NRCA 5CP5A 4O76A 4ALHA 4MENA 5I29A 4UIZA 4BW3A 5C4QA 4UYEA 4HXNA 4N4FA 5EV9A 5L96A 5CUAA 5FFVA 4TU6A 4QR5A 3Q2FA 4YYJA 2H60A 4ALGA 5E0RA 4PCIA 5E9YA 3HMFA 5ETBA 5EWHA 5FE4A 5E7DA 5BT3A 5I7YA 3TLPA 5IG6A 4A9IA 5E3GA 5E9MA 1F68A 4O7FA 4CFLA 4NUEA 4X2IA 2LSPB 3AADA 3MULA 4O7BA 5EVAA 4A9HA 5HLSA 4MR3A 4QYDA 5HFRA 5EK9A 5F2PA 2E3KA 1JM4B 2R10A 3LJWA 4NR5A 3U5NA 5AMFA 5LUUA 5CQ7A 3AQAA 5DFBA 3SVFA 4RVRA 5HRVA 4PKLA 5CRMA 5LJ2A 4LZSA 4YADA 5CQ5A 5E3DA 5EICA 5II2A 4HXLA 4QR3A 3JVMA 5F25A 4BW2A 4E96A 4QSSA 2MJVB 2DVQA 5ENEA 5FE8A 5F60A 4IR4A 4CFKA 3UVYA 2OO1A 5LKZA 3JVJA 3LQJA 5CU8A 3G0LA 3MB3A 5DLZA 3G0JA 4O70A 4UYGA
chains in the Genus database with same CATH superfamily
4XUBA 4NS5A 4NUCA 3D1BA 4NQNA 4NR7A 4A9MA 4TZ8A 5ENIA 4O77A 5DX4A 4MEQA 4UYDA 4QR4A 5E9LA 5FH8A 3O33A 3S92A 4J0RA 5HQ5A 2E7NA 2L85A 4UYFB 4NR8A 4O78A 5EQ1A 5F63A 5CQ8A 5L98A 5EWDA 5HEMA 3U5MA 3UV4A 5DW1A 1EQFA 2G4AA 5A5NA 2DATA 5CUCA 5G4RA 4QSTA 4YH4A 3IU6A 3K2JA 4UIUA 3MQMA 5A5RA 5CUDA 2RFJA 4NRBA 5I83A 4BHWA 3JVLA 3P1FA 4QSQA 5DKDA 2WP1A 4F3IA 5FH7A 4QYLA 4N4HA 4QSXA 4UYFA 5CUGA 5DLXA 5EA1A 5IGKA 4TZ2A 4TS8A 4QSPA 4DONA 3ERRA 4QEVA 4WIVA 5A85A 5LKXA 4BW1A 4O7CA 3DAIA 3P1DA 4PY6A 5A83A 5C85A 4GPJA 4WHWA 5TCMA 4FLPA 4QNSA 5AD3A 4LR6A 5FFWA 4YABA 3U5PA 5EP7A 5AD2A 5A7CA 5KTXA 5CGPA 5D3HA 5I40A 4Z6HA 5FG6A 2L84A 1PUOA 3NXBA 5D26A 4CUUA 5D3RA 5L99A 5EWVA 5L97A 4QEUA 4O74A 4BW4A 4BJXA 3VKGA 3O37A 4QBMA 5DW2A 3QZVA 4IR6A 1E6IA 5II1A 3O36A 5A5QA 4HXKA 5D3TA 3O34A 5LKTA 4O71A 4TT4A 5D3JA 5DYXA 3JVKA 5CQTA 5E73A 5C8GA 3U5LA 5D0CA 5I1QA 5A5OA 2DKWA 5BT5A 4ZC9A 4MR5A 5HQ7A 4YH3A 5DYUA 4J0SA 2RO1A 2RNWA 4YBSA 5I89A 5F61A 4AKIA 4HXPA 5I80A 5CRZA 4HXSA 4YYNA 3O35A 3I3JA 4QY4A 4WHUA 3MXFA 4NR9A 3U5JA 3FKMX 5CUEA 4YATA 5E74A 4QUUA 2F6JA 4O7EA 4J1PA 2YW5A 5FH6A 4LRGA 4CUQA 5D3PA 5CTLA 5FE5A 5KO4A 4Y03A 4QSVA 4YYHA 2KTBB 5C7NA 2WP2A 4IOQA 5H1UA 3MB4A 5H85A 5LKUA 2YYNA 3UV2A 4Q0NA 5JI8A 4YC9A 4O75A 4NRAA 5D7XA 5DBMA 3LQHA 4HXOA 5H1VA 4PS5A 2R0SA 4LYIA 4N4GA 4IOOA 4MEOA 4A9NA 5DY7A 2DWWA 2NXBA 2F6NA 4Q0OA 3S91A 4ZQLA 4QC1A 3SVHA 5HRWA 4YYGA 4O7AA 5FE0A 4Z1SA 5CS8A 2YQDA 3UVWA 5JWMA 4YBTA 4CUSA 5EU1A 5FBXA 4TTEA 1X0JA 4NR4A 5KTUA 5D3SA 4TQNA 4NR6A 5LVRA 3UVDA 5DYAA 5HJCA 3IU5A 4YYDA 4AI6A 5A5PA 4UIXA 2E7OA 4A9JA 5F1HA 4KCXA 5CQ3A 4A9EA 5ENBA 4UIYA 5DFDA 1N72A 3MUKA 5AMEA 2YEKA 5TB6A 4YY6A 5ENGA 4Z93A 4QSRA 5HENA 4HBYA 4LDFA 5CQ4A 2RNXA 4LYSA 5FE2A 4OGIA 2OSSA 5L8UA 4KV4A 5BT4A 4OUFA 4UYHA 5F5ZA 4YBMA 5DKHA 5FE9A 5IIDA 5HFQA 4QSWA 1ZKRA 2YDWA 4NQMA 5LJ1A 5IGNA 4CLBA 4O72A 1WUGA 5FE1A 5C89A 4TT2A 4NUDA 3HMHA 2GRCA 3QZSA 4QC3A 5ACYA 5F1LA 5G4SA 3QZTA 4TYLA 5A81A 4Z6IA 5EI4A 5ENHA 2OUOA 5LVQA 5FB0A 5E9KA 5CFWA 3GG3A 4A9KA 4HBVA 5CPEA 4A9LA 2R0YA 4KV1A 4N3WA 5FE7A 4A9FA 4CURA 4J3IA 5FFYA 5D3LA 5CY9A 4LZRA 5EPBA 4QUTA 2D9EA 3ONIA 5ENFA 5FG5A 5HM0A 3UVXA 4OGJA 4XY8A 4QEWA 2RS9B 5FE6A 4QSUA 5K29A 5KTWA 4AKGA 1ZS5A 4YK0A 4IR3A 4LC2A 5FE3A 4IR5A 3P1EA 3P5OA 5IBNA 5H1TA 5EWCA 4AKHA 5COIA 5HQ6A 3UW9A 5J0DA 4XYAA 4A9OA 4CUPA 5EM3A 4YAXA 5F3AA 3U5OA 4NYXA 5F62A 5D25A 5LJ0A 4HBXA 5A5SA 2YELA 5F36A 4IORA 4CL9A 5HRXA 4XY9A 4UITA 2DVRA 5CZGA 5E9VA 2I8NA 5IGMA 5DYCA 5FB1A 2D82A 3UV5A 4HXRA 3Q2EA 5ETDA 4C66A 4TU4A 3P1CA 2I7KA 4ZW1A 3D7CA 5D3NA 5FG4A 5I86A 1JSPB 5I7XA 5EPRA 2FSAA 5IGLA 3D1DA 4AKNA 4PCEA 4PTBA 4HBWA 4NXJA 4TT6A 3DWYA 4NYWA 4HXMA 4XUAA 5DKCA 5EGUA 1WUMA 5ENCA 4YYKA 2YEMA 4LZ2A 5ENJA 5CQAA 5D24A 4QB3A 5C87A 2RNYA 5E9IA 4MR6A 4UIWA 5CUBA 5EWWA 3LQIA 5FDZA 5L8TA 5HCLA 2DVVA 3RCWA 4CUTA 3SVGA 5CQ6A 4LYWA 5EISA 4Z1QA 4UIVA 5KU3A 2DVSA 4MR4A 4MEPA 3U5KA 4QZSA 4YYIA 2N9GA 5A82A 5I88A 5EPSA 5HELA 2RI7A 3HMEA 3VKHA 3LXJA 5KHMA 3ZYUA 4YYMA 2L5EA 4YY4A 2R0VA 5DFCA 4C67A 4NYVA 4N4IA 4NRCA 5CP5A 4O76A 4ALHA 4MENA 5I29A 4UIZA 4BW3A 5C4QA 4UYEA 4HXNA 4N4FA 5EV9A 5L96A 5CUAA 5FFVA 4TU6A 4QR5A 3Q2FA 4YYJA 2H60A 4ALGA 5E0RA 4PCIA 5E9YA 3HMFA 5ETBA 5EWHA 5FE4A 5E7DA 2EJNA 5BT3A 5I7YA 3TLPA 5IG6A 4A9IA 5E3GA 5E9MA 1F68A 4O7FA 4CFLA 4NUEA 4X2IA 2LSPB 3AADA 3MULA 4O7BA 5EVAA 4A9HA 5HLSA 4MR3A 4QYDA 5HFRA 5EK9A 5F2PA 2E3KA 1JM4B 2R10A 3LJWA 4NR5A 3U5NA 5AMFA 5LUUA 5CQ7A 3AQAA 5DFBA 3SVFA 4RVRA 5HRVA 4PKLA 5CRMA 5LJ2A 4LZSA 4YADA 5CQ5A 5E3DA 5EICA 5II2A 4HXLA 4QR3A 3JVMA 5F25A 4BW2A 4E96A 4QSSA 2MJVB 2DVQA 5ENEA 5FE8A 5F60A 4IR4A 4CFKA 3UVYA 2OO1A 5LKZA 3JVJA 3LQJA 5CU8A 3G0LA 3MB3A 5DLZA 3G0JA 4O70A 4UYGA
chains in the Genus database with same CATH topology
4XUBA 4NS5A 4NUCA 4NQNA 4NR7A 4A9MA 4TZ8A 5ENIA 4O77A 5DX4A 4MEQA 4UYDA 4QR4A 5E9LA 5FH8A 3O33A 3S92A 4J0RA 5HQ5A 2E7NA 2L85A 4UYFB 4NR8A 4O78A 5EQ1A 5F63A 5CQ8A 5L98A 5EWDA 5HEMA 3U5MA 3UV4A 5DW1A 1EQFA 2G4AA 5A5NA 2DATA 5CUCA 5G4RA 4QSTA 4YH4A 3IU6A 3K2JA 4UIUA 3MQMA 5A5RA 5CUDA 2RFJA 4NRBA 5I83A 4BHWA 3JVLA 3P1FA 4QSQA 5DKDA 2WP1A 4F3IA 5FH7A 4QYLA 4N4HA 4QSXA 4UYFA 5CUGA 5DLXA 5EA1A 5IGKA 4TZ2A 4TS8A 4QSPA 4DONA 4QEVA 4WIVA 5A85A 5LKXA 4BW1A 4O7CA 3DAIA 3P1DA 4PY6A 5A83A 5C85A 4GPJA 4WHWA 5TCMA 4FLPA 4QNSA 5AD3A 4LR6A 5FFWA 4YABA 3U5PA 5EP7A 5AD2A 5A7CA 5KTXA 5CGPA 5D3HA 5I40A 4Z6HA 5FG6A 2L84A 3NXBA 5D26A 4CUUA 5D3RA 5L99A 5EWVA 5L97A 4QEUA 4O74A 4BW4A 4BJXA 3O37A 4QBMA 5DW2A 3QZVA 4IR6A 1E6IA 5II1A 3O36A 5A5QA 4HXKA 5D3TA 3O34A 5LKTA 4O71A 4TT4A 5D3JA 5DYXA 3JVKA 5CQTA 5E73A 5C8GA 3U5LA 5D0CA 5I1QA 5A5OA 2DKWA 5BT5A 4ZC9A 4MR5A 5HQ7A 4YH3A 5DYUA 4J0SA 2RO1A 2RNWA 4YBSA 5I89A 5F61A 4HXPA 5I80A 5CRZA 4HXSA 4YYNA 3O35A 3I3JA 4QY4A 4WHUA 3MXFA 4NR9A 3U5JA 3FKMX 5CUEA 4YATA 5E74A 4QUUA 2F6JA 4O7EA 4J1PA 2YW5A 5FH6A 4LRGA 4CUQA 5D3PA 5CTLA 5FE5A 5KO4A 4Y03A 4QSVA 4YYHA 2KTBB 5C7NA 2WP2A 4IOQA 5H1UA 3MB4A 5H85A 5LKUA 2YYNA 3UV2A 4Q0NA 5JI8A 4YC9A 4O75A 4NRAA 5D7XA 5DBMA 3LQHA 4HXOA 5H1VA 4PS5A 2R0SA 4LYIA 4N4GA 4IOOA 4MEOA 4A9NA 5DY7A 2DWWA 2NXBA 2F6NA 4Q0OA 3S91A 4ZQLA 4QC1A 3SVHA 5HRWA 4YYGA 4O7AA 5FE0A 4Z1SA 5CS8A 2YQDA 3UVWA 5JWMA 4YBTA 4CUSA 5EU1A 5FBXA 4TTEA 1X0JA 4NR4A 5KTUA 5D3SA 4TQNA 4NR6A 5LVRA 3UVDA 5DYAA 5HJCA 3IU5A 4YYDA 5A5PA 4UIXA 2E7OA 4A9JA 5F1HA 4KCXA 5CQ3A 4A9EA 5ENBA 4UIYA 5DFDA 1N72A 3MUKA 5AMEA 2YEKA 5TB6A 4YY6A 5ENGA 4Z93A 4QSRA 5HENA 4HBYA 4LDFA 5CQ4A 2RNXA 4LYSA 5FE2A 4OGIA 2OSSA 5L8UA 4KV4A 5BT4A 4OUFA 4UYHA 5F5ZA 4YBMA 5DKHA 5FE9A 5IIDA 5HFQA 4QSWA 2YDWA 4NQMA 5LJ1A 5IGNA 4CLBA 4O72A 1WUGA 5FE1A 5C89A 4TT2A 4NUDA 3HMHA 2GRCA 3QZSA 4QC3A 5ACYA 5F1LA 5G4SA 3QZTA 4TYLA 5A81A 4Z6IA 5EI4A 5ENHA 2OUOA 5LVQA 5FB0A 5E9KA 5CFWA 3GG3A 4A9KA 4HBVA 5CPEA 4A9LA 2R0YA 4KV1A 4N3WA 5FE7A 4A9FA 4CURA 4J3IA 5FFYA 5D3LA 5CY9A 4LZRA 5EPBA 4QUTA 2D9EA 3ONIA 5ENFA 5FG5A 5HM0A 3UVXA 4OGJA 4XY8A 4QEWA 2RS9B 5FE6A 4QSUA 5K29A 5KTWA 1ZS5A 4YK0A 4IR3A 4LC2A 5FE3A 4IR5A 3P1EA 3P5OA 5IBNA 5H1TA 5EWCA 5COIA 5HQ6A 3UW9A 5J0DA 4XYAA 4A9OA 4CUPA 5EM3A 4YAXA 5F3AA 3U5OA 4NYXA 5F62A 5D25A 5LJ0A 4HBXA 5A5SA 2YELA 5F36A 4IORA 4CL9A 5HRXA 4XY9A 4UITA 2DVRA 5CZGA 5E9VA 2I8NA 5IGMA 5DYCA 5FB1A 2D82A 3UV5A 4HXRA 3Q2EA 5ETDA 4C66A 4TU4A 3P1CA 2I7KA 4ZW1A 3D7CA 5D3NA 5FG4A 5I86A 1JSPB 5I7XA 5EPRA 2FSAA 5IGLA 4AKNA 4PCEA 4PTBA 4HBWA 4NXJA 4TT6A 3DWYA 4NYWA 4HXMA 4XUAA 5DKCA 5EGUA 1WUMA 5ENCA 4YYKA 2YEMA 4LZ2A 5ENJA 5CQAA 5D24A 4QB3A 5C87A 2RNYA 5E9IA 4MR6A 4UIWA 5CUBA 5EWWA 3LQIA 5FDZA 5L8TA 5HCLA 2DVVA 3RCWA 4CUTA 3SVGA 5CQ6A 4LYWA 5EISA 4Z1QA 4UIVA 5KU3A 2DVSA 4MR4A 4MEPA 3U5KA 4QZSA 4YYIA 2N9GA 5A82A 5I88A 5EPSA 5HELA 2RI7A 3HMEA 3LXJA 5KHMA 3ZYUA 4YYMA 2L5EA 4YY4A 2R0VA 5DFCA 4C67A 4NYVA 4N4IA 4NRCA 5CP5A 4O76A 4ALHA 4MENA 5I29A 4UIZA 4BW3A 5C4QA 4UYEA 4HXNA 4N4FA 5EV9A 5L96A 5CUAA 5FFVA 4TU6A 4QR5A 3Q2FA 4YYJA 2H60A 4ALGA 5E0RA 4PCIA 5E9YA 3HMFA 5ETBA 5EWHA 5FE4A 5E7DA 5BT3A 5I7YA 3TLPA 5IG6A 4A9IA 5E3GA 5E9MA 1F68A 4O7FA 4CFLA 4NUEA 4X2IA 2LSPB 3AADA 3MULA 4O7BA 5EVAA 4A9HA 5HLSA 4MR3A 4QYDA 5HFRA 5EK9A 5F2PA 2E3KA 1JM4B 2R10A 3LJWA 4NR5A 3U5NA 5AMFA 5LUUA 5CQ7A 3AQAA 5DFBA 3SVFA 4RVRA 5HRVA 4PKLA 5CRMA 5LJ2A 4LZSA 4YADA 5CQ5A 5E3DA 5EICA 5II2A 4HXLA 4QR3A 3JVMA 5F25A 4BW2A 4E96A 4QSSA 2MJVB 2DVQA 5ENEA 5FE8A 5F60A 4IR4A 4CFKA 3UVYA 2OO1A 5LKZA 3JVJA 3LQJA 5CU8A 3G0LA 3MB3A 5DLZA 3G0JA 4O70A 4UYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUB A;  4NS5 A;  4NUC A;  4NQN A;  4NR7 A;  4A9M A;  4TZ8 A;  5ENI A;  4O77 A;  5DX4 A;  4MEQ A;  4UYD A;  4QR4 A;  5E9L A;  5FH8 A;  3O33 A;  3S92 A;  4J0R A;  5HQ5 A;  2E7N A;  2L85 A;  4UYF B;  4NR8 A;  4O78 A;  5EQ1 A;  5F63 A;  5CQ8 A;  5L98 A;  5EWD A;  5HEM A;  3U5M A;  3UV4 A;  5DW1 A;  1EQF A;  2G4A A;  5A5N A;  2DAT A;  5CUC A;  5G4R A;  4QST A;  4YH4 A;  3IU6 A;  3K2J A;  4UIU A;  3MQM A;  5A5R A;  5CUD A;  2RFJ A;  4NRB A;  5I83 A;  4BHW A;  3JVL A;  3P1F A;  4QSQ A;  5DKD A;  2WP1 A;  4F3I A;  5FH7 A;  4QYL A;  4N4H A;  4QSX A;  4UYF A;  5CUG A;  5DLX A;  5EA1 A;  5IGK A;  4TZ2 A;  4TS8 A;  4QSP A;  4DON A;  4QEV A;  4WIV A;  5A85 A;  5LKX A;  4BW1 A;  4O7C A;  3DAI A;  3P1D A;  4PY6 A;  5A83 A;  5C85 A;  4GPJ A;  4WHW A;  5TCM A;  4FLP A;  4QNS A;  5AD3 A;  4LR6 A;  5FFW A;  4YAB A;  3U5P A;  5EP7 A;  5AD2 A;  5A7C A;  5KTX A;  5CGP A;  5D3H A;  5I40 A;  4Z6H A;  5FG6 A;  2L84 A;  3NXB A;  5D26 A;  4CUU A;  5D3R A;  5L99 A;  5EWV A;  5L97 A;  4QEU A;  4O74 A;  4BW4 A;  4BJX A;  3O37 A;  4QBM A;  5DW2 A;  3QZV A;  4IR6 A;  1E6I A;  5II1 A;  3O36 A;  5A5Q A;  4HXK A;  5D3T A;  3O34 A;  5LKT A;  4O71 A;  4TT4 A;  5D3J A;  5DYX A;  3JVK A;  5CQT A;  5E73 A;  5C8G A;  3U5L A;  5D0C A;  5I1Q A;  5A5O A;  2DKW A;  5BT5 A;  4ZC9 A;  4MR5 A;  5HQ7 A;  4YH3 A;  5DYU A;  4J0S A;  2RO1 A;  2RNW A;  4YBS A;  5I89 A;  5F61 A;  4HXP A;  5I80 A;  5CRZ A;  4HXS A;  4YYN A;  3O35 A;  3I3J A;  4QY4 A;  4WHU A;  3MXF A;  4NR9 A;  3U5J A;  3FKM X;  5CUE A;  4YAT A;  5E74 A;  4QUU A;  2F6J A;  4O7E A;  4J1P A;  2YW5 A;  5FH6 A;  4LRG A;  4CUQ A;  5D3P A;  5CTL A;  5FE5 A;  5KO4 A;  4Y03 A;  4QSV A;  4YYH A;  2KTB B;  5C7N A;  2WP2 A;  4IOQ A;  5H1U A;  3MB4 A;  5H85 A;  5LKU A;  2YYN A;  3UV2 A;  4Q0N A;  5JI8 A;  4YC9 A;  4O75 A;  4NRA A;  5D7X A;  5DBM A;  3LQH A;  4HXO A;  5H1V A;  4PS5 A;  2R0S A;  4LYI A;  4N4G A;  4IOO A;  4MEO A;  4A9N A;  5DY7 A;  2DWW A;  2NXB A;  2F6N A;  4Q0O A;  3S91 A;  4ZQL A;  4QC1 A;  3SVH A;  5HRW A;  4YYG A;  4O7A A;  5FE0 A;  4Z1S A;  5CS8 A;  2YQD A;  3UVW A;  5JWM A;  4YBT A;  4CUS A;  5EU1 A;  5FBX A;  4TTE A;  1X0J A;  4NR4 A;  5KTU A;  5D3S A;  4TQN A;  4NR6 A;  5LVR A;  3UVD A;  5DYA A;  5HJC A;  3IU5 A;  4YYD A;  5A5P A;  4UIX A;  2E7O A;  4A9J A;  5F1H A;  4KCX A;  5CQ3 A;  4A9E A;  5ENB A;  4UIY A;  5DFD A;  1N72 A;  3MUK A;  5AME A;  2YEK A;  5TB6 A;  4YY6 A;  5ENG A;  4Z93 A;  4QSR A;  5HEN A;  4HBY A;  4LDF A;  5CQ4 A;  2RNX A;  4LYS A;  5FE2 A;  4OGI A;  2OSS A;  5L8U A;  4KV4 A;  5BT4 A;  4OUF A;  4UYH A;  5F5Z A;  4YBM A;  5DKH A;  5FE9 A;  5IID A;  5HFQ A;  4QSW A;  2YDW A;  4NQM A;  5LJ1 A;  5IGN A;  4CLB A;  4O72 A;  1WUG A;  5FE1 A;  5C89 A;  4TT2 A;  4NUD A;  3HMH A;  2GRC A;  3QZS A;  4QC3 A;  5ACY A;  5F1L A;  5G4S A;  3QZT A;  4TYL A;  5A81 A;  4Z6I A;  5EI4 A;  5ENH A;  2OUO A;  5LVQ A;  5FB0 A;  5E9K A;  5CFW A;  3GG3 A;  4A9K A;  4HBV A;  5CPE A;  4A9L A;  2R0Y A;  4KV1 A;  4N3W A;  5FE7 A;  4A9F A;  4CUR A;  4J3I A;  5FFY A;  5D3L A;  5CY9 A;  4LZR A;  5EPB A;  4QUT A;  2D9E A;  3ONI A;  5ENF A;  5FG5 A;  5HM0 A;  3UVX A;  4OGJ A;  4XY8 A;  4QEW A;  2RS9 B;  5FE6 A;  4QSU A;  5K29 A;  5KTW A;  1ZS5 A;  4YK0 A;  4IR3 A;  4LC2 A;  5FE3 A;  4IR5 A;  3P1E A;  3P5O A;  5IBN A;  5H1T A;  5EWC A;  5COI A;  5HQ6 A;  3UW9 A;  5J0D A;  4XYA A;  4A9O A;  4CUP A;  5EM3 A;  4YAX A;  5F3A A;  3U5O A;  4NYX A;  5F62 A;  5D25 A;  5LJ0 A;  4HBX A;  5A5S A;  2YEL A;  5F36 A;  4IOR A;  4CL9 A;  5HRX A;  4XY9 A;  4UIT A;  2DVR A;  5CZG A;  5E9V A;  2I8N A;  5IGM A;  5DYC A;  5FB1 A;  2D82 A;  3UV5 A;  4HXR A;  3Q2E A;  5ETD A;  4C66 A;  4TU4 A;  3P1C A;  2I7K A;  4ZW1 A;  3D7C A;  5D3N A;  5FG4 A;  5I86 A;  1JSP B;  5I7X A;  5EPR A;  2FSA A;  5IGL A;  4AKN A;  4PCE A;  4PTB A;  4HBW A;  4NXJ A;  4TT6 A;  3DWY A;  4NYW A;  4HXM A;  4XUA A;  5DKC A;  5EGU A;  1WUM A;  5ENC A;  4YYK A;  2YEM A;  4LZ2 A;  5ENJ A;  5CQA A;  5D24 A;  4QB3 A;  5C87 A;  2RNY A;  5E9I A;  4MR6 A;  4UIW A;  5CUB A;  5EWW A;  3LQI A;  5FDZ A;  5L8T A;  5HCL A;  2DVV A;  3RCW A;  4CUT A;  3SVG A;  5CQ6 A;  4LYW A;  5EIS A;  4Z1Q A;  4UIV A;  5KU3 A;  2DVS A;  4MR4 A;  4MEP A;  3U5K A;  4QZS A;  4YYI A;  2N9G A;  5A82 A;  5I88 A;  5EPS A;  5HEL A;  2RI7 A;  3HME A;  3LXJ A;  5KHM A;  3ZYU A;  4YYM A;  2L5E A;  4YY4 A;  2R0V A;  5DFC A;  4C67 A;  4NYV A;  4N4I A;  4NRC A;  5CP5 A;  4O76 A;  4ALH A;  4MEN A;  5I29 A;  4UIZ A;  4BW3 A;  5C4Q A;  4UYE A;  4HXN A;  4N4F A;  5EV9 A;  5L96 A;  5CUA A;  5FFV A;  4TU6 A;  4QR5 A;  3Q2F A;  4YYJ A;  2H60 A;  4ALG A;  5E0R A;  4PCI A;  5E9Y A;  3HMF A;  5ETB A;  5EWH A;  5FE4 A;  5E7D A;  5BT3 A;  5I7Y A;  3TLP A;  5IG6 A;  4A9I A;  5E3G A;  5E9M A;  1F68 A;  4O7F A;  4CFL A;  4NUE A;  4X2I A;  2LSP B;  3AAD A;  3MUL A;  4O7B A;  5EVA A;  4A9H A;  5HLS A;  4MR3 A;  4QYD A;  5HFR A;  5EK9 A;  5F2P A;  2E3K A;  1JM4 B;  2R10 A;  3LJW A;  4NR5 A;  3U5N A;  5AMF A;  5LUU A;  5CQ7 A;  3AQA A;  5DFB A;  3SVF A;  4RVR A;  5HRV A;  4PKL A;  5CRM A;  5LJ2 A;  4LZS A;  4YAD A;  5CQ5 A;  5E3D A;  5EIC A;  5II2 A;  4HXL A;  4QR3 A;  3JVM A;  5F25 A;  4BW2 A;  4E96 A;  4QSS A;  2MJV B;  2DVQ A;  5ENE A;  5FE8 A;  5F60 A;  4IR4 A;  4CFK A;  3UVY A;  2OO1 A;  5LKZ A;  3JVJ A;  3LQJ A;  5CU8 A;  3G0L A;  3MB3 A;  5DLZ A;  3G0J A;  4O70 A;  4UYG A; 
#chains in the Genus database with same CATH topology
 4XUB A;  4NS5 A;  4NUC A;  3D1B A;  4NQN A;  4NR7 A;  4A9M A;  4TZ8 A;  5ENI A;  4O77 A;  5DX4 A;  4MEQ A;  4UYD A;  4QR4 A;  5E9L A;  5FH8 A;  3O33 A;  3S92 A;  4J0R A;  5HQ5 A;  2E7N A;  2L85 A;  4UYF B;  4NR8 A;  4O78 A;  5EQ1 A;  5F63 A;  5CQ8 A;  5L98 A;  5EWD A;  5HEM A;  3U5M A;  3UV4 A;  5DW1 A;  1EQF A;  2G4A A;  5A5N A;  2DAT A;  5CUC A;  5G4R A;  4QST A;  4YH4 A;  3IU6 A;  3K2J A;  4UIU A;  3MQM A;  5A5R A;  5CUD A;  2RFJ A;  4NRB A;  5I83 A;  4BHW A;  3JVL A;  3P1F A;  4QSQ A;  5DKD A;  2WP1 A;  4F3I A;  5FH7 A;  4QYL A;  4N4H A;  4QSX A;  4UYF A;  5CUG A;  5DLX A;  5EA1 A;  5IGK A;  4TZ2 A;  4TS8 A;  4QSP A;  4DON A;  3ERR A;  4QEV A;  4WIV A;  5A85 A;  5LKX A;  4BW1 A;  4O7C A;  3DAI A;  3P1D A;  4PY6 A;  5A83 A;  5C85 A;  4GPJ A;  4WHW A;  5TCM A;  4FLP A;  4QNS A;  5AD3 A;  4LR6 A;  5FFW A;  4YAB A;  3U5P A;  5EP7 A;  5AD2 A;  5A7C A;  5KTX A;  5CGP A;  5D3H A;  5I40 A;  4Z6H A;  5FG6 A;  2L84 A;  1PUO A;  3NXB A;  5D26 A;  4CUU A;  5D3R A;  5L99 A;  5EWV A;  5L97 A;  4QEU A;  4O74 A;  4BW4 A;  4BJX A;  3VKG A;  3O37 A;  4QBM A;  5DW2 A;  3QZV A;  4IR6 A;  1E6I A;  5II1 A;  3O36 A;  5A5Q A;  4HXK A;  5D3T A;  3O34 A;  5LKT A;  4O71 A;  4TT4 A;  5D3J A;  5DYX A;  3JVK A;  5CQT A;  5E73 A;  5C8G A;  3U5L A;  5D0C A;  5I1Q A;  5A5O A;  2DKW A;  5BT5 A;  4ZC9 A;  4MR5 A;  5HQ7 A;  4YH3 A;  5DYU A;  4J0S A;  2RO1 A;  2RNW A;  4YBS A;  5I89 A;  5F61 A;  4AKI A;  4HXP A;  5I80 A;  5CRZ A;  4HXS A;  4YYN A;  3O35 A;  3I3J A;  4QY4 A;  4WHU A;  3MXF A;  4NR9 A;  3U5J A;  3FKM X;  5CUE A;  4YAT A;  5E74 A;  4QUU A;  2F6J A;  4O7E A;  4J1P A;  2YW5 A;  5FH6 A;  4LRG A;  4CUQ A;  5D3P A;  5CTL A;  5FE5 A;  5KO4 A;  4Y03 A;  4QSV A;  4YYH A;  2KTB B;  5C7N A;  2WP2 A;  4IOQ A;  5H1U A;  3MB4 A;  5H85 A;  5LKU A;  2YYN A;  3UV2 A;  4Q0N A;  5JI8 A;  4YC9 A;  4O75 A;  4NRA A;  5D7X A;  5DBM A;  3LQH A;  4HXO A;  5H1V A;  4PS5 A;  2R0S A;  4LYI A;  4N4G A;  4IOO A;  4MEO A;  4A9N A;  5DY7 A;  2DWW A;  2NXB A;  2F6N A;  4Q0O A;  3S91 A;  4ZQL A;  4QC1 A;  3SVH A;  5HRW A;  4YYG A;  4O7A A;  5FE0 A;  4Z1S A;  5CS8 A;  2YQD A;  3UVW A;  5JWM A;  4YBT A;  4CUS A;  5EU1 A;  5FBX A;  4TTE A;  1X0J A;  4NR4 A;  5KTU A;  5D3S A;  4TQN A;  4NR6 A;  5LVR A;  3UVD A;  5DYA A;  5HJC A;  3IU5 A;  4YYD A;  4AI6 A;  5A5P A;  4UIX A;  2E7O A;  4A9J A;  5F1H A;  4KCX A;  5CQ3 A;  4A9E A;  5ENB A;  4UIY A;  5DFD A;  1N72 A;  3MUK A;  5AME A;  2YEK A;  5TB6 A;  4YY6 A;  5ENG A;  4Z93 A;  4QSR A;  5HEN A;  4HBY A;  4LDF A;  5CQ4 A;  2RNX A;  4LYS A;  5FE2 A;  4OGI A;  2OSS A;  5L8U A;  4KV4 A;  5BT4 A;  4OUF A;  4UYH A;  5F5Z A;  4YBM A;  5DKH A;  5FE9 A;  5IID A;  5HFQ A;  4QSW A;  1ZKR A;  2YDW A;  4NQM A;  5LJ1 A;  5IGN A;  4CLB A;  4O72 A;  1WUG A;  5FE1 A;  5C89 A;  4TT2 A;  4NUD A;  3HMH A;  2GRC A;  3QZS A;  4QC3 A;  5ACY A;  5F1L A;  5G4S A;  3QZT A;  4TYL A;  5A81 A;  4Z6I A;  5EI4 A;  5ENH A;  2OUO A;  5LVQ A;  5FB0 A;  5E9K A;  5CFW A;  3GG3 A;  4A9K A;  4HBV A;  5CPE A;  4A9L A;  2R0Y A;  4KV1 A;  4N3W A;  5FE7 A;  4A9F A;  4CUR A;  4J3I A;  5FFY A;  5D3L A;  5CY9 A;  4LZR A;  5EPB A;  4QUT A;  2D9E A;  3ONI A;  5ENF A;  5FG5 A;  5HM0 A;  3UVX A;  4OGJ A;  4XY8 A;  4QEW A;  2RS9 B;  5FE6 A;  4QSU A;  5K29 A;  5KTW A;  4AKG A;  1ZS5 A;  4YK0 A;  4IR3 A;  4LC2 A;  5FE3 A;  4IR5 A;  3P1E A;  3P5O A;  5IBN A;  5H1T A;  5EWC A;  4AKH A;  5COI A;  5HQ6 A;  3UW9 A;  5J0D A;  4XYA A;  4A9O A;  4CUP A;  5EM3 A;  4YAX A;  5F3A A;  3U5O A;  4NYX A;  5F62 A;  5D25 A;  5LJ0 A;  4HBX A;  5A5S A;  2YEL A;  5F36 A;  4IOR A;  4CL9 A;  5HRX A;  4XY9 A;  4UIT A;  2DVR A;  5CZG A;  5E9V A;  2I8N A;  5IGM A;  5DYC A;  5FB1 A;  2D82 A;  3UV5 A;  4HXR A;  3Q2E A;  5ETD A;  4C66 A;  4TU4 A;  3P1C A;  2I7K A;  4ZW1 A;  3D7C A;  5D3N A;  5FG4 A;  5I86 A;  1JSP B;  5I7X A;  5EPR A;  2FSA A;  5IGL A;  3D1D A;  4AKN A;  4PCE A;  4PTB A;  4HBW A;  4NXJ A;  4TT6 A;  3DWY A;  4NYW A;  4HXM A;  4XUA A;  5DKC A;  5EGU A;  1WUM A;  5ENC A;  4YYK A;  2YEM A;  4LZ2 A;  5ENJ A;  5CQA A;  5D24 A;  4QB3 A;  5C87 A;  2RNY A;  5E9I A;  4MR6 A;  4UIW A;  5CUB A;  5EWW A;  3LQI A;  5FDZ A;  5L8T A;  5HCL A;  2DVV A;  3RCW A;  4CUT A;  3SVG A;  5CQ6 A;  4LYW A;  5EIS A;  4Z1Q A;  4UIV A;  5KU3 A;  2DVS A;  4MR4 A;  4MEP A;  3U5K A;  4QZS A;  4YYI A;  2N9G A;  5A82 A;  5I88 A;  5EPS A;  5HEL A;  2RI7 A;  3HME A;  3VKH A;  3LXJ A;  5KHM A;  3ZYU A;  4YYM A;  2L5E A;  4YY4 A;  2R0V A;  5DFC A;  4C67 A;  4NYV A;  4N4I A;  4NRC A;  5CP5 A;  4O76 A;  4ALH A;  4MEN A;  5I29 A;  4UIZ A;  4BW3 A;  5C4Q A;  4UYE A;  4HXN A;  4N4F A;  5EV9 A;  5L96 A;  5CUA A;  5FFV A;  4TU6 A;  4QR5 A;  3Q2F A;  4YYJ A;  2H60 A;  4ALG A;  5E0R A;  4PCI A;  5E9Y A;  3HMF A;  5ETB A;  5EWH A;  5FE4 A;  5E7D A;  2EJN A;  5BT3 A;  5I7Y A;  3TLP A;  5IG6 A;  4A9I A;  5E3G A;  5E9M A;  1F68 A;  4O7F A;  4CFL A;  4NUE A;  4X2I A;  2LSP B;  3AAD A;  3MUL A;  4O7B A;  5EVA A;  4A9H A;  5HLS A;  4MR3 A;  4QYD A;  5HFR A;  5EK9 A;  5F2P A;  2E3K A;  1JM4 B;  2R10 A;  3LJW A;  4NR5 A;  3U5N A;  5AMF A;  5LUU A;  5CQ7 A;  3AQA A;  5DFB A;  3SVF A;  4RVR A;  5HRV A;  4PKL A;  5CRM A;  5LJ2 A;  4LZS A;  4YAD A;  5CQ5 A;  5E3D A;  5EIC A;  5II2 A;  4HXL A;  4QR3 A;  3JVM A;  5F25 A;  4BW2 A;  4E96 A;  4QSS A;  2MJV B;  2DVQ A;  5ENE A;  5FE8 A;  5F60 A;  4IR4 A;  4CFK A;  3UVY A;  2OO1 A;  5LKZ A;  3JVJ A;  3LQJ A;  5CU8 A;  3G0L A;  3MB3 A;  5DLZ A;  3G0J A;  4O70 A;  4UYG A; 
#chains in the Genus database with same CATH homology
 4XUB A;  4NS5 A;  4NUC A;  4NQN A;  4NR7 A;  4A9M A;  4TZ8 A;  5ENI A;  4O77 A;  5DX4 A;  4MEQ A;  4UYD A;  4QR4 A;  5E9L A;  5FH8 A;  3O33 A;  3S92 A;  4J0R A;  5HQ5 A;  2E7N A;  2L85 A;  4UYF B;  4NR8 A;  4O78 A;  5EQ1 A;  5F63 A;  5CQ8 A;  5L98 A;  5EWD A;  5HEM A;  3U5M A;  3UV4 A;  5DW1 A;  1EQF A;  2G4A A;  5A5N A;  2DAT A;  5CUC A;  5G4R A;  4QST A;  4YH4 A;  3IU6 A;  3K2J A;  4UIU A;  3MQM A;  5A5R A;  5CUD A;  2RFJ A;  4NRB A;  5I83 A;  4BHW A;  3JVL A;  3P1F A;  4QSQ A;  5DKD A;  2WP1 A;  4F3I A;  5FH7 A;  4QYL A;  4N4H A;  4QSX A;  4UYF A;  5CUG A;  5DLX A;  5EA1 A;  5IGK A;  4TZ2 A;  4TS8 A;  4QSP A;  4DON A;  4QEV A;  4WIV A;  5A85 A;  5LKX A;  4BW1 A;  4O7C A;  3DAI A;  3P1D A;  4PY6 A;  5A83 A;  5C85 A;  4GPJ A;  4WHW A;  5TCM A;  4FLP A;  4QNS A;  5AD3 A;  4LR6 A;  5FFW A;  4YAB A;  3U5P A;  5EP7 A;  5AD2 A;  5A7C A;  5KTX A;  5CGP A;  5D3H A;  5I40 A;  4Z6H A;  5FG6 A;  2L84 A;  3NXB A;  5D26 A;  4CUU A;  5D3R A;  5L99 A;  5EWV A;  5L97 A;  4QEU A;  4O74 A;  4BW4 A;  4BJX A;  3O37 A;  4QBM A;  5DW2 A;  3QZV A;  4IR6 A;  1E6I A;  5II1 A;  3O36 A;  5A5Q A;  4HXK A;  5D3T A;  3O34 A;  5LKT A;  4O71 A;  4TT4 A;  5D3J A;  5DYX A;  3JVK A;  5CQT A;  5E73 A;  5C8G A;  3U5L A;  5D0C A;  5I1Q A;  5A5O A;  2DKW A;  5BT5 A;  4ZC9 A;  4MR5 A;  5HQ7 A;  4YH3 A;  5DYU A;  4J0S A;  2RO1 A;  2RNW A;  4YBS A;  5I89 A;  5F61 A;  4HXP A;  5I80 A;  5CRZ A;  4HXS A;  4YYN A;  3O35 A;  3I3J A;  4QY4 A;  4WHU A;  3MXF A;  4NR9 A;  3U5J A;  3FKM X;  5CUE A;  4YAT A;  5E74 A;  4QUU A;  2F6J A;  4O7E A;  4J1P A;  2YW5 A;  5FH6 A;  4LRG A;  4CUQ A;  5D3P A;  5CTL A;  5FE5 A;  5KO4 A;  4Y03 A;  4QSV A;  4YYH A;  2KTB B;  5C7N A;  2WP2 A;  4IOQ A;  5H1U A;  3MB4 A;  5H85 A;  5LKU A;  2YYN A;  3UV2 A;  4Q0N A;  5JI8 A;  4YC9 A;  4O75 A;  4NRA A;  5D7X A;  5DBM A;  3LQH A;  4HXO A;  5H1V A;  4PS5 A;  2R0S A;  4LYI A;  4N4G A;  4IOO A;  4MEO A;  4A9N A;  5DY7 A;  2DWW A;  2NXB A;  2F6N A;  4Q0O A;  3S91 A;  4ZQL A;  4QC1 A;  3SVH A;  5HRW A;  4YYG A;  4O7A A;  5FE0 A;  4Z1S A;  5CS8 A;  2YQD A;  3UVW A;  5JWM A;  4YBT A;  4CUS A;  5EU1 A;  5FBX A;  4TTE A;  1X0J A;  4NR4 A;  5KTU A;  5D3S A;  4TQN A;  4NR6 A;  5LVR A;  3UVD A;  5DYA A;  5HJC A;  3IU5 A;  4YYD A;  5A5P A;  4UIX A;  2E7O A;  4A9J A;  5F1H A;  4KCX A;  5CQ3 A;  4A9E A;  5ENB A;  4UIY A;  5DFD A;  1N72 A;  3MUK A;  5AME A;  2YEK A;  5TB6 A;  4YY6 A;  5ENG A;  4Z93 A;  4QSR A;  5HEN A;  4HBY A;  4LDF A;  5CQ4 A;  2RNX A;  4LYS A;  5FE2 A;  4OGI A;  2OSS A;  5L8U A;  4KV4 A;  5BT4 A;  4OUF A;  4UYH A;  5F5Z A;  4YBM A;  5DKH A;  5FE9 A;  5IID A;  5HFQ A;  4QSW A;  2YDW A;  4NQM A;  5LJ1 A;  5IGN A;  4CLB A;  4O72 A;  1WUG A;  5FE1 A;  5C89 A;  4TT2 A;  4NUD A;  3HMH A;  2GRC A;  3QZS A;  4QC3 A;  5ACY A;  5F1L A;  5G4S A;  3QZT A;  4TYL A;  5A81 A;  4Z6I A;  5EI4 A;  5ENH A;  2OUO A;  5LVQ A;  5FB0 A;  5E9K A;  5CFW A;  3GG3 A;  4A9K A;  4HBV A;  5CPE A;  4A9L A;  2R0Y A;  4KV1 A;  4N3W A;  5FE7 A;  4A9F A;  4CUR A;  4J3I A;  5FFY A;  5D3L A;  5CY9 A;  4LZR A;  5EPB A;  4QUT A;  2D9E A;  3ONI A;  5ENF A;  5FG5 A;  5HM0 A;  3UVX A;  4OGJ A;  4XY8 A;  4QEW A;  2RS9 B;  5FE6 A;  4QSU A;  5K29 A;  5KTW A;  1ZS5 A;  4YK0 A;  4IR3 A;  4LC2 A;  5FE3 A;  4IR5 A;  3P1E A;  3P5O A;  5IBN A;  5H1T A;  5EWC A;  5COI A;  5HQ6 A;  3UW9 A;  5J0D A;  4XYA A;  4A9O A;  4CUP A;  5EM3 A;  4YAX A;  5F3A A;  3U5O A;  4NYX A;  5F62 A;  5D25 A;  5LJ0 A;  4HBX A;  5A5S A;  2YEL A;  5F36 A;  4IOR A;  4CL9 A;  5HRX A;  4XY9 A;  4UIT A;  2DVR A;  5CZG A;  5E9V A;  2I8N A;  5IGM A;  5DYC A;  5FB1 A;  2D82 A;  3UV5 A;  4HXR A;  3Q2E A;  5ETD A;  4C66 A;  4TU4 A;  3P1C A;  2I7K A;  4ZW1 A;  3D7C A;  5D3N A;  5FG4 A;  5I86 A;  1JSP B;  5I7X A;  5EPR A;  2FSA A;  5IGL A;  4AKN A;  4PCE A;  4PTB A;  4HBW A;  4NXJ A;  4TT6 A;  3DWY A;  4NYW A;  4HXM A;  4XUA A;  5DKC A;  5EGU A;  1WUM A;  5ENC A;  4YYK A;  2YEM A;  4LZ2 A;  5ENJ A;  5CQA A;  5D24 A;  4QB3 A;  5C87 A;  2RNY A;  5E9I A;  4MR6 A;  4UIW A;  5CUB A;  5EWW A;  3LQI A;  5FDZ A;  5L8T A;  5HCL A;  2DVV A;  3RCW A;  4CUT A;  3SVG A;  5CQ6 A;  4LYW A;  5EIS A;  4Z1Q A;  4UIV A;  5KU3 A;  2DVS A;  4MR4 A;  4MEP A;  3U5K A;  4QZS A;  4YYI A;  2N9G A;  5A82 A;  5I88 A;  5EPS A;  5HEL A;  2RI7 A;  3HME A;  3LXJ A;  5KHM A;  3ZYU A;  4YYM A;  2L5E A;  4YY4 A;  2R0V A;  5DFC A;  4C67 A;  4NYV A;  4N4I A;  4NRC A;  5CP5 A;  4O76 A;  4ALH A;  4MEN A;  5I29 A;  4UIZ A;  4BW3 A;  5C4Q A;  4UYE A;  4HXN A;  4N4F A;  5EV9 A;  5L96 A;  5CUA A;  5FFV A;  4TU6 A;  4QR5 A;  3Q2F A;  4YYJ A;  2H60 A;  4ALG A;  5E0R A;  4PCI A;  5E9Y A;  3HMF A;  5ETB A;  5EWH A;  5FE4 A;  5E7D A;  5BT3 A;  5I7Y A;  3TLP A;  5IG6 A;  4A9I A;  5E3G A;  5E9M A;  1F68 A;  4O7F A;  4CFL A;  4NUE A;  4X2I A;  2LSP B;  3AAD A;  3MUL A;  4O7B A;  5EVA A;  4A9H A;  5HLS A;  4MR3 A;  4QYD A;  5HFR A;  5EK9 A;  5F2P A;  2E3K A;  1JM4 B;  2R10 A;  3LJW A;  4NR5 A;  3U5N A;  5AMF A;  5LUU A;  5CQ7 A;  3AQA A;  5DFB A;  3SVF A;  4RVR A;  5HRV A;  4PKL A;  5CRM A;  5LJ2 A;  4LZS A;  4YAD A;  5CQ5 A;  5E3D A;  5EIC A;  5II2 A;  4HXL A;  4QR3 A;  3JVM A;  5F25 A;  4BW2 A;  4E96 A;  4QSS A;  2MJV B;  2DVQ A;  5ENE A;  5FE8 A;  5F60 A;  4IR4 A;  4CFK A;  3UVY A;  2OO1 A;  5LKZ A;  3JVJ A;  3LQJ A;  5CU8 A;  3G0L A;  3MB3 A;  5DLZ A;  3G0J A;  4O70 A;  4UYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...