2NXBA

Crystal structure of human bromodomain containing protein 3 (brd3)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
111
structure length
111
Chain Sequence
RKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 3
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 38
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2nxbA01
3MQMA 4J3IA 4CUTA 4NQNA 4LYIA 4TT2A 5L96A 4A9LA 2DKWA 5ENBA 4WIVA 3NXBA 5LUUA 5IGNA 3UVDA 4A9MA 5EM3A 4ALGA 4HBXA 5DYCA 4AKNA 3GG3A 4NYVA 4UITA 5CQ3A 4XY9A 5A5SA 2RO1A 4A9FA 5DKHA 1JM4B 4NUDA 2D9EA 2F6NA 4N4IA 5D25A 3MUKA 3QZSA 5I86A 5CGPA 4A9JA 4QUUA 3P1FA 4IR5A 5EISA 2YQDA 4MEQA 5CUDA 5H1VA 5CPEA 5DYAA 3O37A 5A5PA 1EQFA 4BJXA 5CP5A 4O7CA 4IOOA 4QSVA 4CFKA 4O7FA 5A83A 4HXOA 4DONA 3QZVA 5BT4A 4QBMA 4CFLA 4J0SA 5BT5A 4Q0NA 5C87A 4BW1A 2L84A 5C89A 3U5MA 4CUSA 4Q0OA 5D3SA 5KTWA 3UW9A 4BHWA 5L97A 4PTBA 4NUCA 4QSWA 5FH8A 5FG6A 2YELA 1ZS5A 3P1EA 3HMFA 2WP2A 5E3DA 5EWHA 4NR7A 4LR6A 3MULA 5D7XA 2RNWA 4N4GA 4MEPA 4E96A 2RNYA 4NYWA 4MR6A 4BW3A 4F3IA 4A9IA 5DFDA 2R0SA 4LRGA 4IR3A 5EQ1A 5FE0A 5DKCA 3AQAA 4NUEA 4UIXA 5ENJA 5EWVA 5E7DA 4YATA 4UYFB 4CUPA 4O74A 4X2IA 5EPBA 4QSTA 2OO1A 5FB0A 4NR6A 4MEOA 5COIA 2DVQA 3S92A 4QSPA 5EPRA 4TTEA 4HBYA 1WUMA 2YYNA 5D3HA 5ENEA 3UV2A 4NRBA 4N3WA 5CY9A 4HXSA 5FH7A 5C85A 5AMFA 4UIYA 5ETDA 4HXKA 2NXBA 2OSSA 5CUAA 5HM0A 4Z6IA 1N72A 4YH3A 5DKDA 4FLPA 4YYKA 3I3JA 2L85A 3UV4A 4YBMA 2YDWA 3SVHA 5HQ7A 5CTLA 5E0RA 5F60A 5A5NA 3IU6A 4PCIA 3ONIA 5TCMA 3MB4A 4BW4A 2WP1A 2L5EA 5DY7A 5F2PA 2OUOA 3UV5A 3U5PA 4RVRA 4NXJA 4QR5A 5HEMA 5A5RA 5HRXA 5HQ6A 4TT4A 5F62A 3DAIA 2E7OA 5F25A 5CUBA 5DW2A 4YABA 3S91A 3LXJA 5D3RA 4CL9A 4O72A 4OUFA 4CLBA 5FFVA 5H1TA 4NR9A 4WHWA 5EA1A 4Y03A 5HQ5A 4IR6A 3QZTA 5AD2A 4MENA 2DVRA 4A9HA 5HFRA 2E3KA 5DBMA 4ZQLA 4NQMA 5H85A 4O7BA 5HRVA 4QB3A 3MB3A 4HXPA 4QR3A 4IORA 4HBWA 4O7AA 5EWWA 5CS8A 5IG6A 5EVAA 4ALHA 5E3GA 2R0YA 5H1UA 4O70A 5E9YA 4UYEA 5AMEA 5DW1A 4NRCA 5CZGA 5ENCA 4PY6A 4N4FA 3ZYUA 4NS5A 4O75A 2RI7A 5TB6A 5CUGA 4A9NA 5D3JA 1F68A 5FE5A 3U5NA 4HBVA 4NR4A 5LKTA 4QR4A 4O77A 4A9KA 2G4AA 3JVLA 2YW5A 2F6JA 3SVFA 5D26A 3P1CA 3TLPA 3U5KA 4MR4A 5K29A 5ENFA 5AD3A 5E74A 4YYIA 5A81A 3HMEA 5FG5A 2DVVA 4CUQA 5FE4A 3LQJA 5D3NA 5G4RA 5LJ0A 5CQ5A 4TU4A 4LDFA 4LZSA 5DLXA 4TS8A 4C66A 3P1DA 3P5OA 4QYLA 5EU1A 2YEMA 5A85A 5CQ7A 5A5OA 4HXNA 5HENA 3DWYA 5I7YA 5I40A 4N4HA 5F5ZA 5EPSA 5EGUA 3D7CA 5EK9A 3MXFA 5CQ4A 4XYAA 4LZ2A 5CQ8A 4A9OA 3O36A 4QUTA 4OGJA 5F1LA 5LKXA 3UVWA 3JVKA 4UYFA 5HRWA 2DWWA 5DYUA 4TT6A 3LQHA 3Q2EA 2R10A 5I29A 5FE9A 3K2JA 4YYGA 4YYJA 5FBXA 4GPJA 4UIWA 2GRCA 5A7CA 4YY4A 5J0DA 4LYWA 4QSUA 5II2A 4KV4A 4IOQA 5HELA 5HLSA 4HXLA 3RCWA 5KO4A 4Z1QA 4YYHA 3G0LA 4NR8A 4QSQA 5II1A 5KHMA 5HFQA 5F1HA 3UVYA 5KTXA 5F63A 4Z1SA 5CUEA 4YH4A 5IBNA 5CRZA 5EI4A 4QEVA 5FG4A 2YEKA 4YY6A 5E9KA 5LVQA 4XUAA 5E9MA 4QC3A 3FKMX 5EWCA 5IIDA 5JWMA 5DLZA 5ETBA 4YBSA 4TYLA 2E7NA 5D3PA 5LKUA 4O71A 4CURA 2RS9B 3HMHA 4O7EA 3JVJA 4UYHA 4A9EA 5I83A 5KTUA 5LKZA 2D82A 4QYDA 5ACYA 5DFBA 5IGMA 5L99A 5FE8A 5FFWA 4HXRA 4LYSA 5JI8A 3LQIA 4TZ8A 5CQTA 4QY4A 5FB1A 5FH6A 2RFJA 5HCLA 4KV1A 4YYMA 4PKLA 5ENGA 5DYXA 5D0CA 5IGKA 3O34A 5DFCA 4PS5A 4YADA 5I88A 4TQNA 4LC2A 4UIZA 4UYDA 5EP7A 5EV9A 4UIVA 4O76A 1E6IA 4TU6A 2DVSA 3AADA 4HXMA 3UVXA 1JSPB 4KCXA 4YAXA 4C67A 5D3LA 5E9LA 5A82A 5E73A 5FE3A 5ENIA 2LSPB 5CUCA 5IGLA 5C7NA 3U5JA 3O35A 4XUBA 1X0JA 4UIUA 5D3TA 5L98A 5A5QA 4IR4A 4PCEA 3SVGA 5CU8A 4LZRA 2FSAA 2H60A 4O78A 5D24A 4QZSA 2MJVB 5L8TA 5HJCA 5EICA 4QEUA 4QNSA 4UYGA 4YC9A 5BT3A 4NR5A 5FDZA 5CRMA 5I7XA 5F3AA 5CQ6A 5E9IA 4BW2A 5FFYA 4J0RA 4QEWA 2KTBB 4MR5A 4J1PA 2DATA 2R0VA 4CUUA 4YBTA 4YYDA 5FE7A 4QSXA 5CQAA 5C4QA 5C8GA 5I1QA 4TZ2A 5LJ2A 3O33A 4ZC9A 4OGIA 4Z93A 5FE6A 4YYNA 2RNXA 5LVRA 5F61A 4XY8A 5LJ1A 3G0JA 4YK0A 5E9VA 5EWDA 3U5LA 5L8UA 1WUGA 4NYXA 5G4SA 3Q2FA 3LJWA 5FE1A 3IU5A 5I80A 4QC1A 2I8NA 3JVMA 5I89A 5FE2A 4QSSA 4MR3A 5DX4A 3U5OA 4WHUA 2I7KA 5CFWA 2N9GA 4NRAA 4Z6HA 5F36A 4ZW1A 5ENHA 4QSRA 5KU3A
chains in the Genus database with same CATH superfamily
3MQMA 4J3IA 4CUTA 4NQNA 4LYIA 4TT2A 5L96A 4A9LA 2DKWA 5ENBA 4WIVA 3NXBA 5LUUA 5IGNA 3UVDA 4A9MA 5EM3A 4ALGA 4HBXA 5DYCA 4AKNA 3GG3A 4NYVA 4UITA 5CQ3A 4XY9A 5A5SA 2RO1A 4A9FA 5DKHA 1JM4B 4NUDA 2D9EA 2F6NA 4N4IA 5D25A 3MUKA 3QZSA 5I86A 5CGPA 4A9JA 4QUUA 3P1FA 4IR5A 4AI6A 5EISA 2YQDA 4MEQA 5CUDA 5H1VA 5CPEA 5DYAA 3O37A 5A5PA 1EQFA 4BJXA 5CP5A 4O7CA 4IOOA 4QSVA 4CFKA 4O7FA 5A83A 4HXOA 4DONA 3QZVA 5BT4A 4QBMA 4CFLA 4J0SA 5BT5A 4Q0NA 5C87A 4BW1A 2L84A 5C89A 3U5MA 4CUSA 4Q0OA 5D3SA 5KTWA 3UW9A 4BHWA 5L97A 4PTBA 4NUCA 4QSWA 5FH8A 5FG6A 2YELA 1ZS5A 3P1EA 3HMFA 2WP2A 5E3DA 5EWHA 4NR7A 4LR6A 3MULA 5D7XA 2RNWA 4N4GA 4MEPA 4E96A 2RNYA 4NYWA 4MR6A 4BW3A 4F3IA 4A9IA 5DFDA 2R0SA 4LRGA 3VKHA 4IR3A 5EQ1A 5FE0A 5DKCA 3AQAA 4NUEA 4UIXA 4AKIA 5ENJA 5EWVA 5E7DA 4YATA 4UYFB 4CUPA 4O74A 4X2IA 5EPBA 4QSTA 2OO1A 5FB0A 4NR6A 4MEOA 5COIA 2DVQA 3S92A 4QSPA 5EPRA 4TTEA 4HBYA 1WUMA 2YYNA 5D3HA 5ENEA 3UV2A 4NRBA 4N3WA 5CY9A 4HXSA 5FH7A 5C85A 5AMFA 4UIYA 5ETDA 4HXKA 2NXBA 2OSSA 5CUAA 5HM0A 4Z6IA 1N72A 4YH3A 5DKDA 4FLPA 4YYKA 3I3JA 2L85A 3UV4A 4YBMA 2YDWA 3SVHA 5HQ7A 5CTLA 5E0RA 5F60A 5A5NA 3IU6A 4PCIA 3ONIA 5TCMA 3MB4A 4BW4A 2WP1A 2L5EA 5DY7A 5F2PA 2OUOA 3UV5A 3U5PA 4RVRA 4NXJA 4QR5A 5HEMA 5A5RA 5HRXA 5HQ6A 4TT4A 5F62A 3DAIA 2E7OA 5F25A 5CUBA 5DW2A 4YABA 3S91A 3LXJA 5D3RA 4CL9A 4O72A 4OUFA 4CLBA 5FFVA 5H1TA 4NR9A 4WHWA 5EA1A 4Y03A 5HQ5A 4IR6A 3QZTA 5AD2A 4MENA 2DVRA 4A9HA 5HFRA 2E3KA 5DBMA 4ZQLA 4NQMA 5H85A 4O7BA 5HRVA 4QB3A 3MB3A 4HXPA 4QR3A 4IORA 4HBWA 4O7AA 5EWWA 5CS8A 5IG6A 5EVAA 4ALHA 5E3GA 2R0YA 5H1UA 4O70A 5E9YA 4UYEA 5AMEA 5DW1A 4NRCA 5CZGA 5ENCA 4PY6A 4N4FA 3ZYUA 4NS5A 4O75A 2RI7A 5TB6A 5CUGA 4A9NA 5D3JA 1F68A 5FE5A 3U5NA 4HBVA 4NR4A 5LKTA 4QR4A 4O77A 4A9KA 2G4AA 3JVLA 2YW5A 2F6JA 3SVFA 5D26A 3P1CA 3TLPA 3U5KA 4MR4A 5K29A 5ENFA 5AD3A 5E74A 4YYIA 5A81A 3HMEA 5FG5A 2DVVA 4CUQA 5FE4A 3LQJA 5D3NA 5G4RA 5LJ0A 5CQ5A 4TU4A 4LDFA 4LZSA 5DLXA 4TS8A 4C66A 3P1DA 3P5OA 4QYLA 5EU1A 2YEMA 5A85A 5CQ7A 5A5OA 4HXNA 5HENA 3DWYA 2EJNA 5I7YA 5I40A 4N4HA 5F5ZA 5EPSA 5EGUA 3D7CA 5EK9A 3MXFA 5CQ4A 4XYAA 4LZ2A 5CQ8A 4A9OA 3O36A 4QUTA 3ERRA 4OGJA 5F1LA 5LKXA 3UVWA 3JVKA 4UYFA 5HRWA 2DWWA 5DYUA 4TT6A 3LQHA 3Q2EA 2R10A 5I29A 5FE9A 3K2JA 4YYGA 4YYJA 4AKHA 5FBXA 4GPJA 4UIWA 2GRCA 5A7CA 4YY4A 5J0DA 4LYWA 4QSUA 5II2A 4KV4A 4IOQA 5HELA 5HLSA 4HXLA 3RCWA 5KO4A 4Z1QA 4YYHA 3G0LA 4NR8A 4QSQA 5II1A 5KHMA 5HFQA 5F1HA 3UVYA 5KTXA 5F63A 4Z1SA 5CUEA 4YH4A 5IBNA 5CRZA 5EI4A 3D1BA 4QEVA 5FG4A 2YEKA 4YY6A 5E9KA 5LVQA 4XUAA 5E9MA 4QC3A 3FKMX 5EWCA 5IIDA 5JWMA 5DLZA 5ETBA 4YBSA 4TYLA 2E7NA 5D3PA 5LKUA 4O71A 4CURA 2RS9B 3HMHA 4O7EA 3JVJA 4UYHA 4A9EA 5I83A 5KTUA 5LKZA 2D82A 4QYDA 5ACYA 5DFBA 5IGMA 5L99A 5FE8A 5FFWA 4HXRA 4LYSA 5JI8A 3LQIA 4TZ8A 5CQTA 4QY4A 5FB1A 5FH6A 2RFJA 5HCLA 4KV1A 4YYMA 4PKLA 5ENGA 5DYXA 5D0CA 1PUOA 3O34A 5IGKA 5DFCA 4PS5A 4YADA 5I88A 4TQNA 4LC2A 4UIZA 4UYDA 5EP7A 5EV9A 4UIVA 3VKGA 4O76A 1E6IA 4TU6A 2DVSA 3AADA 4HXMA 3UVXA 1JSPB 4KCXA 4YAXA 4C67A 5D3LA 5E9LA 5A82A 5E73A 5FE3A 5ENIA 2LSPB 5CUCA 5IGLA 5C7NA 3U5JA 3O35A 4XUBA 1X0JA 4UIUA 5D3TA 5L98A 5A5QA 4IR4A 4PCEA 3SVGA 5CU8A 4LZRA 2FSAA 2H60A 4O78A 5D24A 4QZSA 2MJVB 5L8TA 5HJCA 5EICA 4QEUA 4QNSA 4UYGA 4YC9A 5BT3A 4NR5A 5FDZA 5CRMA 5I7XA 5F3AA 5CQ6A 5E9IA 4BW2A 5FFYA 4J0RA 4QEWA 2KTBB 4MR5A 4J1PA 2DATA 2R0VA 4CUUA 4YBTA 4YYDA 5FE7A 4QSXA 5CQAA 5C4QA 5C8GA 5I1QA 4TZ2A 4AKGA 5LJ2A 3O33A 4ZC9A 4OGIA 3D1DA 4Z93A 5FE6A 4YYNA 2RNXA 5LVRA 5F61A 4XY8A 5LJ1A 3G0JA 4YK0A 5E9VA 5EWDA 3U5LA 5L8UA 1WUGA 4NYXA 5G4SA 3Q2FA 3LJWA 5FE1A 3IU5A 5I80A 4QC1A 2I8NA 3JVMA 5I89A 5FE2A 4QSSA 4MR3A 5DX4A 3U5OA 4WHUA 2I7KA 1ZKRA 5CFWA 2N9GA 4NRAA 4Z6HA 5F36A 4ZW1A 5ENHA 4QSRA 5KU3A
chains in the Genus database with same CATH topology
3MQMA 4J3IA 4CUTA 4NQNA 4LYIA 4TT2A 5L96A 4A9LA 2DKWA 5ENBA 4WIVA 3NXBA 5LUUA 5IGNA 3UVDA 4A9MA 5EM3A 4ALGA 4HBXA 5DYCA 4AKNA 3GG3A 4NYVA 4UITA 5CQ3A 4XY9A 5A5SA 2RO1A 4A9FA 5DKHA 1JM4B 4NUDA 2D9EA 2F6NA 4N4IA 5D25A 3MUKA 3QZSA 5I86A 5CGPA 4A9JA 4QUUA 3P1FA 4IR5A 5EISA 2YQDA 4MEQA 5CUDA 5H1VA 5CPEA 5DYAA 3O37A 5A5PA 1EQFA 4BJXA 5CP5A 4O7CA 4IOOA 4QSVA 4CFKA 4O7FA 5A83A 4HXOA 4DONA 3QZVA 5BT4A 4QBMA 4CFLA 4J0SA 5BT5A 4Q0NA 5C87A 4BW1A 2L84A 5C89A 3U5MA 4CUSA 4Q0OA 5D3SA 5KTWA 3UW9A 4BHWA 5L97A 4PTBA 4NUCA 4QSWA 5FH8A 5FG6A 2YELA 1ZS5A 3P1EA 3HMFA 2WP2A 5E3DA 5EWHA 4NR7A 4LR6A 3MULA 5D7XA 2RNWA 4N4GA 4MEPA 4E96A 2RNYA 4NYWA 4MR6A 4BW3A 4F3IA 4A9IA 5DFDA 2R0SA 4LRGA 4IR3A 5EQ1A 5FE0A 5DKCA 3AQAA 4NUEA 4UIXA 5ENJA 5EWVA 5E7DA 4YATA 4UYFB 4CUPA 4O74A 4X2IA 5EPBA 4QSTA 2OO1A 5FB0A 4NR6A 4MEOA 5COIA 2DVQA 3S92A 4QSPA 5EPRA 4TTEA 4HBYA 1WUMA 2YYNA 5D3HA 5ENEA 3UV2A 4NRBA 4N3WA 5CY9A 4HXSA 5FH7A 5C85A 5AMFA 4UIYA 5ETDA 4HXKA 2NXBA 2OSSA 5CUAA 5HM0A 4Z6IA 1N72A 4YH3A 5DKDA 4FLPA 4YYKA 3I3JA 2L85A 3UV4A 4YBMA 2YDWA 3SVHA 5HQ7A 5CTLA 5E0RA 5F60A 5A5NA 3IU6A 4PCIA 3ONIA 5TCMA 3MB4A 4BW4A 2WP1A 2L5EA 5DY7A 5F2PA 2OUOA 3UV5A 3U5PA 4RVRA 4NXJA 4QR5A 5HEMA 5A5RA 5HRXA 5HQ6A 4TT4A 5F62A 3DAIA 2E7OA 5F25A 5CUBA 5DW2A 4YABA 3S91A 3LXJA 5D3RA 4CL9A 4O72A 4OUFA 4CLBA 5FFVA 5H1TA 4NR9A 4WHWA 5EA1A 4Y03A 5HQ5A 4IR6A 3QZTA 5AD2A 4MENA 2DVRA 4A9HA 5HFRA 2E3KA 5DBMA 4ZQLA 4NQMA 5H85A 4O7BA 5HRVA 4QB3A 3MB3A 4HXPA 4QR3A 4IORA 4HBWA 4O7AA 5EWWA 5CS8A 5IG6A 5EVAA 4ALHA 5E3GA 2R0YA 5H1UA 4O70A 5E9YA 4UYEA 5AMEA 5DW1A 4NRCA 5CZGA 5ENCA 4PY6A 4N4FA 3ZYUA 4NS5A 4O75A 2RI7A 5TB6A 5CUGA 4A9NA 5D3JA 1F68A 5FE5A 3U5NA 4HBVA 4NR4A 5LKTA 4QR4A 4O77A 4A9KA 2G4AA 3JVLA 2YW5A 2F6JA 3SVFA 5D26A 3P1CA 3TLPA 3U5KA 4MR4A 5K29A 5ENFA 5AD3A 5E74A 4YYIA 5A81A 3HMEA 5FG5A 2DVVA 4CUQA 5FE4A 3LQJA 5D3NA 5G4RA 5LJ0A 5CQ5A 4TU4A 4LDFA 4LZSA 5DLXA 4TS8A 4C66A 3P1DA 3P5OA 4QYLA 5EU1A 2YEMA 5A85A 5CQ7A 5A5OA 4HXNA 5HENA 3DWYA 5I7YA 5I40A 4N4HA 5F5ZA 5EPSA 5EGUA 3D7CA 5EK9A 3MXFA 5CQ4A 4XYAA 4LZ2A 5CQ8A 4A9OA 3O36A 4QUTA 4OGJA 5F1LA 5LKXA 3UVWA 3JVKA 4UYFA 5HRWA 2DWWA 5DYUA 4TT6A 3LQHA 3Q2EA 2R10A 5I29A 5FE9A 3K2JA 4YYGA 4YYJA 5FBXA 4GPJA 4UIWA 2GRCA 5A7CA 4YY4A 5J0DA 4LYWA 4QSUA 5II2A 4KV4A 4IOQA 5HELA 5HLSA 4HXLA 3RCWA 5KO4A 4Z1QA 4YYHA 3G0LA 4NR8A 4QSQA 5II1A 5KHMA 5HFQA 5F1HA 3UVYA 5KTXA 5F63A 4Z1SA 5CUEA 4YH4A 5IBNA 5CRZA 5EI4A 4QEVA 5FG4A 2YEKA 4YY6A 5E9KA 5LVQA 4XUAA 5E9MA 4QC3A 3FKMX 5EWCA 5IIDA 5JWMA 5DLZA 5ETBA 4YBSA 4TYLA 2E7NA 5D3PA 5LKUA 4O71A 4CURA 2RS9B 3HMHA 4O7EA 3JVJA 4UYHA 4A9EA 5I83A 5KTUA 5LKZA 2D82A 4QYDA 5ACYA 5DFBA 5IGMA 5L99A 5FE8A 5FFWA 4HXRA 4LYSA 5JI8A 3LQIA 4TZ8A 5CQTA 4QY4A 5FB1A 5FH6A 2RFJA 5HCLA 4KV1A 4YYMA 4PKLA 5ENGA 5DYXA 5D0CA 5IGKA 3O34A 5DFCA 4PS5A 4YADA 5I88A 4TQNA 4LC2A 4UIZA 4UYDA 5EP7A 5EV9A 4UIVA 4O76A 1E6IA 4TU6A 2DVSA 3AADA 4HXMA 3UVXA 1JSPB 4KCXA 4YAXA 4C67A 5D3LA 5E9LA 5A82A 5E73A 5FE3A 5ENIA 2LSPB 5CUCA 5IGLA 5C7NA 3U5JA 3O35A 4XUBA 1X0JA 4UIUA 5D3TA 5L98A 5A5QA 4IR4A 4PCEA 3SVGA 5CU8A 4LZRA 2FSAA 2H60A 4O78A 5D24A 4QZSA 2MJVB 5L8TA 5HJCA 5EICA 4QEUA 4QNSA 4UYGA 4YC9A 5BT3A 4NR5A 5FDZA 5CRMA 5I7XA 5F3AA 5CQ6A 5E9IA 4BW2A 5FFYA 4J0RA 4QEWA 2KTBB 4MR5A 4J1PA 2DATA 2R0VA 4CUUA 4YBTA 4YYDA 5FE7A 4QSXA 5CQAA 5C4QA 5C8GA 5I1QA 4TZ2A 5LJ2A 3O33A 4ZC9A 4OGIA 4Z93A 5FE6A 4YYNA 2RNXA 5LVRA 5F61A 4XY8A 5LJ1A 3G0JA 4YK0A 5E9VA 5EWDA 3U5LA 5L8UA 1WUGA 4NYXA 5G4SA 3Q2FA 3LJWA 5FE1A 3IU5A 5I80A 4QC1A 2I8NA 3JVMA 5I89A 5FE2A 4QSSA 4MR3A 5DX4A 3U5OA 4WHUA 2I7KA 5CFWA 2N9GA 4NRAA 4Z6HA 5F36A 4ZW1A 5ENHA 4QSRA 5KU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQM A;  4J3I A;  4CUT A;  4NQN A;  4LYI A;  4TT2 A;  5L96 A;  4A9L A;  2DKW A;  5ENB A;  4WIV A;  3NXB A;  5LUU A;  5IGN A;  3UVD A;  4A9M A;  5EM3 A;  4ALG A;  4HBX A;  5DYC A;  4AKN A;  3GG3 A;  4NYV A;  4UIT A;  5CQ3 A;  4XY9 A;  5A5S A;  2RO1 A;  4A9F A;  5DKH A;  1JM4 B;  4NUD A;  2D9E A;  2F6N A;  4N4I A;  5D25 A;  3MUK A;  3QZS A;  5I86 A;  5CGP A;  4A9J A;  4QUU A;  3P1F A;  4IR5 A;  5EIS A;  2YQD A;  4MEQ A;  5CUD A;  5H1V A;  5CPE A;  5DYA A;  3O37 A;  5A5P A;  1EQF A;  4BJX A;  5CP5 A;  4O7C A;  4IOO A;  4QSV A;  4CFK A;  4O7F A;  5A83 A;  4HXO A;  4DON A;  3QZV A;  5BT4 A;  4QBM A;  4CFL A;  4J0S A;  5BT5 A;  4Q0N A;  5C87 A;  4BW1 A;  2L84 A;  5C89 A;  3U5M A;  4CUS A;  4Q0O A;  5D3S A;  5KTW A;  3UW9 A;  4BHW A;  5L97 A;  4PTB A;  4NUC A;  4QSW A;  5FH8 A;  5FG6 A;  2YEL A;  1ZS5 A;  3P1E A;  3HMF A;  2WP2 A;  5E3D A;  5EWH A;  4NR7 A;  4LR6 A;  3MUL A;  5D7X A;  2RNW A;  4N4G A;  4MEP A;  4E96 A;  2RNY A;  4NYW A;  4MR6 A;  4BW3 A;  4F3I A;  4A9I A;  5DFD A;  2R0S A;  4LRG A;  4IR3 A;  5EQ1 A;  5FE0 A;  5DKC A;  3AQA A;  4NUE A;  4UIX A;  5ENJ A;  5EWV A;  5E7D A;  4YAT A;  4UYF B;  4CUP A;  4O74 A;  4X2I A;  5EPB A;  4QST A;  2OO1 A;  5FB0 A;  4NR6 A;  4MEO A;  5COI A;  2DVQ A;  3S92 A;  4QSP A;  5EPR A;  4TTE A;  4HBY A;  1WUM A;  2YYN A;  5D3H A;  5ENE A;  3UV2 A;  4NRB A;  4N3W A;  5CY9 A;  4HXS A;  5FH7 A;  5C85 A;  5AMF A;  4UIY A;  5ETD A;  4HXK A;  2NXB A;  2OSS A;  5CUA A;  5HM0 A;  4Z6I A;  1N72 A;  4YH3 A;  5DKD A;  4FLP A;  4YYK A;  3I3J A;  2L85 A;  3UV4 A;  4YBM A;  2YDW A;  3SVH A;  5HQ7 A;  5CTL A;  5E0R A;  5F60 A;  5A5N A;  3IU6 A;  4PCI A;  3ONI A;  5TCM A;  3MB4 A;  4BW4 A;  2WP1 A;  2L5E A;  5DY7 A;  5F2P A;  2OUO A;  3UV5 A;  3U5P A;  4RVR A;  4NXJ A;  4QR5 A;  5HEM A;  5A5R A;  5HRX A;  5HQ6 A;  4TT4 A;  5F62 A;  3DAI A;  2E7O A;  5F25 A;  5CUB A;  5DW2 A;  4YAB A;  3S91 A;  3LXJ A;  5D3R A;  4CL9 A;  4O72 A;  4OUF A;  4CLB A;  5FFV A;  5H1T A;  4NR9 A;  4WHW A;  5EA1 A;  4Y03 A;  5HQ5 A;  4IR6 A;  3QZT A;  5AD2 A;  4MEN A;  2DVR A;  4A9H A;  5HFR A;  2E3K A;  5DBM A;  4ZQL A;  4NQM A;  5H85 A;  4O7B A;  5HRV A;  4QB3 A;  3MB3 A;  4HXP A;  4QR3 A;  4IOR A;  4HBW A;  4O7A A;  5EWW A;  5CS8 A;  5IG6 A;  5EVA A;  4ALH A;  5E3G A;  2R0Y A;  5H1U A;  4O70 A;  5E9Y A;  4UYE A;  5AME A;  5DW1 A;  4NRC A;  5CZG A;  5ENC A;  4PY6 A;  4N4F A;  3ZYU A;  4NS5 A;  4O75 A;  2RI7 A;  5TB6 A;  5CUG A;  4A9N A;  5D3J A;  1F68 A;  5FE5 A;  3U5N A;  4HBV A;  4NR4 A;  5LKT A;  4QR4 A;  4O77 A;  4A9K A;  2G4A A;  3JVL A;  2YW5 A;  2F6J A;  3SVF A;  5D26 A;  3P1C A;  3TLP A;  3U5K A;  4MR4 A;  5K29 A;  5ENF A;  5AD3 A;  5E74 A;  4YYI A;  5A81 A;  3HME A;  5FG5 A;  2DVV A;  4CUQ A;  5FE4 A;  3LQJ A;  5D3N A;  5G4R A;  5LJ0 A;  5CQ5 A;  4TU4 A;  4LDF A;  4LZS A;  5DLX A;  4TS8 A;  4C66 A;  3P1D A;  3P5O A;  4QYL A;  5EU1 A;  2YEM A;  5A85 A;  5CQ7 A;  5A5O A;  4HXN A;  5HEN A;  3DWY A;  5I7Y A;  5I40 A;  4N4H A;  5F5Z A;  5EPS A;  5EGU A;  3D7C A;  5EK9 A;  3MXF A;  5CQ4 A;  4XYA A;  4LZ2 A;  5CQ8 A;  4A9O A;  3O36 A;  4QUT A;  4OGJ A;  5F1L A;  5LKX A;  3UVW A;  3JVK A;  4UYF A;  5HRW A;  2DWW A;  5DYU A;  4TT6 A;  3LQH A;  3Q2E A;  2R10 A;  5I29 A;  5FE9 A;  3K2J A;  4YYG A;  4YYJ A;  5FBX A;  4GPJ A;  4UIW A;  2GRC A;  5A7C A;  4YY4 A;  5J0D A;  4LYW A;  4QSU A;  5II2 A;  4KV4 A;  4IOQ A;  5HEL A;  5HLS A;  4HXL A;  3RCW A;  5KO4 A;  4Z1Q A;  4YYH A;  3G0L A;  4NR8 A;  4QSQ A;  5II1 A;  5KHM A;  5HFQ A;  5F1H A;  3UVY A;  5KTX A;  5F63 A;  4Z1S A;  5CUE A;  4YH4 A;  5IBN A;  5CRZ A;  5EI4 A;  4QEV A;  5FG4 A;  2YEK A;  4YY6 A;  5E9K A;  5LVQ A;  4XUA A;  5E9M A;  4QC3 A;  3FKM X;  5EWC A;  5IID A;  5JWM A;  5DLZ A;  5ETB A;  4YBS A;  4TYL A;  2E7N A;  5D3P A;  5LKU A;  4O71 A;  4CUR A;  2RS9 B;  3HMH A;  4O7E A;  3JVJ A;  4UYH A;  4A9E A;  5I83 A;  5KTU A;  5LKZ A;  2D82 A;  4QYD A;  5ACY A;  5DFB A;  5IGM A;  5L99 A;  5FE8 A;  5FFW A;  4HXR A;  4LYS A;  5JI8 A;  3LQI A;  4TZ8 A;  5CQT A;  4QY4 A;  5FB1 A;  5FH6 A;  2RFJ A;  5HCL A;  4KV1 A;  4YYM A;  4PKL A;  5ENG A;  5DYX A;  5D0C A;  5IGK A;  3O34 A;  5DFC A;  4PS5 A;  4YAD A;  5I88 A;  4TQN A;  4LC2 A;  4UIZ A;  4UYD A;  5EP7 A;  5EV9 A;  4UIV A;  4O76 A;  1E6I A;  4TU6 A;  2DVS A;  3AAD A;  4HXM A;  3UVX A;  1JSP B;  4KCX A;  4YAX A;  4C67 A;  5D3L A;  5E9L A;  5A82 A;  5E73 A;  5FE3 A;  5ENI A;  2LSP B;  5CUC A;  5IGL A;  5C7N A;  3U5J A;  3O35 A;  4XUB A;  1X0J A;  4UIU A;  5D3T A;  5L98 A;  5A5Q A;  4IR4 A;  4PCE A;  3SVG A;  5CU8 A;  4LZR A;  2FSA A;  2H60 A;  4O78 A;  5D24 A;  4QZS A;  2MJV B;  5L8T A;  5HJC A;  5EIC A;  4QEU A;  4QNS A;  4UYG A;  4YC9 A;  5BT3 A;  4NR5 A;  5FDZ A;  5CRM A;  5I7X A;  5F3A A;  5CQ6 A;  5E9I A;  4BW2 A;  5FFY A;  4J0R A;  4QEW A;  2KTB B;  4MR5 A;  4J1P A;  2DAT A;  2R0V A;  4CUU A;  4YBT A;  4YYD A;  5FE7 A;  4QSX A;  5CQA A;  5C4Q A;  5C8G A;  5I1Q A;  4TZ2 A;  5LJ2 A;  3O33 A;  4ZC9 A;  4OGI A;  4Z93 A;  5FE6 A;  4YYN A;  2RNX A;  5LVR A;  5F61 A;  4XY8 A;  5LJ1 A;  3G0J A;  4YK0 A;  5E9V A;  5EWD A;  3U5L A;  5L8U A;  1WUG A;  4NYX A;  5G4S A;  3Q2F A;  3LJW A;  5FE1 A;  3IU5 A;  5I80 A;  4QC1 A;  2I8N A;  3JVM A;  5I89 A;  5FE2 A;  4QSS A;  4MR3 A;  5DX4 A;  3U5O A;  4WHU A;  2I7K A;  5CFW A;  2N9G A;  4NRA A;  4Z6H A;  5F36 A;  4ZW1 A;  5ENH A;  4QSR A;  5KU3 A; 
#chains in the Genus database with same CATH topology
 3MQM A;  4J3I A;  4CUT A;  4NQN A;  4LYI A;  4TT2 A;  5L96 A;  4A9L A;  2DKW A;  5ENB A;  4WIV A;  3NXB A;  5LUU A;  5IGN A;  3UVD A;  4A9M A;  5EM3 A;  4ALG A;  4HBX A;  5DYC A;  4AKN A;  3GG3 A;  4NYV A;  4UIT A;  5CQ3 A;  4XY9 A;  5A5S A;  2RO1 A;  4A9F A;  5DKH A;  1JM4 B;  4NUD A;  2D9E A;  2F6N A;  4N4I A;  5D25 A;  3MUK A;  3QZS A;  5I86 A;  5CGP A;  4A9J A;  4QUU A;  3P1F A;  4IR5 A;  4AI6 A;  5EIS A;  2YQD A;  4MEQ A;  5CUD A;  5H1V A;  5CPE A;  5DYA A;  3O37 A;  5A5P A;  1EQF A;  4BJX A;  5CP5 A;  4O7C A;  4IOO A;  4QSV A;  4CFK A;  4O7F A;  5A83 A;  4HXO A;  4DON A;  3QZV A;  5BT4 A;  4QBM A;  4CFL A;  4J0S A;  5BT5 A;  4Q0N A;  5C87 A;  4BW1 A;  2L84 A;  5C89 A;  3U5M A;  4CUS A;  4Q0O A;  5D3S A;  5KTW A;  3UW9 A;  4BHW A;  5L97 A;  4PTB A;  4NUC A;  4QSW A;  5FH8 A;  5FG6 A;  2YEL A;  1ZS5 A;  3P1E A;  3HMF A;  2WP2 A;  5E3D A;  5EWH A;  4NR7 A;  4LR6 A;  3MUL A;  5D7X A;  2RNW A;  4N4G A;  4MEP A;  4E96 A;  2RNY A;  4NYW A;  4MR6 A;  4BW3 A;  4F3I A;  4A9I A;  5DFD A;  2R0S A;  4LRG A;  3VKH A;  4IR3 A;  5EQ1 A;  5FE0 A;  5DKC A;  3AQA A;  4NUE A;  4UIX A;  4AKI A;  5ENJ A;  5EWV A;  5E7D A;  4YAT A;  4UYF B;  4CUP A;  4O74 A;  4X2I A;  5EPB A;  4QST A;  2OO1 A;  5FB0 A;  4NR6 A;  4MEO A;  5COI A;  2DVQ A;  3S92 A;  4QSP A;  5EPR A;  4TTE A;  4HBY A;  1WUM A;  2YYN A;  5D3H A;  5ENE A;  3UV2 A;  4NRB A;  4N3W A;  5CY9 A;  4HXS A;  5FH7 A;  5C85 A;  5AMF A;  4UIY A;  5ETD A;  4HXK A;  2NXB A;  2OSS A;  5CUA A;  5HM0 A;  4Z6I A;  1N72 A;  4YH3 A;  5DKD A;  4FLP A;  4YYK A;  3I3J A;  2L85 A;  3UV4 A;  4YBM A;  2YDW A;  3SVH A;  5HQ7 A;  5CTL A;  5E0R A;  5F60 A;  5A5N A;  3IU6 A;  4PCI A;  3ONI A;  5TCM A;  3MB4 A;  4BW4 A;  2WP1 A;  2L5E A;  5DY7 A;  5F2P A;  2OUO A;  3UV5 A;  3U5P A;  4RVR A;  4NXJ A;  4QR5 A;  5HEM A;  5A5R A;  5HRX A;  5HQ6 A;  4TT4 A;  5F62 A;  3DAI A;  2E7O A;  5F25 A;  5CUB A;  5DW2 A;  4YAB A;  3S91 A;  3LXJ A;  5D3R A;  4CL9 A;  4O72 A;  4OUF A;  4CLB A;  5FFV A;  5H1T A;  4NR9 A;  4WHW A;  5EA1 A;  4Y03 A;  5HQ5 A;  4IR6 A;  3QZT A;  5AD2 A;  4MEN A;  2DVR A;  4A9H A;  5HFR A;  2E3K A;  5DBM A;  4ZQL A;  4NQM A;  5H85 A;  4O7B A;  5HRV A;  4QB3 A;  3MB3 A;  4HXP A;  4QR3 A;  4IOR A;  4HBW A;  4O7A A;  5EWW A;  5CS8 A;  5IG6 A;  5EVA A;  4ALH A;  5E3G A;  2R0Y A;  5H1U A;  4O70 A;  5E9Y A;  4UYE A;  5AME A;  5DW1 A;  4NRC A;  5CZG A;  5ENC A;  4PY6 A;  4N4F A;  3ZYU A;  4NS5 A;  4O75 A;  2RI7 A;  5TB6 A;  5CUG A;  4A9N A;  5D3J A;  1F68 A;  5FE5 A;  3U5N A;  4HBV A;  4NR4 A;  5LKT A;  4QR4 A;  4O77 A;  4A9K A;  2G4A A;  3JVL A;  2YW5 A;  2F6J A;  3SVF A;  5D26 A;  3P1C A;  3TLP A;  3U5K A;  4MR4 A;  5K29 A;  5ENF A;  5AD3 A;  5E74 A;  4YYI A;  5A81 A;  3HME A;  5FG5 A;  2DVV A;  4CUQ A;  5FE4 A;  3LQJ A;  5D3N A;  5G4R A;  5LJ0 A;  5CQ5 A;  4TU4 A;  4LDF A;  4LZS A;  5DLX A;  4TS8 A;  4C66 A;  3P1D A;  3P5O A;  4QYL A;  5EU1 A;  2YEM A;  5A85 A;  5CQ7 A;  5A5O A;  4HXN A;  5HEN A;  3DWY A;  2EJN A;  5I7Y A;  5I40 A;  4N4H A;  5F5Z A;  5EPS A;  5EGU A;  3D7C A;  5EK9 A;  3MXF A;  5CQ4 A;  4XYA A;  4LZ2 A;  5CQ8 A;  4A9O A;  3O36 A;  4QUT A;  3ERR A;  4OGJ A;  5F1L A;  5LKX A;  3UVW A;  3JVK A;  4UYF A;  5HRW A;  2DWW A;  5DYU A;  4TT6 A;  3LQH A;  3Q2E A;  2R10 A;  5I29 A;  5FE9 A;  3K2J A;  4YYG A;  4YYJ A;  4AKH A;  5FBX A;  4GPJ A;  4UIW A;  2GRC A;  5A7C A;  4YY4 A;  5J0D A;  4LYW A;  4QSU A;  5II2 A;  4KV4 A;  4IOQ A;  5HEL A;  5HLS A;  4HXL A;  3RCW A;  5KO4 A;  4Z1Q A;  4YYH A;  3G0L A;  4NR8 A;  4QSQ A;  5II1 A;  5KHM A;  5HFQ A;  5F1H A;  3UVY A;  5KTX A;  5F63 A;  4Z1S A;  5CUE A;  4YH4 A;  5IBN A;  5CRZ A;  5EI4 A;  3D1B A;  4QEV A;  5FG4 A;  2YEK A;  4YY6 A;  5E9K A;  5LVQ A;  4XUA A;  5E9M A;  4QC3 A;  3FKM X;  5EWC A;  5IID A;  5JWM A;  5DLZ A;  5ETB A;  4YBS A;  4TYL A;  2E7N A;  5D3P A;  5LKU A;  4O71 A;  4CUR A;  2RS9 B;  3HMH A;  4O7E A;  3JVJ A;  4UYH A;  4A9E A;  5I83 A;  5KTU A;  5LKZ A;  2D82 A;  4QYD A;  5ACY A;  5DFB A;  5IGM A;  5L99 A;  5FE8 A;  5FFW A;  4HXR A;  4LYS A;  5JI8 A;  3LQI A;  4TZ8 A;  5CQT A;  4QY4 A;  5FB1 A;  5FH6 A;  2RFJ A;  5HCL A;  4KV1 A;  4YYM A;  4PKL A;  5ENG A;  5DYX A;  5D0C A;  1PUO A;  3O34 A;  5IGK A;  5DFC A;  4PS5 A;  4YAD A;  5I88 A;  4TQN A;  4LC2 A;  4UIZ A;  4UYD A;  5EP7 A;  5EV9 A;  4UIV A;  3VKG A;  4O76 A;  1E6I A;  4TU6 A;  2DVS A;  3AAD A;  4HXM A;  3UVX A;  1JSP B;  4KCX A;  4YAX A;  4C67 A;  5D3L A;  5E9L A;  5A82 A;  5E73 A;  5FE3 A;  5ENI A;  2LSP B;  5CUC A;  5IGL A;  5C7N A;  3U5J A;  3O35 A;  4XUB A;  1X0J A;  4UIU A;  5D3T A;  5L98 A;  5A5Q A;  4IR4 A;  4PCE A;  3SVG A;  5CU8 A;  4LZR A;  2FSA A;  2H60 A;  4O78 A;  5D24 A;  4QZS A;  2MJV B;  5L8T A;  5HJC A;  5EIC A;  4QEU A;  4QNS A;  4UYG A;  4YC9 A;  5BT3 A;  4NR5 A;  5FDZ A;  5CRM A;  5I7X A;  5F3A A;  5CQ6 A;  5E9I A;  4BW2 A;  5FFY A;  4J0R A;  4QEW A;  2KTB B;  4MR5 A;  4J1P A;  2DAT A;  2R0V A;  4CUU A;  4YBT A;  4YYD A;  5FE7 A;  4QSX A;  5CQA A;  5C4Q A;  5C8G A;  5I1Q A;  4TZ2 A;  4AKG A;  5LJ2 A;  3O33 A;  4ZC9 A;  4OGI A;  3D1D A;  4Z93 A;  5FE6 A;  4YYN A;  2RNX A;  5LVR A;  5F61 A;  4XY8 A;  5LJ1 A;  3G0J A;  4YK0 A;  5E9V A;  5EWD A;  3U5L A;  5L8U A;  1WUG A;  4NYX A;  5G4S A;  3Q2F A;  3LJW A;  5FE1 A;  3IU5 A;  5I80 A;  4QC1 A;  2I8N A;  3JVM A;  5I89 A;  5FE2 A;  4QSS A;  4MR3 A;  5DX4 A;  3U5O A;  4WHU A;  2I7K A;  1ZKR A;  5CFW A;  2N9G A;  4NRA A;  4Z6H A;  5F36 A;  4ZW1 A;  5ENH A;  4QSR A;  5KU3 A; 
#chains in the Genus database with same CATH homology
 3MQM A;  4J3I A;  4CUT A;  4NQN A;  4LYI A;  4TT2 A;  5L96 A;  4A9L A;  2DKW A;  5ENB A;  4WIV A;  3NXB A;  5LUU A;  5IGN A;  3UVD A;  4A9M A;  5EM3 A;  4ALG A;  4HBX A;  5DYC A;  4AKN A;  3GG3 A;  4NYV A;  4UIT A;  5CQ3 A;  4XY9 A;  5A5S A;  2RO1 A;  4A9F A;  5DKH A;  1JM4 B;  4NUD A;  2D9E A;  2F6N A;  4N4I A;  5D25 A;  3MUK A;  3QZS A;  5I86 A;  5CGP A;  4A9J A;  4QUU A;  3P1F A;  4IR5 A;  5EIS A;  2YQD A;  4MEQ A;  5CUD A;  5H1V A;  5CPE A;  5DYA A;  3O37 A;  5A5P A;  1EQF A;  4BJX A;  5CP5 A;  4O7C A;  4IOO A;  4QSV A;  4CFK A;  4O7F A;  5A83 A;  4HXO A;  4DON A;  3QZV A;  5BT4 A;  4QBM A;  4CFL A;  4J0S A;  5BT5 A;  4Q0N A;  5C87 A;  4BW1 A;  2L84 A;  5C89 A;  3U5M A;  4CUS A;  4Q0O A;  5D3S A;  5KTW A;  3UW9 A;  4BHW A;  5L97 A;  4PTB A;  4NUC A;  4QSW A;  5FH8 A;  5FG6 A;  2YEL A;  1ZS5 A;  3P1E A;  3HMF A;  2WP2 A;  5E3D A;  5EWH A;  4NR7 A;  4LR6 A;  3MUL A;  5D7X A;  2RNW A;  4N4G A;  4MEP A;  4E96 A;  2RNY A;  4NYW A;  4MR6 A;  4BW3 A;  4F3I A;  4A9I A;  5DFD A;  2R0S A;  4LRG A;  4IR3 A;  5EQ1 A;  5FE0 A;  5DKC A;  3AQA A;  4NUE A;  4UIX A;  5ENJ A;  5EWV A;  5E7D A;  4YAT A;  4UYF B;  4CUP A;  4O74 A;  4X2I A;  5EPB A;  4QST A;  2OO1 A;  5FB0 A;  4NR6 A;  4MEO A;  5COI A;  2DVQ A;  3S92 A;  4QSP A;  5EPR A;  4TTE A;  4HBY A;  1WUM A;  2YYN A;  5D3H A;  5ENE A;  3UV2 A;  4NRB A;  4N3W A;  5CY9 A;  4HXS A;  5FH7 A;  5C85 A;  5AMF A;  4UIY A;  5ETD A;  4HXK A;  2NXB A;  2OSS A;  5CUA A;  5HM0 A;  4Z6I A;  1N72 A;  4YH3 A;  5DKD A;  4FLP A;  4YYK A;  3I3J A;  2L85 A;  3UV4 A;  4YBM A;  2YDW A;  3SVH A;  5HQ7 A;  5CTL A;  5E0R A;  5F60 A;  5A5N A;  3IU6 A;  4PCI A;  3ONI A;  5TCM A;  3MB4 A;  4BW4 A;  2WP1 A;  2L5E A;  5DY7 A;  5F2P A;  2OUO A;  3UV5 A;  3U5P A;  4RVR A;  4NXJ A;  4QR5 A;  5HEM A;  5A5R A;  5HRX A;  5HQ6 A;  4TT4 A;  5F62 A;  3DAI A;  2E7O A;  5F25 A;  5CUB A;  5DW2 A;  4YAB A;  3S91 A;  3LXJ A;  5D3R A;  4CL9 A;  4O72 A;  4OUF A;  4CLB A;  5FFV A;  5H1T A;  4NR9 A;  4WHW A;  5EA1 A;  4Y03 A;  5HQ5 A;  4IR6 A;  3QZT A;  5AD2 A;  4MEN A;  2DVR A;  4A9H A;  5HFR A;  2E3K A;  5DBM A;  4ZQL A;  4NQM A;  5H85 A;  4O7B A;  5HRV A;  4QB3 A;  3MB3 A;  4HXP A;  4QR3 A;  4IOR A;  4HBW A;  4O7A A;  5EWW A;  5CS8 A;  5IG6 A;  5EVA A;  4ALH A;  5E3G A;  2R0Y A;  5H1U A;  4O70 A;  5E9Y A;  4UYE A;  5AME A;  5DW1 A;  4NRC A;  5CZG A;  5ENC A;  4PY6 A;  4N4F A;  3ZYU A;  4NS5 A;  4O75 A;  2RI7 A;  5TB6 A;  5CUG A;  4A9N A;  5D3J A;  1F68 A;  5FE5 A;  3U5N A;  4HBV A;  4NR4 A;  5LKT A;  4QR4 A;  4O77 A;  4A9K A;  2G4A A;  3JVL A;  2YW5 A;  2F6J A;  3SVF A;  5D26 A;  3P1C A;  3TLP A;  3U5K A;  4MR4 A;  5K29 A;  5ENF A;  5AD3 A;  5E74 A;  4YYI A;  5A81 A;  3HME A;  5FG5 A;  2DVV A;  4CUQ A;  5FE4 A;  3LQJ A;  5D3N A;  5G4R A;  5LJ0 A;  5CQ5 A;  4TU4 A;  4LDF A;  4LZS A;  5DLX A;  4TS8 A;  4C66 A;  3P1D A;  3P5O A;  4QYL A;  5EU1 A;  2YEM A;  5A85 A;  5CQ7 A;  5A5O A;  4HXN A;  5HEN A;  3DWY A;  5I7Y A;  5I40 A;  4N4H A;  5F5Z A;  5EPS A;  5EGU A;  3D7C A;  5EK9 A;  3MXF A;  5CQ4 A;  4XYA A;  4LZ2 A;  5CQ8 A;  4A9O A;  3O36 A;  4QUT A;  4OGJ A;  5F1L A;  5LKX A;  3UVW A;  3JVK A;  4UYF A;  5HRW A;  2DWW A;  5DYU A;  4TT6 A;  3LQH A;  3Q2E A;  2R10 A;  5I29 A;  5FE9 A;  3K2J A;  4YYG A;  4YYJ A;  5FBX A;  4GPJ A;  4UIW A;  2GRC A;  5A7C A;  4YY4 A;  5J0D A;  4LYW A;  4QSU A;  5II2 A;  4KV4 A;  4IOQ A;  5HEL A;  5HLS A;  4HXL A;  3RCW A;  5KO4 A;  4Z1Q A;  4YYH A;  3G0L A;  4NR8 A;  4QSQ A;  5II1 A;  5KHM A;  5HFQ A;  5F1H A;  3UVY A;  5KTX A;  5F63 A;  4Z1S A;  5CUE A;  4YH4 A;  5IBN A;  5CRZ A;  5EI4 A;  4QEV A;  5FG4 A;  2YEK A;  4YY6 A;  5E9K A;  5LVQ A;  4XUA A;  5E9M A;  4QC3 A;  3FKM X;  5EWC A;  5IID A;  5JWM A;  5DLZ A;  5ETB A;  4YBS A;  4TYL A;  2E7N A;  5D3P A;  5LKU A;  4O71 A;  4CUR A;  2RS9 B;  3HMH A;  4O7E A;  3JVJ A;  4UYH A;  4A9E A;  5I83 A;  5KTU A;  5LKZ A;  2D82 A;  4QYD A;  5ACY A;  5DFB A;  5IGM A;  5L99 A;  5FE8 A;  5FFW A;  4HXR A;  4LYS A;  5JI8 A;  3LQI A;  4TZ8 A;  5CQT A;  4QY4 A;  5FB1 A;  5FH6 A;  2RFJ A;  5HCL A;  4KV1 A;  4YYM A;  4PKL A;  5ENG A;  5DYX A;  5D0C A;  5IGK A;  3O34 A;  5DFC A;  4PS5 A;  4YAD A;  5I88 A;  4TQN A;  4LC2 A;  4UIZ A;  4UYD A;  5EP7 A;  5EV9 A;  4UIV A;  4O76 A;  1E6I A;  4TU6 A;  2DVS A;  3AAD A;  4HXM A;  3UVX A;  1JSP B;  4KCX A;  4YAX A;  4C67 A;  5D3L A;  5E9L A;  5A82 A;  5E73 A;  5FE3 A;  5ENI A;  2LSP B;  5CUC A;  5IGL A;  5C7N A;  3U5J A;  3O35 A;  4XUB A;  1X0J A;  4UIU A;  5D3T A;  5L98 A;  5A5Q A;  4IR4 A;  4PCE A;  3SVG A;  5CU8 A;  4LZR A;  2FSA A;  2H60 A;  4O78 A;  5D24 A;  4QZS A;  2MJV B;  5L8T A;  5HJC A;  5EIC A;  4QEU A;  4QNS A;  4UYG A;  4YC9 A;  5BT3 A;  4NR5 A;  5FDZ A;  5CRM A;  5I7X A;  5F3A A;  5CQ6 A;  5E9I A;  4BW2 A;  5FFY A;  4J0R A;  4QEW A;  2KTB B;  4MR5 A;  4J1P A;  2DAT A;  2R0V A;  4CUU A;  4YBT A;  4YYD A;  5FE7 A;  4QSX A;  5CQA A;  5C4Q A;  5C8G A;  5I1Q A;  4TZ2 A;  5LJ2 A;  3O33 A;  4ZC9 A;  4OGI A;  4Z93 A;  5FE6 A;  4YYN A;  2RNX A;  5LVR A;  5F61 A;  4XY8 A;  5LJ1 A;  3G0J A;  4YK0 A;  5E9V A;  5EWD A;  3U5L A;  5L8U A;  1WUG A;  4NYX A;  5G4S A;  3Q2F A;  3LJW A;  5FE1 A;  3IU5 A;  5I80 A;  4QC1 A;  2I8N A;  3JVM A;  5I89 A;  5FE2 A;  4QSS A;  4MR3 A;  5DX4 A;  3U5O A;  4WHU A;  2I7K A;  5CFW A;  2N9G A;  4NRA A;  4Z6H A;  5F36 A;  4ZW1 A;  5ENH A;  4QSR A;  5KU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...