4QEVA

Crystal structure of brd2(bd2) mutant with ligand me bound (methyl (2r)- 2-[(4s)-6-(4-chlorophenyl)-8-methoxy-1-methyl-4h-[1,2,4]triazolo[4,3-a][1, 4]benzodiazepin-4-yl]propanoate)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
110
structure length
110
Chain Sequence
LSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGAHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Bromodomain-containing protein 2
publication title Chemical biology. A bump-and-hole approach to engineer controlled selectivity of BET bromodomain chemical probes.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2014-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qevA00
2N9GA 5IIDA 4QSTA 5EV9A 4QR4A 4QUUA 4UYHA 5A83A 4TQNA 4LZ2A 4NR8A 5D3TA 4YYHA 5DY7A 5EVAA 4IR3A 5F2PA 4UIXA 5ENHA 4YY6A 2YQDA 4C66A 5HLSA 4HBWA 2RI7A 4YABA 4NR9A 2F6NA 4QEWA 4MEOA 4NUEA 2RNXA 5LVQA 5E3GA 5EPSA 5CPEA 5DKCA 4N4FA 4BW3A 3IU5A 4C67A 4NYWA 5I86A 5FFVA 5G4RA 4XUAA 5BT5A 2H60A 4IOOA 4IOQA 5HELA 4GPJA 5IBNA 4QSQA 5E9IA 5L96A 2MJVB 5FE3A 1N72A 4YK0A 3P1CA 2R0SA 4Z1QA 4Q0NA 5FG4A 4PS5A 4YY4A 3JVLA 3P1DA 4MENA 5FG6A 5EI4A 5FB1A 2L5EA 4KV4A 4LZSA 5I40A 4N4HA 3FKMX 5DX4A 5HENA 3UVDA 4MR5A 5D25A 5KU3A 5FG5A 4TU6A 4UIYA 4TU4A 4LYSA 4CUPA 4Z6HA 4HBYA 4QSUA 5LJ2A 2RS9B 3LQHA 2YYNA 4A9IA 3SVFA 4NYVA 3IU6A 4CFKA 3U5LA 4O75A 4CUSA 4ALHA 2D9EA 5D3RA 5KTUA 4A9EA 4QSXA 3MULA 3HMFA 3O37A 3U5JA 4HXNA 2E7OA 4YH3A 4XUBA 4ALGA 2DWWA 5D3SA 3UV5A 2YDWA 5CP5A 1F68A 4YYGA 5EWCA 4TT2A 3AADA 4NRAA 4HXPA 4E96A 4QNSA 4HXRA 1WUGA 5LJ1A 4UYFA 3P1EA 4RVRA 4WHUA 4QSRA 2RO1A 5C87A 5F61A 4CURA 3O33A 4LC2A 1JM4B 4IR4A 1EQFA 5E9KA 5C89A 4LRGA 4N4GA 5E9MA 5L99A 5IGLA 2WP2A 4QR3A 3HMHA 4Z93A 3HMEA 5II2A 5HRVA 4PCEA 5EICA 5K29A 3Q2EA 4NR5A 3JVKA 5CUBA 3U5NA 3UW9A 5LVRA 2RFJA 4MR3A 5ENJA 5F1LA 4UIVA 2YEMA 2RNWA 5DYXA 3SVHA 2YELA 2DVQA 4ZW1A 5H1VA 4BJXA 4MR4A 4BW4A 5C85A 3LQJA 3UVWA 4A9LA 3MB3A 4A9HA 5COIA 4NYXA 5EPBA 4TYLA 4O72A 5CUAA 5EPRA 2NXBA 4O71A 5A81A 4HXLA 4OUFA 5F60A 4ZC9A 3AQAA 2LSPB 3GG3A 3MXFA 5TB6A 4YYNA 5HFRA 5A82A 4UIZA 4XY8A 2OO1A 4Y03A 4O7FA 5CQ3A 5CRMA 4CUTA 4TS8A 3I3JA 5F3AA 2I8NA 2YEKA 4IR5A 4YH4A 4O7AA 5A5RA 4QBMA 5EWDA 3U5KA 4MR6A 5ETBA 5DBMA 5C7NA 4N4IA 4OGJA 3U5PA 4TT4A 2R0VA 5A5QA 5AMFA 5BT3A 3TLPA 4NQMA 4QSVA 3JVJA 5I7YA 3LXJA 5DFBA 4KCXA 4A9JA 5FDZA 3LJWA 4NS5A 3MB4A 5F1HA 4FLPA 4J1PA 5DFCA 4YAXA 1WUMA 3U5MA 5FE7A 5J0DA 5G4SA 4CUQA 5H85A 4LZRA 5FE5A 5HCLA 5HFQA 2E7NA 4YATA 4F3IA 5HQ6A 5ENBA 5EQ1A 5AD3A 4QYDA 4QSSA 3U5OA 5KTWA 3NXBA 3UVYA 4QEVA 5IG6A 3LQIA 4UYDA 5F25A 4O74A 2OUOA 5LKZA 5HQ7A 4A9FA 4BW2A 5E9YA 4YC9A 2GRCA 5CTLA 4UYEA 4PY6A 4NRBA 5D7XA 5AMEA 5L98A 5JI8A 4PKLA 4UYFB 3QZTA 4IORA 4QYLA 3MUKA 5CQ6A 4Z6IA 4QC1A 4PCIA 5E7DA 5BT4A 5A5NA 5II1A 5DLXA 4O78A 5E0RA 5FE8A 5A7CA 5C8GA 2L85A 5CQ8A 4UIUA 5KHMA 3ONIA 4ZQLA 3UV4A 4CL9A 4A9NA 5ENEA 2I7KA 4A9OA 4DONA 5EWWA 5DFDA 5D3PA 4NRCA 3ZYUA 4X2IA 5DYUA 5E74A 3D7CA 2R0YA 5ENFA 4HBVA 5A5OA 5DW2A 3QZVA 5D3NA 4QEUA 3P1FA 5FBXA 3S92A 3O34A 3O35A 5CFWA 4TZ2A 5FB0A 4TT6A 5FE4A 5CQ5A 4UITA 5HEMA 5A85A 5EWVA 5A5SA 3G0JA 4BW1A 4O76A 3QZSA 5EP7A 4N3WA 5LJ0A 5LUUA 5FE2A 4LYIA 1JSPB 5ETDA 1X0JA 5ENGA 5F62A 5KTXA 3UV2A 5DYAA 5CGPA 4CUUA 5FE6A 4QUTA 5CRZA 5HJCA 5EK9A 2R10A 4MEQA 5ACYA 4QZSA 5I1QA 5F5ZA 5DKDA 5I29A 3Q2FA 5D3LA 4IR6A 4AKNA 1E6IA 5F36A 2OSSA 4YBTA 4J0SA 4NXJA 4MEPA 3S91A 4NUDA 5I80A 4YYDA 4WHWA 4TTEA 2RNYA 4NR7A 3UVXA 5D0CA 5IGNA 4YBMA 4XYAA 5TCMA 5DW1A 2G4AA 4O70A 4TZ8A 2FSAA 5CQTA 4YYIA 5HRWA 4BHWA 5A5PA 5C4QA 4YYMA 2DVVA 5HRXA 5DKHA 4HBXA 3SVGA 5D24A 5JWMA 4LDFA 5EU1A 4O77A 2DKWA 4UIWA 5EWHA 4UYGA 5ENCA 5H1UA 4QSWA 5CQ4A 5FH6A 5D26A 4LR6A 5H1TA 5CUCA 5EM3A 4A9MA 4OGIA 4CLBA 4YYKA 3P5OA 3G0LA 5CZGA 4NR6A 5EA1A 4XY9A 4O7EA 5L8TA 5KO4A 5L97A 5I7XA 4J0RA 4Q0OA 5I83A 4NR4A 4NUCA 5FH8A 4QB3A 5CUEA 1ZS5A 5LKUA 5E73A 2F6JA 4LYWA 5FH7A 5FFYA 5DYCA 5EGUA 5LKXA 5CQ7A 5HQ5A 3JVMA 4O7BA 5I88A 5HM0A 5FFWA 5D3HA 4KV1A 3DWYA 5FE0A 2E3KA 2WP1A 4NQNA 4HXOA 5E9LA 4CFLA 5IGKA 2D82A 4YADA 2DVRA 2L84A 5EISA 5ENIA 2DVSA 5CS8A 5FE9A 4QSPA 4QR5A 5CU8A 4QY4A 3O36A 4HXSA 3DAIA 5CQAA 4YYJA 5F63A 2YW5A 4QC3A 5CUGA 5E9VA 3K2JA 4O7CA 5DLZA 4A9KA 3RCWA 5CY9A 5L8UA 5AD2A 5E3DA 4YBSA 2DATA 4Z1SA 5IGMA 4HXMA 4HXKA 4J3IA 5CUDA 5D3JA 3MQMA 4WIVA 5FE1A 4PTBA 5I89A 2KTBB 5LKTA
chains in the Genus database with same CATH superfamily
2N9GA 5IIDA 4QSTA 5EV9A 4QR4A 4QUUA 4UYHA 5A83A 4TQNA 4LZ2A 4NR8A 5D3TA 4YYHA 5DY7A 5EVAA 4IR3A 5F2PA 4UIXA 5ENHA 4YY6A 2YQDA 4C66A 5HLSA 4HBWA 2RI7A 4YABA 4NR9A 2F6NA 4QEWA 4MEOA 4NUEA 2RNXA 5LVQA 5E3GA 5EPSA 5CPEA 5DKCA 4N4FA 4BW3A 3IU5A 4C67A 4NYWA 5I86A 5FFVA 5G4RA 4XUAA 5BT5A 2H60A 3D1BA 4IOOA 4IOQA 5HELA 4GPJA 5IBNA 4QSQA 5E9IA 5L96A 2MJVB 5FE3A 1N72A 4YK0A 3P1CA 2R0SA 4Z1QA 4AKHA 4Q0NA 5FG4A 4PS5A 4YY4A 3JVLA 3P1DA 4MENA 5FG6A 5EI4A 5FB1A 2L5EA 4KV4A 4LZSA 5I40A 4N4HA 3FKMX 5DX4A 5HENA 3UVDA 4MR5A 5D25A 5KU3A 5FG5A 4TU6A 4UIYA 4TU4A 4LYSA 4CUPA 4Z6HA 4HBYA 4QSUA 5LJ2A 2RS9B 3LQHA 2YYNA 4A9IA 3SVFA 4NYVA 3IU6A 4CFKA 3U5LA 4O75A 4CUSA 4ALHA 2D9EA 5D3RA 5KTUA 4A9EA 4QSXA 3MULA 3HMFA 3O37A 3U5JA 4HXNA 2E7OA 4YH3A 4XUBA 4ALGA 2DWWA 5D3SA 3UV5A 2YDWA 5CP5A 1F68A 4YYGA 5EWCA 4TT2A 3AADA 4NRAA 4HXPA 4E96A 4QNSA 4HXRA 1WUGA 5LJ1A 4UYFA 3P1EA 4RVRA 4WHUA 4QSRA 2RO1A 5C87A 5F61A 4CURA 3O33A 4LC2A 1JM4B 4IR4A 1EQFA 5E9KA 5C89A 4LRGA 4N4GA 5E9MA 5L99A 5IGLA 2WP2A 4QR3A 3HMHA 4Z93A 3HMEA 5II2A 5HRVA 4PCEA 5EICA 5K29A 3Q2EA 4NR5A 3JVKA 5CUBA 3U5NA 3UW9A 5LVRA 2RFJA 4MR3A 5ENJA 5F1LA 4UIVA 1PUOA 2RNWA 2YEMA 4AKIA 5DYXA 3SVHA 2YELA 2DVQA 4ZW1A 5H1VA 4BJXA 4MR4A 4BW4A 5C85A 3LQJA 3UVWA 4A9LA 3VKGA 3MB3A 4A9HA 5COIA 4NYXA 5EPBA 4TYLA 4O72A 5CUAA 5EPRA 2NXBA 4O71A 5A81A 4HXLA 4OUFA 5F60A 4ZC9A 3AQAA 2LSPB 3GG3A 3MXFA 5TB6A 4YYNA 5HFRA 5A82A 4UIZA 4XY8A 2OO1A 4Y03A 4O7FA 5CQ3A 5CRMA 4CUTA 4TS8A 3I3JA 5F3AA 2I8NA 2YEKA 4IR5A 4YH4A 4O7AA 5A5RA 4QBMA 5EWDA 3U5KA 4MR6A 5ETBA 5DBMA 5C7NA 4N4IA 4OGJA 3U5PA 4TT4A 2R0VA 5A5QA 5AMFA 5BT3A 3TLPA 4NQMA 4QSVA 3JVJA 5I7YA 3LXJA 5DFBA 4KCXA 4A9JA 5FDZA 3LJWA 4NS5A 3MB4A 5F1HA 4FLPA 4J1PA 5DFCA 4YAXA 1WUMA 3U5MA 5FE7A 5J0DA 2EJNA 5G4SA 4CUQA 5H85A 4LZRA 5FE5A 5HCLA 5HFQA 3VKHA 2E7NA 4YATA 4F3IA 5HQ6A 5ENBA 5EQ1A 5AD3A 4QYDA 4QSSA 3ERRA 3U5OA 5KTWA 3NXBA 3UVYA 4QEVA 5IG6A 3LQIA 4UYDA 5F25A 4O74A 2OUOA 5LKZA 5HQ7A 4A9FA 4BW2A 5E9YA 4YC9A 2GRCA 5CTLA 4UYEA 4PY6A 4NRBA 5D7XA 5AMEA 5L98A 5JI8A 4PKLA 4UYFB 3QZTA 4IORA 4QYLA 3MUKA 5CQ6A 4Z6IA 4QC1A 1ZKRA 4PCIA 5E7DA 5BT4A 5A5NA 5II1A 5DLXA 4AI6A 4O78A 5E0RA 5FE8A 5A7CA 5C8GA 2L85A 5CQ8A 4UIUA 5KHMA 3ONIA 4ZQLA 3UV4A 4CL9A 4A9NA 5ENEA 2I7KA 4A9OA 4DONA 5EWWA 5DFDA 5D3PA 4NRCA 3ZYUA 4X2IA 5DYUA 5E74A 3D7CA 2R0YA 5ENFA 4HBVA 5A5OA 5DW2A 3QZVA 5D3NA 4QEUA 3P1FA 5FBXA 3S92A 3O34A 3O35A 5CFWA 4TZ2A 5FB0A 4TT6A 5FE4A 5CQ5A 4UITA 5HEMA 5A85A 5EWVA 5A5SA 3G0JA 4BW1A 4O76A 3QZSA 5EP7A 4N3WA 5LJ0A 5LUUA 5FE2A 4LYIA 1JSPB 5ETDA 1X0JA 5ENGA 5F62A 5KTXA 3UV2A 5DYAA 5CGPA 4CUUA 5FE6A 4QUTA 5CRZA 5HJCA 5EK9A 2R10A 4MEQA 5ACYA 4QZSA 5I1QA 5F5ZA 5DKDA 5I29A 3Q2FA 5D3LA 4IR6A 4AKNA 1E6IA 5F36A 2OSSA 4YBTA 4J0SA 4NXJA 4MEPA 3S91A 4NUDA 5I80A 4YYDA 4WHWA 4TTEA 2RNYA 4NR7A 3UVXA 5D0CA 5IGNA 4YBMA 4XYAA 5TCMA 5DW1A 2G4AA 4O70A 4TZ8A 2FSAA 5CQTA 4YYIA 5HRWA 4BHWA 5A5PA 5C4QA 4YYMA 2DVVA 5HRXA 5DKHA 4HBXA 3SVGA 5D24A 5JWMA 4LDFA 5EU1A 4O77A 2DKWA 4UIWA 5EWHA 4UYGA 5ENCA 5H1UA 4QSWA 5CQ4A 5FH6A 5D26A 4LR6A 4AKGA 5H1TA 5CUCA 5EM3A 4A9MA 4OGIA 4CLBA 4YYKA 3P5OA 3G0LA 5CZGA 4NR6A 5EA1A 4XY9A 4O7EA 5L8TA 5KO4A 5L97A 5I7XA 4J0RA 4Q0OA 5I83A 4NR4A 4NUCA 5FH8A 4QB3A 5CUEA 1ZS5A 5LKUA 5E73A 2F6JA 4LYWA 5FH7A 5FFYA 5DYCA 5EGUA 5LKXA 5CQ7A 3D1DA 5HQ5A 3JVMA 4O7BA 5I88A 5HM0A 5FFWA 5D3HA 4KV1A 3DWYA 5FE0A 2E3KA 2WP1A 4NQNA 4HXOA 5E9LA 4CFLA 5IGKA 2D82A 4YADA 2DVRA 2L84A 5EISA 5ENIA 2DVSA 5CS8A 5FE9A 4QSPA 4QR5A 5CU8A 4QY4A 3O36A 4HXSA 3DAIA 5CQAA 4YYJA 5F63A 2YW5A 4QC3A 5CUGA 5E9VA 3K2JA 4O7CA 5DLZA 4A9KA 3RCWA 5CY9A 5L8UA 5AD2A 5E3DA 4YBSA 2DATA 4Z1SA 5IGMA 4HXMA 4HXKA 4J3IA 5CUDA 5D3JA 3MQMA 4WIVA 5FE1A 4PTBA 5I89A 2KTBB 5LKTA
chains in the Genus database with same CATH topology
2N9GA 5IIDA 4QSTA 5EV9A 4QR4A 4QUUA 4UYHA 5A83A 4TQNA 4LZ2A 4NR8A 5D3TA 4YYHA 5DY7A 5EVAA 4IR3A 5F2PA 4UIXA 5ENHA 4YY6A 2YQDA 4C66A 5HLSA 4HBWA 2RI7A 4YABA 4NR9A 2F6NA 4QEWA 4MEOA 4NUEA 2RNXA 5LVQA 5E3GA 5EPSA 5CPEA 5DKCA 4N4FA 4BW3A 3IU5A 4C67A 4NYWA 5I86A 5FFVA 5G4RA 4XUAA 5BT5A 2H60A 4IOOA 4IOQA 5HELA 4GPJA 5IBNA 4QSQA 5E9IA 5L96A 2MJVB 5FE3A 1N72A 4YK0A 3P1CA 2R0SA 4Z1QA 4Q0NA 5FG4A 4PS5A 4YY4A 3JVLA 3P1DA 4MENA 5FG6A 5EI4A 5FB1A 2L5EA 4KV4A 4LZSA 5I40A 4N4HA 3FKMX 5DX4A 5HENA 3UVDA 4MR5A 5D25A 5KU3A 5FG5A 4TU6A 4UIYA 4TU4A 4LYSA 4CUPA 4Z6HA 4HBYA 4QSUA 5LJ2A 2RS9B 3LQHA 2YYNA 4A9IA 3SVFA 4NYVA 3IU6A 4CFKA 3U5LA 4O75A 4CUSA 4ALHA 2D9EA 5D3RA 5KTUA 4A9EA 4QSXA 3MULA 3HMFA 3O37A 3U5JA 4HXNA 2E7OA 4YH3A 4XUBA 4ALGA 2DWWA 5D3SA 3UV5A 2YDWA 5CP5A 1F68A 4YYGA 5EWCA 4TT2A 3AADA 4NRAA 4HXPA 4E96A 4QNSA 4HXRA 1WUGA 5LJ1A 4UYFA 3P1EA 4RVRA 4WHUA 4QSRA 2RO1A 5C87A 5F61A 4CURA 3O33A 4LC2A 1JM4B 4IR4A 1EQFA 5E9KA 5C89A 4LRGA 4N4GA 5E9MA 5L99A 5IGLA 2WP2A 4QR3A 3HMHA 4Z93A 3HMEA 5II2A 5HRVA 4PCEA 5EICA 5K29A 3Q2EA 4NR5A 3JVKA 5CUBA 3U5NA 3UW9A 5LVRA 2RFJA 4MR3A 5ENJA 5F1LA 4UIVA 2YEMA 2RNWA 5DYXA 3SVHA 2YELA 2DVQA 4ZW1A 5H1VA 4BJXA 4MR4A 4BW4A 5C85A 3LQJA 3UVWA 4A9LA 3MB3A 4A9HA 5COIA 4NYXA 5EPBA 4TYLA 4O72A 5CUAA 5EPRA 2NXBA 4O71A 5A81A 4HXLA 4OUFA 5F60A 4ZC9A 3AQAA 2LSPB 3GG3A 3MXFA 5TB6A 4YYNA 5HFRA 5A82A 4UIZA 4XY8A 2OO1A 4Y03A 4O7FA 5CQ3A 5CRMA 4CUTA 4TS8A 3I3JA 5F3AA 2I8NA 2YEKA 4IR5A 4YH4A 4O7AA 5A5RA 4QBMA 5EWDA 3U5KA 4MR6A 5ETBA 5DBMA 5C7NA 4N4IA 4OGJA 3U5PA 4TT4A 2R0VA 5A5QA 5AMFA 5BT3A 3TLPA 4NQMA 4QSVA 3JVJA 5I7YA 3LXJA 5DFBA 4KCXA 4A9JA 5FDZA 3LJWA 4NS5A 3MB4A 5F1HA 4FLPA 4J1PA 5DFCA 4YAXA 1WUMA 3U5MA 5FE7A 5J0DA 5G4SA 4CUQA 5H85A 4LZRA 5FE5A 5HCLA 5HFQA 2E7NA 4YATA 4F3IA 5HQ6A 5ENBA 5EQ1A 5AD3A 4QYDA 4QSSA 3U5OA 5KTWA 3NXBA 3UVYA 4QEVA 5IG6A 3LQIA 4UYDA 5F25A 4O74A 2OUOA 5LKZA 5HQ7A 4A9FA 4BW2A 5E9YA 4YC9A 2GRCA 5CTLA 4UYEA 4PY6A 4NRBA 5D7XA 5AMEA 5L98A 5JI8A 4PKLA 4UYFB 3QZTA 4IORA 4QYLA 3MUKA 5CQ6A 4Z6IA 4QC1A 4PCIA 5E7DA 5BT4A 5A5NA 5II1A 5DLXA 4O78A 5E0RA 5FE8A 5A7CA 5C8GA 2L85A 5CQ8A 4UIUA 5KHMA 3ONIA 4ZQLA 3UV4A 4CL9A 4A9NA 5ENEA 2I7KA 4A9OA 4DONA 5EWWA 5DFDA 5D3PA 4NRCA 3ZYUA 4X2IA 5DYUA 5E74A 3D7CA 2R0YA 5ENFA 4HBVA 5A5OA 5DW2A 3QZVA 5D3NA 4QEUA 3P1FA 5FBXA 3S92A 3O34A 3O35A 5CFWA 4TZ2A 5FB0A 4TT6A 5FE4A 5CQ5A 4UITA 5HEMA 5A85A 5EWVA 5A5SA 3G0JA 4BW1A 4O76A 3QZSA 5EP7A 4N3WA 5LJ0A 5LUUA 5FE2A 4LYIA 1JSPB 5ETDA 1X0JA 5ENGA 5F62A 5KTXA 3UV2A 5DYAA 5CGPA 4CUUA 5FE6A 4QUTA 5CRZA 5HJCA 5EK9A 2R10A 4MEQA 5ACYA 4QZSA 5I1QA 5F5ZA 5DKDA 5I29A 3Q2FA 5D3LA 4IR6A 4AKNA 1E6IA 5F36A 2OSSA 4YBTA 4J0SA 4NXJA 4MEPA 3S91A 4NUDA 5I80A 4YYDA 4WHWA 4TTEA 2RNYA 4NR7A 3UVXA 5D0CA 5IGNA 4YBMA 4XYAA 5TCMA 5DW1A 2G4AA 4O70A 4TZ8A 2FSAA 5CQTA 4YYIA 5HRWA 4BHWA 5A5PA 5C4QA 4YYMA 2DVVA 5HRXA 5DKHA 4HBXA 3SVGA 5D24A 5JWMA 4LDFA 5EU1A 4O77A 2DKWA 4UIWA 5EWHA 4UYGA 5ENCA 5H1UA 4QSWA 5CQ4A 5FH6A 5D26A 4LR6A 5H1TA 5CUCA 5EM3A 4A9MA 4OGIA 4CLBA 4YYKA 3P5OA 3G0LA 5CZGA 4NR6A 5EA1A 4XY9A 4O7EA 5L8TA 5KO4A 5L97A 5I7XA 4J0RA 4Q0OA 5I83A 4NR4A 4NUCA 5FH8A 4QB3A 5CUEA 1ZS5A 5LKUA 5E73A 2F6JA 4LYWA 5FH7A 5FFYA 5DYCA 5EGUA 5LKXA 5CQ7A 5HQ5A 3JVMA 4O7BA 5I88A 5HM0A 5FFWA 5D3HA 4KV1A 3DWYA 5FE0A 2E3KA 2WP1A 4NQNA 4HXOA 5E9LA 4CFLA 5IGKA 2D82A 4YADA 2DVRA 2L84A 5EISA 5ENIA 2DVSA 5CS8A 5FE9A 4QSPA 4QR5A 5CU8A 4QY4A 3O36A 4HXSA 3DAIA 5CQAA 4YYJA 5F63A 2YW5A 4QC3A 5CUGA 5E9VA 3K2JA 4O7CA 5DLZA 4A9KA 3RCWA 5CY9A 5L8UA 5AD2A 5E3DA 4YBSA 2DATA 4Z1SA 5IGMA 4HXMA 4HXKA 4J3IA 5CUDA 5D3JA 3MQMA 4WIVA 5FE1A 4PTBA 5I89A 2KTBB 5LKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9G A;  5IID A;  4QST A;  5EV9 A;  4QR4 A;  4QUU A;  4UYH A;  5A83 A;  4TQN A;  4LZ2 A;  4NR8 A;  5D3T A;  4YYH A;  5DY7 A;  5EVA A;  4IR3 A;  5F2P A;  4UIX A;  5ENH A;  4YY6 A;  2YQD A;  4C66 A;  5HLS A;  4HBW A;  2RI7 A;  4YAB A;  4NR9 A;  2F6N A;  4QEW A;  4MEO A;  4NUE A;  2RNX A;  5LVQ A;  5E3G A;  5EPS A;  5CPE A;  5DKC A;  4N4F A;  4BW3 A;  3IU5 A;  4C67 A;  4NYW A;  5I86 A;  5FFV A;  5G4R A;  4XUA A;  5BT5 A;  2H60 A;  4IOO A;  4IOQ A;  5HEL A;  4GPJ A;  5IBN A;  4QSQ A;  5E9I A;  5L96 A;  2MJV B;  5FE3 A;  1N72 A;  4YK0 A;  3P1C A;  2R0S A;  4Z1Q A;  4Q0N A;  5FG4 A;  4PS5 A;  4YY4 A;  3JVL A;  3P1D A;  4MEN A;  5FG6 A;  5EI4 A;  5FB1 A;  2L5E A;  4KV4 A;  4LZS A;  5I40 A;  4N4H A;  3FKM X;  5DX4 A;  5HEN A;  3UVD A;  4MR5 A;  5D25 A;  5KU3 A;  5FG5 A;  4TU6 A;  4UIY A;  4TU4 A;  4LYS A;  4CUP A;  4Z6H A;  4HBY A;  4QSU A;  5LJ2 A;  2RS9 B;  3LQH A;  2YYN A;  4A9I A;  3SVF A;  4NYV A;  3IU6 A;  4CFK A;  3U5L A;  4O75 A;  4CUS A;  4ALH A;  2D9E A;  5D3R A;  5KTU A;  4A9E A;  4QSX A;  3MUL A;  3HMF A;  3O37 A;  3U5J A;  4HXN A;  2E7O A;  4YH3 A;  4XUB A;  4ALG A;  2DWW A;  5D3S A;  3UV5 A;  2YDW A;  5CP5 A;  1F68 A;  4YYG A;  5EWC A;  4TT2 A;  3AAD A;  4NRA A;  4HXP A;  4E96 A;  4QNS A;  4HXR A;  1WUG A;  5LJ1 A;  4UYF A;  3P1E A;  4RVR A;  4WHU A;  4QSR A;  2RO1 A;  5C87 A;  5F61 A;  4CUR A;  3O33 A;  4LC2 A;  1JM4 B;  4IR4 A;  1EQF A;  5E9K A;  5C89 A;  4LRG A;  4N4G A;  5E9M A;  5L99 A;  5IGL A;  2WP2 A;  4QR3 A;  3HMH A;  4Z93 A;  3HME A;  5II2 A;  5HRV A;  4PCE A;  5EIC A;  5K29 A;  3Q2E A;  4NR5 A;  3JVK A;  5CUB A;  3U5N A;  3UW9 A;  5LVR A;  2RFJ A;  4MR3 A;  5ENJ A;  5F1L A;  4UIV A;  2YEM A;  2RNW A;  5DYX A;  3SVH A;  2YEL A;  2DVQ A;  4ZW1 A;  5H1V A;  4BJX A;  4MR4 A;  4BW4 A;  5C85 A;  3LQJ A;  3UVW A;  4A9L A;  3MB3 A;  4A9H A;  5COI A;  4NYX A;  5EPB A;  4TYL A;  4O72 A;  5CUA A;  5EPR A;  2NXB A;  4O71 A;  5A81 A;  4HXL A;  4OUF A;  5F60 A;  4ZC9 A;  3AQA A;  2LSP B;  3GG3 A;  3MXF A;  5TB6 A;  4YYN A;  5HFR A;  5A82 A;  4UIZ A;  4XY8 A;  2OO1 A;  4Y03 A;  4O7F A;  5CQ3 A;  5CRM A;  4CUT A;  4TS8 A;  3I3J A;  5F3A A;  2I8N A;  2YEK A;  4IR5 A;  4YH4 A;  4O7A A;  5A5R A;  4QBM A;  5EWD A;  3U5K A;  4MR6 A;  5ETB A;  5DBM A;  5C7N A;  4N4I A;  4OGJ A;  3U5P A;  4TT4 A;  2R0V A;  5A5Q A;  5AMF A;  5BT3 A;  3TLP A;  4NQM A;  4QSV A;  3JVJ A;  5I7Y A;  3LXJ A;  5DFB A;  4KCX A;  4A9J A;  5FDZ A;  3LJW A;  4NS5 A;  3MB4 A;  5F1H A;  4FLP A;  4J1P A;  5DFC A;  4YAX A;  1WUM A;  3U5M A;  5FE7 A;  5J0D A;  5G4S A;  4CUQ A;  5H85 A;  4LZR A;  5FE5 A;  5HCL A;  5HFQ A;  2E7N A;  4YAT A;  4F3I A;  5HQ6 A;  5ENB A;  5EQ1 A;  5AD3 A;  4QYD A;  4QSS A;  3U5O A;  5KTW A;  3NXB A;  3UVY A;  4QEV A;  5IG6 A;  3LQI A;  4UYD A;  5F25 A;  4O74 A;  2OUO A;  5LKZ A;  5HQ7 A;  4A9F A;  4BW2 A;  5E9Y A;  4YC9 A;  2GRC A;  5CTL A;  4UYE A;  4PY6 A;  4NRB A;  5D7X A;  5AME A;  5L98 A;  5JI8 A;  4PKL A;  4UYF B;  3QZT A;  4IOR A;  4QYL A;  3MUK A;  5CQ6 A;  4Z6I A;  4QC1 A;  4PCI A;  5E7D A;  5BT4 A;  5A5N A;  5II1 A;  5DLX A;  4O78 A;  5E0R A;  5FE8 A;  5A7C A;  5C8G A;  2L85 A;  5CQ8 A;  4UIU A;  5KHM A;  3ONI A;  4ZQL A;  3UV4 A;  4CL9 A;  4A9N A;  5ENE A;  2I7K A;  4A9O A;  4DON A;  5EWW A;  5DFD A;  5D3P A;  4NRC A;  3ZYU A;  4X2I A;  5DYU A;  5E74 A;  3D7C A;  2R0Y A;  5ENF A;  4HBV A;  5A5O A;  5DW2 A;  3QZV A;  5D3N A;  4QEU A;  3P1F A;  5FBX A;  3S92 A;  3O34 A;  3O35 A;  5CFW A;  4TZ2 A;  5FB0 A;  4TT6 A;  5FE4 A;  5CQ5 A;  4UIT A;  5HEM A;  5A85 A;  5EWV A;  5A5S A;  3G0J A;  4BW1 A;  4O76 A;  3QZS A;  5EP7 A;  4N3W A;  5LJ0 A;  5LUU A;  5FE2 A;  4LYI A;  1JSP B;  5ETD A;  1X0J A;  5ENG A;  5F62 A;  5KTX A;  3UV2 A;  5DYA A;  5CGP A;  4CUU A;  5FE6 A;  4QUT A;  5CRZ A;  5HJC A;  5EK9 A;  2R10 A;  4MEQ A;  5ACY A;  4QZS A;  5I1Q A;  5F5Z A;  5DKD A;  5I29 A;  3Q2F A;  5D3L A;  4IR6 A;  4AKN A;  1E6I A;  5F36 A;  2OSS A;  4YBT A;  4J0S A;  4NXJ A;  4MEP A;  3S91 A;  4NUD A;  5I80 A;  4YYD A;  4WHW A;  4TTE A;  2RNY A;  4NR7 A;  3UVX A;  5D0C A;  5IGN A;  4YBM A;  4XYA A;  5TCM A;  5DW1 A;  2G4A A;  4O70 A;  4TZ8 A;  2FSA A;  5CQT A;  4YYI A;  5HRW A;  4BHW A;  5A5P A;  5C4Q A;  4YYM A;  2DVV A;  5HRX A;  5DKH A;  4HBX A;  3SVG A;  5D24 A;  5JWM A;  4LDF A;  5EU1 A;  4O77 A;  2DKW A;  4UIW A;  5EWH A;  4UYG A;  5ENC A;  5H1U A;  4QSW A;  5CQ4 A;  5FH6 A;  5D26 A;  4LR6 A;  5H1T A;  5CUC A;  5EM3 A;  4A9M A;  4OGI A;  4CLB A;  4YYK A;  3P5O A;  3G0L A;  5CZG A;  4NR6 A;  5EA1 A;  4XY9 A;  4O7E A;  5L8T A;  5KO4 A;  5L97 A;  5I7X A;  4J0R A;  4Q0O A;  5I83 A;  4NR4 A;  4NUC A;  5FH8 A;  4QB3 A;  5CUE A;  1ZS5 A;  5LKU A;  5E73 A;  2F6J A;  4LYW A;  5FH7 A;  5FFY A;  5DYC A;  5EGU A;  5LKX A;  5CQ7 A;  5HQ5 A;  3JVM A;  4O7B A;  5I88 A;  5HM0 A;  5FFW A;  5D3H A;  4KV1 A;  3DWY A;  5FE0 A;  2E3K A;  2WP1 A;  4NQN A;  4HXO A;  5E9L A;  4CFL A;  5IGK A;  2D82 A;  4YAD A;  2DVR A;  2L84 A;  5EIS A;  5ENI A;  2DVS A;  5CS8 A;  5FE9 A;  4QSP A;  4QR5 A;  5CU8 A;  4QY4 A;  3O36 A;  4HXS A;  3DAI A;  5CQA A;  4YYJ A;  5F63 A;  2YW5 A;  4QC3 A;  5CUG A;  5E9V A;  3K2J A;  4O7C A;  5DLZ A;  4A9K A;  3RCW A;  5CY9 A;  5L8U A;  5AD2 A;  5E3D A;  4YBS A;  2DAT A;  4Z1S A;  5IGM A;  4HXM A;  4HXK A;  4J3I A;  5CUD A;  5D3J A;  3MQM A;  4WIV A;  5FE1 A;  4PTB A;  5I89 A;  2KTB B;  5LKT A; 
#chains in the Genus database with same CATH topology
 2N9G A;  5IID A;  4QST A;  5EV9 A;  4QR4 A;  4QUU A;  4UYH A;  5A83 A;  4TQN A;  4LZ2 A;  4NR8 A;  5D3T A;  4YYH A;  5DY7 A;  5EVA A;  4IR3 A;  5F2P A;  4UIX A;  5ENH A;  4YY6 A;  2YQD A;  4C66 A;  5HLS A;  4HBW A;  2RI7 A;  4YAB A;  4NR9 A;  2F6N A;  4QEW A;  4MEO A;  4NUE A;  2RNX A;  5LVQ A;  5E3G A;  5EPS A;  5CPE A;  5DKC A;  4N4F A;  4BW3 A;  3IU5 A;  4C67 A;  4NYW A;  5I86 A;  5FFV A;  5G4R A;  4XUA A;  5BT5 A;  2H60 A;  3D1B A;  4IOO A;  4IOQ A;  5HEL A;  4GPJ A;  5IBN A;  4QSQ A;  5E9I A;  5L96 A;  2MJV B;  5FE3 A;  1N72 A;  4YK0 A;  3P1C A;  2R0S A;  4Z1Q A;  4AKH A;  4Q0N A;  5FG4 A;  4PS5 A;  4YY4 A;  3JVL A;  3P1D A;  4MEN A;  5FG6 A;  5EI4 A;  5FB1 A;  2L5E A;  4KV4 A;  4LZS A;  5I40 A;  4N4H A;  3FKM X;  5DX4 A;  5HEN A;  3UVD A;  4MR5 A;  5D25 A;  5KU3 A;  5FG5 A;  4TU6 A;  4UIY A;  4TU4 A;  4LYS A;  4CUP A;  4Z6H A;  4HBY A;  4QSU A;  5LJ2 A;  2RS9 B;  3LQH A;  2YYN A;  4A9I A;  3SVF A;  4NYV A;  3IU6 A;  4CFK A;  3U5L A;  4O75 A;  4CUS A;  4ALH A;  2D9E A;  5D3R A;  5KTU A;  4A9E A;  4QSX A;  3MUL A;  3HMF A;  3O37 A;  3U5J A;  4HXN A;  2E7O A;  4YH3 A;  4XUB A;  4ALG A;  2DWW A;  5D3S A;  3UV5 A;  2YDW A;  5CP5 A;  1F68 A;  4YYG A;  5EWC A;  4TT2 A;  3AAD A;  4NRA A;  4HXP A;  4E96 A;  4QNS A;  4HXR A;  1WUG A;  5LJ1 A;  4UYF A;  3P1E A;  4RVR A;  4WHU A;  4QSR A;  2RO1 A;  5C87 A;  5F61 A;  4CUR A;  3O33 A;  4LC2 A;  1JM4 B;  4IR4 A;  1EQF A;  5E9K A;  5C89 A;  4LRG A;  4N4G A;  5E9M A;  5L99 A;  5IGL A;  2WP2 A;  4QR3 A;  3HMH A;  4Z93 A;  3HME A;  5II2 A;  5HRV A;  4PCE A;  5EIC A;  5K29 A;  3Q2E A;  4NR5 A;  3JVK A;  5CUB A;  3U5N A;  3UW9 A;  5LVR A;  2RFJ A;  4MR3 A;  5ENJ A;  5F1L A;  4UIV A;  1PUO A;  2RNW A;  2YEM A;  4AKI A;  5DYX A;  3SVH A;  2YEL A;  2DVQ A;  4ZW1 A;  5H1V A;  4BJX A;  4MR4 A;  4BW4 A;  5C85 A;  3LQJ A;  3UVW A;  4A9L A;  3VKG A;  3MB3 A;  4A9H A;  5COI A;  4NYX A;  5EPB A;  4TYL A;  4O72 A;  5CUA A;  5EPR A;  2NXB A;  4O71 A;  5A81 A;  4HXL A;  4OUF A;  5F60 A;  4ZC9 A;  3AQA A;  2LSP B;  3GG3 A;  3MXF A;  5TB6 A;  4YYN A;  5HFR A;  5A82 A;  4UIZ A;  4XY8 A;  2OO1 A;  4Y03 A;  4O7F A;  5CQ3 A;  5CRM A;  4CUT A;  4TS8 A;  3I3J A;  5F3A A;  2I8N A;  2YEK A;  4IR5 A;  4YH4 A;  4O7A A;  5A5R A;  4QBM A;  5EWD A;  3U5K A;  4MR6 A;  5ETB A;  5DBM A;  5C7N A;  4N4I A;  4OGJ A;  3U5P A;  4TT4 A;  2R0V A;  5A5Q A;  5AMF A;  5BT3 A;  3TLP A;  4NQM A;  4QSV A;  3JVJ A;  5I7Y A;  3LXJ A;  5DFB A;  4KCX A;  4A9J A;  5FDZ A;  3LJW A;  4NS5 A;  3MB4 A;  5F1H A;  4FLP A;  4J1P A;  5DFC A;  4YAX A;  1WUM A;  3U5M A;  5FE7 A;  5J0D A;  2EJN A;  5G4S A;  4CUQ A;  5H85 A;  4LZR A;  5FE5 A;  5HCL A;  5HFQ A;  3VKH A;  2E7N A;  4YAT A;  4F3I A;  5HQ6 A;  5ENB A;  5EQ1 A;  5AD3 A;  4QYD A;  4QSS A;  3ERR A;  3U5O A;  5KTW A;  3NXB A;  3UVY A;  4QEV A;  5IG6 A;  3LQI A;  4UYD A;  5F25 A;  4O74 A;  2OUO A;  5LKZ A;  5HQ7 A;  4A9F A;  4BW2 A;  5E9Y A;  4YC9 A;  2GRC A;  5CTL A;  4UYE A;  4PY6 A;  4NRB A;  5D7X A;  5AME A;  5L98 A;  5JI8 A;  4PKL A;  4UYF B;  3QZT A;  4IOR A;  4QYL A;  3MUK A;  5CQ6 A;  4Z6I A;  4QC1 A;  1ZKR A;  4PCI A;  5E7D A;  5BT4 A;  5A5N A;  5II1 A;  5DLX A;  4AI6 A;  4O78 A;  5E0R A;  5FE8 A;  5A7C A;  5C8G A;  2L85 A;  5CQ8 A;  4UIU A;  5KHM A;  3ONI A;  4ZQL A;  3UV4 A;  4CL9 A;  4A9N A;  5ENE A;  2I7K A;  4A9O A;  4DON A;  5EWW A;  5DFD A;  5D3P A;  4NRC A;  3ZYU A;  4X2I A;  5DYU A;  5E74 A;  3D7C A;  2R0Y A;  5ENF A;  4HBV A;  5A5O A;  5DW2 A;  3QZV A;  5D3N A;  4QEU A;  3P1F A;  5FBX A;  3S92 A;  3O34 A;  3O35 A;  5CFW A;  4TZ2 A;  5FB0 A;  4TT6 A;  5FE4 A;  5CQ5 A;  4UIT A;  5HEM A;  5A85 A;  5EWV A;  5A5S A;  3G0J A;  4BW1 A;  4O76 A;  3QZS A;  5EP7 A;  4N3W A;  5LJ0 A;  5LUU A;  5FE2 A;  4LYI A;  1JSP B;  5ETD A;  1X0J A;  5ENG A;  5F62 A;  5KTX A;  3UV2 A;  5DYA A;  5CGP A;  4CUU A;  5FE6 A;  4QUT A;  5CRZ A;  5HJC A;  5EK9 A;  2R10 A;  4MEQ A;  5ACY A;  4QZS A;  5I1Q A;  5F5Z A;  5DKD A;  5I29 A;  3Q2F A;  5D3L A;  4IR6 A;  4AKN A;  1E6I A;  5F36 A;  2OSS A;  4YBT A;  4J0S A;  4NXJ A;  4MEP A;  3S91 A;  4NUD A;  5I80 A;  4YYD A;  4WHW A;  4TTE A;  2RNY A;  4NR7 A;  3UVX A;  5D0C A;  5IGN A;  4YBM A;  4XYA A;  5TCM A;  5DW1 A;  2G4A A;  4O70 A;  4TZ8 A;  2FSA A;  5CQT A;  4YYI A;  5HRW A;  4BHW A;  5A5P A;  5C4Q A;  4YYM A;  2DVV A;  5HRX A;  5DKH A;  4HBX A;  3SVG A;  5D24 A;  5JWM A;  4LDF A;  5EU1 A;  4O77 A;  2DKW A;  4UIW A;  5EWH A;  4UYG A;  5ENC A;  5H1U A;  4QSW A;  5CQ4 A;  5FH6 A;  5D26 A;  4LR6 A;  4AKG A;  5H1T A;  5CUC A;  5EM3 A;  4A9M A;  4OGI A;  4CLB A;  4YYK A;  3P5O A;  3G0L A;  5CZG A;  4NR6 A;  5EA1 A;  4XY9 A;  4O7E A;  5L8T A;  5KO4 A;  5L97 A;  5I7X A;  4J0R A;  4Q0O A;  5I83 A;  4NR4 A;  4NUC A;  5FH8 A;  4QB3 A;  5CUE A;  1ZS5 A;  5LKU A;  5E73 A;  2F6J A;  4LYW A;  5FH7 A;  5FFY A;  5DYC A;  5EGU A;  5LKX A;  5CQ7 A;  3D1D A;  5HQ5 A;  3JVM A;  4O7B A;  5I88 A;  5HM0 A;  5FFW A;  5D3H A;  4KV1 A;  3DWY A;  5FE0 A;  2E3K A;  2WP1 A;  4NQN A;  4HXO A;  5E9L A;  4CFL A;  5IGK A;  2D82 A;  4YAD A;  2DVR A;  2L84 A;  5EIS A;  5ENI A;  2DVS A;  5CS8 A;  5FE9 A;  4QSP A;  4QR5 A;  5CU8 A;  4QY4 A;  3O36 A;  4HXS A;  3DAI A;  5CQA A;  4YYJ A;  5F63 A;  2YW5 A;  4QC3 A;  5CUG A;  5E9V A;  3K2J A;  4O7C A;  5DLZ A;  4A9K A;  3RCW A;  5CY9 A;  5L8U A;  5AD2 A;  5E3D A;  4YBS A;  2DAT A;  4Z1S A;  5IGM A;  4HXM A;  4HXK A;  4J3I A;  5CUD A;  5D3J A;  3MQM A;  4WIV A;  5FE1 A;  4PTB A;  5I89 A;  2KTB B;  5LKT A; 
#chains in the Genus database with same CATH homology
 2N9G A;  5IID A;  4QST A;  5EV9 A;  4QR4 A;  4QUU A;  4UYH A;  5A83 A;  4TQN A;  4LZ2 A;  4NR8 A;  5D3T A;  4YYH A;  5DY7 A;  5EVA A;  4IR3 A;  5F2P A;  4UIX A;  5ENH A;  4YY6 A;  2YQD A;  4C66 A;  5HLS A;  4HBW A;  2RI7 A;  4YAB A;  4NR9 A;  2F6N A;  4QEW A;  4MEO A;  4NUE A;  2RNX A;  5LVQ A;  5E3G A;  5EPS A;  5CPE A;  5DKC A;  4N4F A;  4BW3 A;  3IU5 A;  4C67 A;  4NYW A;  5I86 A;  5FFV A;  5G4R A;  4XUA A;  5BT5 A;  2H60 A;  4IOO A;  4IOQ A;  5HEL A;  4GPJ A;  5IBN A;  4QSQ A;  5E9I A;  5L96 A;  2MJV B;  5FE3 A;  1N72 A;  4YK0 A;  3P1C A;  2R0S A;  4Z1Q A;  4Q0N A;  5FG4 A;  4PS5 A;  4YY4 A;  3JVL A;  3P1D A;  4MEN A;  5FG6 A;  5EI4 A;  5FB1 A;  2L5E A;  4KV4 A;  4LZS A;  5I40 A;  4N4H A;  3FKM X;  5DX4 A;  5HEN A;  3UVD A;  4MR5 A;  5D25 A;  5KU3 A;  5FG5 A;  4TU6 A;  4UIY A;  4TU4 A;  4LYS A;  4CUP A;  4Z6H A;  4HBY A;  4QSU A;  5LJ2 A;  2RS9 B;  3LQH A;  2YYN A;  4A9I A;  3SVF A;  4NYV A;  3IU6 A;  4CFK A;  3U5L A;  4O75 A;  4CUS A;  4ALH A;  2D9E A;  5D3R A;  5KTU A;  4A9E A;  4QSX A;  3MUL A;  3HMF A;  3O37 A;  3U5J A;  4HXN A;  2E7O A;  4YH3 A;  4XUB A;  4ALG A;  2DWW A;  5D3S A;  3UV5 A;  2YDW A;  5CP5 A;  1F68 A;  4YYG A;  5EWC A;  4TT2 A;  3AAD A;  4NRA A;  4HXP A;  4E96 A;  4QNS A;  4HXR A;  1WUG A;  5LJ1 A;  4UYF A;  3P1E A;  4RVR A;  4WHU A;  4QSR A;  2RO1 A;  5C87 A;  5F61 A;  4CUR A;  3O33 A;  4LC2 A;  1JM4 B;  4IR4 A;  1EQF A;  5E9K A;  5C89 A;  4LRG A;  4N4G A;  5E9M A;  5L99 A;  5IGL A;  2WP2 A;  4QR3 A;  3HMH A;  4Z93 A;  3HME A;  5II2 A;  5HRV A;  4PCE A;  5EIC A;  5K29 A;  3Q2E A;  4NR5 A;  3JVK A;  5CUB A;  3U5N A;  3UW9 A;  5LVR A;  2RFJ A;  4MR3 A;  5ENJ A;  5F1L A;  4UIV A;  2YEM A;  2RNW A;  5DYX A;  3SVH A;  2YEL A;  2DVQ A;  4ZW1 A;  5H1V A;  4BJX A;  4MR4 A;  4BW4 A;  5C85 A;  3LQJ A;  3UVW A;  4A9L A;  3MB3 A;  4A9H A;  5COI A;  4NYX A;  5EPB A;  4TYL A;  4O72 A;  5CUA A;  5EPR A;  2NXB A;  4O71 A;  5A81 A;  4HXL A;  4OUF A;  5F60 A;  4ZC9 A;  3AQA A;  2LSP B;  3GG3 A;  3MXF A;  5TB6 A;  4YYN A;  5HFR A;  5A82 A;  4UIZ A;  4XY8 A;  2OO1 A;  4Y03 A;  4O7F A;  5CQ3 A;  5CRM A;  4CUT A;  4TS8 A;  3I3J A;  5F3A A;  2I8N A;  2YEK A;  4IR5 A;  4YH4 A;  4O7A A;  5A5R A;  4QBM A;  5EWD A;  3U5K A;  4MR6 A;  5ETB A;  5DBM A;  5C7N A;  4N4I A;  4OGJ A;  3U5P A;  4TT4 A;  2R0V A;  5A5Q A;  5AMF A;  5BT3 A;  3TLP A;  4NQM A;  4QSV A;  3JVJ A;  5I7Y A;  3LXJ A;  5DFB A;  4KCX A;  4A9J A;  5FDZ A;  3LJW A;  4NS5 A;  3MB4 A;  5F1H A;  4FLP A;  4J1P A;  5DFC A;  4YAX A;  1WUM A;  3U5M A;  5FE7 A;  5J0D A;  5G4S A;  4CUQ A;  5H85 A;  4LZR A;  5FE5 A;  5HCL A;  5HFQ A;  2E7N A;  4YAT A;  4F3I A;  5HQ6 A;  5ENB A;  5EQ1 A;  5AD3 A;  4QYD A;  4QSS A;  3U5O A;  5KTW A;  3NXB A;  3UVY A;  4QEV A;  5IG6 A;  3LQI A;  4UYD A;  5F25 A;  4O74 A;  2OUO A;  5LKZ A;  5HQ7 A;  4A9F A;  4BW2 A;  5E9Y A;  4YC9 A;  2GRC A;  5CTL A;  4UYE A;  4PY6 A;  4NRB A;  5D7X A;  5AME A;  5L98 A;  5JI8 A;  4PKL A;  4UYF B;  3QZT A;  4IOR A;  4QYL A;  3MUK A;  5CQ6 A;  4Z6I A;  4QC1 A;  4PCI A;  5E7D A;  5BT4 A;  5A5N A;  5II1 A;  5DLX A;  4O78 A;  5E0R A;  5FE8 A;  5A7C A;  5C8G A;  2L85 A;  5CQ8 A;  4UIU A;  5KHM A;  3ONI A;  4ZQL A;  3UV4 A;  4CL9 A;  4A9N A;  5ENE A;  2I7K A;  4A9O A;  4DON A;  5EWW A;  5DFD A;  5D3P A;  4NRC A;  3ZYU A;  4X2I A;  5DYU A;  5E74 A;  3D7C A;  2R0Y A;  5ENF A;  4HBV A;  5A5O A;  5DW2 A;  3QZV A;  5D3N A;  4QEU A;  3P1F A;  5FBX A;  3S92 A;  3O34 A;  3O35 A;  5CFW A;  4TZ2 A;  5FB0 A;  4TT6 A;  5FE4 A;  5CQ5 A;  4UIT A;  5HEM A;  5A85 A;  5EWV A;  5A5S A;  3G0J A;  4BW1 A;  4O76 A;  3QZS A;  5EP7 A;  4N3W A;  5LJ0 A;  5LUU A;  5FE2 A;  4LYI A;  1JSP B;  5ETD A;  1X0J A;  5ENG A;  5F62 A;  5KTX A;  3UV2 A;  5DYA A;  5CGP A;  4CUU A;  5FE6 A;  4QUT A;  5CRZ A;  5HJC A;  5EK9 A;  2R10 A;  4MEQ A;  5ACY A;  4QZS A;  5I1Q A;  5F5Z A;  5DKD A;  5I29 A;  3Q2F A;  5D3L A;  4IR6 A;  4AKN A;  1E6I A;  5F36 A;  2OSS A;  4YBT A;  4J0S A;  4NXJ A;  4MEP A;  3S91 A;  4NUD A;  5I80 A;  4YYD A;  4WHW A;  4TTE A;  2RNY A;  4NR7 A;  3UVX A;  5D0C A;  5IGN A;  4YBM A;  4XYA A;  5TCM A;  5DW1 A;  2G4A A;  4O70 A;  4TZ8 A;  2FSA A;  5CQT A;  4YYI A;  5HRW A;  4BHW A;  5A5P A;  5C4Q A;  4YYM A;  2DVV A;  5HRX A;  5DKH A;  4HBX A;  3SVG A;  5D24 A;  5JWM A;  4LDF A;  5EU1 A;  4O77 A;  2DKW A;  4UIW A;  5EWH A;  4UYG A;  5ENC A;  5H1U A;  4QSW A;  5CQ4 A;  5FH6 A;  5D26 A;  4LR6 A;  5H1T A;  5CUC A;  5EM3 A;  4A9M A;  4OGI A;  4CLB A;  4YYK A;  3P5O A;  3G0L A;  5CZG A;  4NR6 A;  5EA1 A;  4XY9 A;  4O7E A;  5L8T A;  5KO4 A;  5L97 A;  5I7X A;  4J0R A;  4Q0O A;  5I83 A;  4NR4 A;  4NUC A;  5FH8 A;  4QB3 A;  5CUE A;  1ZS5 A;  5LKU A;  5E73 A;  2F6J A;  4LYW A;  5FH7 A;  5FFY A;  5DYC A;  5EGU A;  5LKX A;  5CQ7 A;  5HQ5 A;  3JVM A;  4O7B A;  5I88 A;  5HM0 A;  5FFW A;  5D3H A;  4KV1 A;  3DWY A;  5FE0 A;  2E3K A;  2WP1 A;  4NQN A;  4HXO A;  5E9L A;  4CFL A;  5IGK A;  2D82 A;  4YAD A;  2DVR A;  2L84 A;  5EIS A;  5ENI A;  2DVS A;  5CS8 A;  5FE9 A;  4QSP A;  4QR5 A;  5CU8 A;  4QY4 A;  3O36 A;  4HXS A;  3DAI A;  5CQA A;  4YYJ A;  5F63 A;  2YW5 A;  4QC3 A;  5CUG A;  5E9V A;  3K2J A;  4O7C A;  5DLZ A;  4A9K A;  3RCW A;  5CY9 A;  5L8U A;  5AD2 A;  5E3D A;  4YBS A;  2DAT A;  4Z1S A;  5IGM A;  4HXM A;  4HXK A;  4J3I A;  5CUD A;  5D3J A;  3MQM A;  4WIV A;  5FE1 A;  4PTB A;  5I89 A;  2KTB B;  5LKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...