2NXBA

Crystal structure of human bromodomain containing protein 3 (brd3)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
111
structure length
111
Chain Sequence
RKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Bromodomain-containing protein 3
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2nxbA01
4NYVA 3SVFA 3IU6A 4ZQLA 3O36A 5D3TA 4J0RA 4A9MA 4BW3A 4NQMA 5FFYA 2I8NA 3LQHA 5BT4A 5COIA 3UVYA 4OGIA 5LKTA 5F1HA 4NRCA 5D3NA 4UYFA 5EWDA 3O37A 5EQ1A 5HRWA 4OGJA 2WP1A 4O75A 5EPRA 4O7FA 4NR5A 5F62A 5CRMA 5C8GA 5IGNA 5ENEA 4A9NA 4UYFB 4LRGA 5I1QA 4XYAA 4A9OA 2YW5A 4QR5A 5ENBA 5FH6A 5KTUA 4N3WA 3JVJA 5CFWA 4PS5A 5AMEA 5E7DA 5LJ0A 5D3JA 5L98A 4J3IA 1N72A 5DFCA 4YYMA 3U5OA 2OUOA 4O7AA 4YC9A 4BW1A 5DYXA 5HJCA 5F1LA 5KU3A 4OUFA 5DLXA 5HFQA 1ZS5A 2G4AA 3HMHA 3O34A 5ENHA 4TU6A 3FKMX 5I83A 5CUBA 5A5NA 5C7NA 4TT2A 5FB1A 4QZSA 4CFKA 4MEOA 4Y03A 5D3HA 5D7XA 4ZW1A 4MR6A 3HMFA 3P1FA 4TTEA 5CQ8A 5HELA 5EWHA 4NXJA 5FE9A 5IGMA 4TT4A 2LSPB 3RCWA 4J1PA 3G0JA 5FE1A 5L99A 4QYDA 4WHWA 2R0YA 2YELA 3P1DA 4PTBA 3P1EA 4Z93A 4YYGA 3UVXA 5BT5A 5CZGA 2RNXA 4HXNA 4UIUA 5TB6A 5D25A 4O77A 3UVWA 5CQ6A 4LYWA 4UYDA 4PCIA 5ENJA 3MXFA 4YYJA 4Z6IA 4LYSA 3DWYA 4MR4A 2NXBA 2R0VA 5E9LA 5FB0A 5FE4A 4N4GA 5CQAA 5FFWA 5C4QA 5IGLA 4WIVA 4LYIA 4TS8A 2R10A 3P1CA 4HBVA 4IR4A 4BW4A 2R0SA 4UIYA 4HXOA 3HMEA 5EGUA 5FG6A 4CUQA 5D26A 4PCEA 3K2JA 5D3RA 5BT3A 2DVVA 5EPSA 3MQMA 5CUEA 5HLSA 5II1A 4QB3A 3U5MA 4YK0A 5HENA 3G0LA 3I3JA 4QUUA 2D82A 5II2A 2MJVB 5F5ZA 5F61A 4PKLA 3NXBA 5FE3A 5A83A 3U5NA 4NR6A 1F68A 5KO4A 5TCMA 4UIXA 5E9YA 4A9HA 3AADA 4HXMA 4QSRA 4QSUA 4XUBA 4YYNA 5DKDA 5HM0A 5CUAA 4Z6HA 4QSQA 4ALGA 5F3AA 4UITA 5EM3A 5EPBA 1EQFA 4YAXA 5A5RA 5F63A 5A82A 2DWWA 5IIDA 4IOOA 3UV4A 2OO1A 4MR5A 4Q0NA 4UYHA 4YYHA 5HQ7A 4NR8A 5G4SA 5CY9A 4QSPA 4TT6A 4QSSA 5CQTA 4QNSA 5FFVA 5IBNA 5KTWA 3LQJA 4TU4A 5HRVA 4TYLA 4IR5A 4O70A 4QYLA 5DYUA 5E9VA 5LVRA 4CLBA 5I80A 5L97A 4TZ2A 2E7OA 5DFBA 5I7XA 4IR3A 3O33A 5EWVA 4UIWA 2D9EA 4HXLA 4QEWA 4Z1QA 4LZ2A 4XUAA 1WUGA 4CUTA 4YYDA 5ETBA 4FLPA 2N9GA 3MUKA 4YADA 4LZRA 5L8UA 4QR3A 5EWCA 4CURA 4PY6A 4NUCA 3S92A 5HCLA 5F25A 5AMFA 5EK9A 4QBMA 5DX4A 5F60A 4KV1A 4NS5A 5FG5A 4YY6A 3Q2EA 4MENA 4Z1SA 5DW2A 4YBMA 5ENGA 2RI7A 4O74A 2E7NA 4KV4A 3P5OA 2E3KA 4NYWA 3LJWA 2L85A 5ENFA 4ALHA 4NQNA 5CTLA 4XY9A 5A5PA 4A9JA 3U5KA 5EI4A 5E3GA 2YEKA 4NRBA 4A9KA 4NRAA 5DLZA 3MB3A 4MEQA 5I86A 5CQ7A 4O7CA 4AKNA 1WUMA 2YDWA 5FE6A 5A5SA 3QZSA 4HBWA 2DVSA 5EU1A 5EVAA 4A9LA 3JVMA 4LR6A 5EA1A 3QZTA 4YYIA 4YH3A 5AD2A 4YABA 5CU8A 5E9IA 4YBSA 4KCXA 4QR4A 3IU5A 3TLPA 4DONA 2DATA 3UW9A 5FE0A 1E6IA 5HQ6A 5LKXA 4WHUA 5CUDA 5LUUA 5H1TA 2FSAA 4N4HA 4J0SA 5EICA 4YATA 2DVRA 4QC1A 5A7CA 4HXRA 4MEPA 5DYCA 1JM4B 5EWWA 5HEMA 3MULA 4CUSA 5G4RA 3GG3A 4CL9A 5FBXA 1JSPB 3QZVA 4O72A 5A85A 3U5JA 4UYGA 5EP7A 5LKZA 5FDZA 5LVQA 4QSXA 4CFLA 2YQDA 4HXPA 5KTXA 5CP5A 4XY8A 2F6NA 4HXSA 4CUUA 5C89A 3LQIA 3U5LA 4TZ8A 5C85A 2DVQA 5DYAA 4O78A 5CS8A 5L96A 5DW1A 2L5EA 3ZYUA 3UV2A 4QSWA 4A9FA 5CUGA 5I89A 5CQ5A 5JI8A 2RNYA 5JWMA 4QC3A 4HBXA 2YYNA 5HRXA 4UIVA 5J0DA 3DAIA 4NR4A 4BHWA 4N4FA 4LZSA 5E3DA 4QSTA 5AD3A 4QEVA 5FG4A 4NR9A 5D0CA 5DBMA 5D3LA 2RS9B 5CUCA 4ZC9A 2WP2A 5CRZA 4IORA 4A9EA 5L8TA 3AQAA 4QEUA 2RFJA 3JVLA 2DKWA 2OSSA 4LDFA 4NUEA 4NYXA 5D3PA 5DKHA 4QY4A 3SVHA 5KHMA 5ETDA 3S91A 5I88A 5HFRA 5C87A 5CGPA 5E9KA 1X0JA 2L84A 5E9MA 5FH8A 4MR3A 4O7BA 4C67A 5HQ5A 2GRCA 3SVGA 4YH4A 5EISA 5F2PA 5I7YA 4O71A 5D3SA 4TQNA 5D24A 5IGKA 4YY4A 5K29A 4GPJA 5ENIA 5ENCA 2RO1A 4Q0OA 4UYEA 4YYKA 4NR7A 3ONIA 4X2IA 5E0RA 4UIZA 5FE2A 3JVKA 4C66A 3Q2FA 3UV5A 4CUPA 3UVDA 2YEMA 4BJXA 5FE8A 5DY7A 5LJ1A 4F3IA 5EV9A 3O35A 4NUDA 5CQ4A 5H1UA 4LC2A 4N4IA 5CPEA 2I7KA 4QUTA 5DFDA 5H85A 5LKUA 5DKCA 3LXJA 4YBTA 4HXKA 5IG6A 5A5OA 3U5PA 4BW2A 5FE7A 5I40A 5A5QA 2RNWA 4A9IA 4RVRA 4IOQA 5E74A 4E96A 5CQ3A 3MB4A 2F6JA 5FE5A 2KTBB 4O76A 5ACYA 4QSVA 4HBYA 5FH7A 5E73A 4IR6A 4O7EA 5F36A 5I29A 5A81A 2H60A 5H1VA 3D7CA 5LJ2A
chains in the Genus database with same CATH superfamily
4NYVA 3SVFA 3IU6A 4ZQLA 3O36A 5D3TA 4J0RA 4A9MA 4BW3A 4NQMA 5FFYA 2I8NA 3LQHA 5BT4A 5COIA 3UVYA 4OGIA 5LKTA 5F1HA 4NRCA 5D3NA 4UYFA 5EWDA 3O37A 5EQ1A 5HRWA 4OGJA 2WP1A 4O75A 5EPRA 4O7FA 4NR5A 5F62A 5CRMA 5C8GA 5IGNA 5ENEA 4A9NA 4UYFB 4LRGA 5I1QA 4XYAA 4A9OA 2YW5A 4QR5A 5ENBA 5FH6A 5KTUA 4N3WA 3JVJA 5CFWA 4PS5A 5AMEA 5E7DA 5LJ0A 5D3JA 5L98A 4J3IA 1N72A 5DFCA 4YYMA 3U5OA 2OUOA 4O7AA 4YC9A 4BW1A 5DYXA 5HJCA 5F1LA 5KU3A 4OUFA 5DLXA 5HFQA 1ZS5A 2G4AA 3HMHA 3O34A 5ENHA 4TU6A 3FKMX 5I83A 5CUBA 5A5NA 5C7NA 4TT2A 4AKIA 5FB1A 4QZSA 4CFKA 4MEOA 4Y03A 5D3HA 5D7XA 4ZW1A 4MR6A 3HMFA 3P1FA 4TTEA 5CQ8A 5HELA 5EWHA 4NXJA 5FE9A 5IGMA 4TT4A 2LSPB 3RCWA 4J1PA 3G0JA 5FE1A 5L99A 4QYDA 4WHWA 2R0YA 2YELA 3P1DA 4PTBA 3P1EA 4Z93A 4YYGA 3UVXA 5BT5A 5CZGA 2RNXA 4HXNA 4UIUA 5TB6A 5D25A 4O77A 3UVWA 5CQ6A 4LYWA 4UYDA 4PCIA 5ENJA 3MXFA 4YYJA 4Z6IA 4LYSA 3DWYA 4MR4A 4AKGA 2NXBA 2R0VA 5E9LA 5FB0A 5FE4A 4N4GA 5CQAA 5FFWA 5C4QA 5IGLA 4WIVA 4LYIA 4TS8A 1ZKRA 2R10A 3P1CA 4HBVA 4IR4A 4BW4A 2R0SA 4UIYA 4HXOA 3HMEA 5EGUA 5FG6A 4CUQA 5D26A 4PCEA 3K2JA 5D3RA 5BT3A 2DVVA 5EPSA 3MQMA 5CUEA 5HLSA 5II1A 4QB3A 3U5MA 4YK0A 5HENA 3G0LA 3I3JA 4QUUA 2D82A 5II2A 2MJVB 5F5ZA 5F61A 4PKLA 3NXBA 5FE3A 5A83A 3U5NA 4NR6A 1F68A 5KO4A 5TCMA 4UIXA 5E9YA 4A9HA 3AADA 4HXMA 4QSRA 4QSUA 3VKHA 4XUBA 4YYNA 5DKDA 5HM0A 5CUAA 4Z6HA 4QSQA 4AI6A 4ALGA 5F3AA 3D1BA 4UITA 5EM3A 5EPBA 1EQFA 4YAXA 5A5RA 5F63A 5A82A 2DWWA 5IIDA 4IOOA 3UV4A 2OO1A 4MR5A 4Q0NA 4UYHA 4YYHA 5HQ7A 4NR8A 5G4SA 5CY9A 4QSPA 4TT6A 4QSSA 5CQTA 4QNSA 5FFVA 5IBNA 5KTWA 3LQJA 4TU4A 5HRVA 4TYLA 4IR5A 4O70A 4QYLA 5DYUA 5E9VA 5LVRA 4CLBA 5I80A 5L97A 4TZ2A 2E7OA 5DFBA 5I7XA 4IR3A 3O33A 5EWVA 4UIWA 2D9EA 4HXLA 4QEWA 4Z1QA 4LZ2A 4XUAA 1WUGA 4CUTA 4YYDA 5ETBA 4FLPA 2N9GA 3MUKA 4YADA 4LZRA 5L8UA 4QR3A 5EWCA 4CURA 4PY6A 4NUCA 3S92A 5HCLA 5F25A 5AMFA 5EK9A 4QBMA 5DX4A 5F60A 4KV1A 4NS5A 5FG5A 4YY6A 3Q2EA 4MENA 4Z1SA 5DW2A 4YBMA 5ENGA 2RI7A 4O74A 2E7NA 4KV4A 3P5OA 2E3KA 4NYWA 3VKGA 3LJWA 2L85A 5ENFA 4ALHA 4NQNA 5CTLA 4XY9A 5A5PA 4A9JA 3U5KA 5EI4A 5E3GA 2YEKA 4NRBA 4A9KA 4NRAA 5DLZA 3MB3A 4MEQA 5I86A 5CQ7A 4O7CA 4AKNA 1WUMA 2YDWA 5FE6A 5A5SA 3QZSA 4HBWA 2DVSA 5EU1A 5EVAA 4A9LA 3JVMA 4LR6A 5EA1A 3QZTA 4YYIA 4YH3A 5AD2A 4YABA 5CU8A 5E9IA 4YBSA 4KCXA 4QR4A 3IU5A 3TLPA 4DONA 2DATA 3UW9A 5FE0A 1E6IA 5HQ6A 5LKXA 4WHUA 5CUDA 5LUUA 5H1TA 2FSAA 4N4HA 4J0SA 5EICA 4YATA 2DVRA 4QC1A 5A7CA 4HXRA 4MEPA 5DYCA 1JM4B 5EWWA 5HEMA 3MULA 4CUSA 5G4RA 3GG3A 4CL9A 5FBXA 1JSPB 3QZVA 4O72A 5A85A 3U5JA 4UYGA 5EP7A 5LKZA 5FDZA 5LVQA 4QSXA 4CFLA 2YQDA 4HXPA 5KTXA 5CP5A 4XY8A 2F6NA 4HXSA 4CUUA 5C89A 3LQIA 3U5LA 4TZ8A 5C85A 2DVQA 5DYAA 4O78A 5CS8A 5L96A 5DW1A 2L5EA 3ZYUA 3UV2A 4QSWA 4A9FA 5CUGA 5I89A 5CQ5A 5JI8A 2RNYA 5JWMA 4QC3A 4HBXA 2YYNA 5HRXA 4UIVA 5J0DA 3DAIA 4NR4A 4BHWA 4N4FA 4LZSA 5E3DA 4QSTA 5AD3A 4QEVA 5FG4A 4NR9A 5D0CA 5DBMA 5D3LA 2RS9B 5CUCA 4ZC9A 2WP2A 5CRZA 4IORA 4A9EA 5L8TA 3AQAA 4QEUA 2RFJA 3JVLA 2DKWA 2OSSA 4LDFA 4NUEA 4NYXA 5D3PA 5DKHA 4QY4A 3SVHA 5KHMA 5ETDA 3S91A 5I88A 5HFRA 5C87A 5CGPA 5E9KA 1X0JA 2L84A 5E9MA 5FH8A 4MR3A 4O7BA 4C67A 5HQ5A 2GRCA 3SVGA 4YH4A 5EISA 5F2PA 5I7YA 4O71A 5D3SA 4TQNA 5D24A 5IGKA 4YY4A 4AKHA 5K29A 4GPJA 5ENIA 5ENCA 2RO1A 4Q0OA 4UYEA 4YYKA 4NR7A 2EJNA 3ONIA 4X2IA 5E0RA 4UIZA 5FE2A 3JVKA 4C66A 3Q2FA 3UV5A 4CUPA 3UVDA 2YEMA 4BJXA 5FE8A 5DY7A 5LJ1A 3ERRA 4F3IA 5EV9A 3O35A 4NUDA 5CQ4A 5H1UA 4LC2A 4N4IA 5CPEA 2I7KA 4QUTA 5DFDA 5H85A 5LKUA 5DKCA 3D1DA 4YBTA 3LXJA 4HXKA 5IG6A 5A5OA 3U5PA 4BW2A 5FE7A 5I40A 5A5QA 2RNWA 4A9IA 4RVRA 4IOQA 5E74A 4E96A 5CQ3A 3MB4A 2F6JA 5FE5A 2KTBB 4O76A 5ACYA 4QSVA 4HBYA 5FH7A 5E73A 1PUOA 4IR6A 4O7EA 5F36A 5I29A 5A81A 2H60A 5H1VA 3D7CA 5LJ2A
chains in the Genus database with same CATH topology
4NYVA 3SVFA 3IU6A 4ZQLA 3O36A 5D3TA 4J0RA 4A9MA 4BW3A 4NQMA 5FFYA 2I8NA 3LQHA 5BT4A 5COIA 3UVYA 4OGIA 5LKTA 5F1HA 4NRCA 5D3NA 4UYFA 5EWDA 3O37A 5EQ1A 5HRWA 4OGJA 2WP1A 4O75A 5EPRA 4O7FA 4NR5A 5F62A 5CRMA 5C8GA 5IGNA 5ENEA 4A9NA 4UYFB 4LRGA 5I1QA 4XYAA 4A9OA 2YW5A 4QR5A 5ENBA 5FH6A 5KTUA 4N3WA 3JVJA 5CFWA 4PS5A 5AMEA 5E7DA 5LJ0A 5D3JA 5L98A 4J3IA 1N72A 5DFCA 4YYMA 3U5OA 2OUOA 4O7AA 4YC9A 4BW1A 5DYXA 5HJCA 5F1LA 5KU3A 4OUFA 5DLXA 5HFQA 1ZS5A 2G4AA 3HMHA 3O34A 5ENHA 4TU6A 3FKMX 5I83A 5CUBA 5A5NA 5C7NA 4TT2A 5FB1A 4QZSA 4CFKA 4MEOA 4Y03A 5D3HA 5D7XA 4ZW1A 4MR6A 3HMFA 3P1FA 4TTEA 5CQ8A 5HELA 5EWHA 4NXJA 5FE9A 5IGMA 4TT4A 2LSPB 3RCWA 4J1PA 3G0JA 5FE1A 5L99A 4QYDA 4WHWA 2R0YA 2YELA 3P1DA 4PTBA 3P1EA 4Z93A 4YYGA 3UVXA 5BT5A 5CZGA 2RNXA 4HXNA 4UIUA 5TB6A 5D25A 4O77A 3UVWA 5CQ6A 4LYWA 4UYDA 4PCIA 5ENJA 3MXFA 4YYJA 4Z6IA 4LYSA 3DWYA 4MR4A 2NXBA 2R0VA 5E9LA 5FB0A 5FE4A 4N4GA 5CQAA 5FFWA 5C4QA 5IGLA 4WIVA 4LYIA 4TS8A 2R10A 3P1CA 4HBVA 4IR4A 4BW4A 2R0SA 4UIYA 4HXOA 3HMEA 5EGUA 5FG6A 4CUQA 5D26A 4PCEA 3K2JA 5D3RA 5BT3A 2DVVA 5EPSA 3MQMA 5CUEA 5HLSA 5II1A 4QB3A 3U5MA 4YK0A 5HENA 3G0LA 3I3JA 4QUUA 2D82A 5II2A 2MJVB 5F5ZA 5F61A 4PKLA 3NXBA 5FE3A 5A83A 3U5NA 4NR6A 1F68A 5KO4A 5TCMA 4UIXA 5E9YA 4A9HA 3AADA 4HXMA 4QSRA 4QSUA 4XUBA 4YYNA 5DKDA 5HM0A 5CUAA 4Z6HA 4QSQA 4ALGA 5F3AA 4UITA 5EM3A 5EPBA 1EQFA 4YAXA 5A5RA 5F63A 5A82A 2DWWA 5IIDA 4IOOA 3UV4A 2OO1A 4MR5A 4Q0NA 4UYHA 4YYHA 5HQ7A 4NR8A 5G4SA 5CY9A 4QSPA 4TT6A 4QSSA 5CQTA 4QNSA 5FFVA 5IBNA 5KTWA 3LQJA 4TU4A 5HRVA 4TYLA 4IR5A 4O70A 4QYLA 5DYUA 5E9VA 5LVRA 4CLBA 5I80A 5L97A 4TZ2A 2E7OA 5DFBA 5I7XA 4IR3A 3O33A 5EWVA 4UIWA 2D9EA 4HXLA 4QEWA 4Z1QA 4LZ2A 4XUAA 1WUGA 4CUTA 4YYDA 5ETBA 4FLPA 2N9GA 3MUKA 4YADA 4LZRA 5L8UA 4QR3A 5EWCA 4CURA 4PY6A 4NUCA 3S92A 5HCLA 5F25A 5AMFA 5EK9A 4QBMA 5DX4A 5F60A 4KV1A 4NS5A 5FG5A 4YY6A 3Q2EA 4MENA 4Z1SA 5DW2A 4YBMA 5ENGA 2RI7A 4O74A 2E7NA 4KV4A 3P5OA 2E3KA 4NYWA 3LJWA 2L85A 5ENFA 4ALHA 4NQNA 5CTLA 4XY9A 5A5PA 4A9JA 3U5KA 5EI4A 5E3GA 2YEKA 4NRBA 4A9KA 4NRAA 5DLZA 3MB3A 4MEQA 5I86A 5CQ7A 4O7CA 4AKNA 1WUMA 2YDWA 5FE6A 5A5SA 3QZSA 4HBWA 2DVSA 5EU1A 5EVAA 4A9LA 3JVMA 4LR6A 5EA1A 3QZTA 4YYIA 4YH3A 5AD2A 4YABA 5CU8A 5E9IA 4YBSA 4KCXA 4QR4A 3IU5A 3TLPA 4DONA 2DATA 3UW9A 5FE0A 1E6IA 5HQ6A 5LKXA 4WHUA 5CUDA 5LUUA 5H1TA 2FSAA 4N4HA 4J0SA 5EICA 4YATA 2DVRA 4QC1A 5A7CA 4HXRA 4MEPA 5DYCA 1JM4B 5EWWA 5HEMA 3MULA 4CUSA 5G4RA 3GG3A 4CL9A 5FBXA 1JSPB 3QZVA 4O72A 5A85A 3U5JA 4UYGA 5EP7A 5LKZA 5FDZA 5LVQA 4QSXA 4CFLA 2YQDA 4HXPA 5KTXA 5CP5A 4XY8A 2F6NA 4HXSA 4CUUA 5C89A 3LQIA 3U5LA 4TZ8A 5C85A 2DVQA 5DYAA 4O78A 5CS8A 5L96A 5DW1A 2L5EA 3ZYUA 3UV2A 4QSWA 4A9FA 5CUGA 5I89A 5CQ5A 5JI8A 2RNYA 5JWMA 4QC3A 4HBXA 2YYNA 5HRXA 4UIVA 5J0DA 3DAIA 4NR4A 4BHWA 4N4FA 4LZSA 5E3DA 4QSTA 5AD3A 4QEVA 5FG4A 4NR9A 5D0CA 5DBMA 5D3LA 2RS9B 5CUCA 4ZC9A 2WP2A 5CRZA 4IORA 4A9EA 5L8TA 3AQAA 4QEUA 2RFJA 3JVLA 2DKWA 2OSSA 4LDFA 4NUEA 4NYXA 5D3PA 5DKHA 4QY4A 3SVHA 5KHMA 5ETDA 3S91A 5I88A 5HFRA 5C87A 5CGPA 5E9KA 1X0JA 2L84A 5E9MA 5FH8A 4MR3A 4O7BA 4C67A 5HQ5A 2GRCA 3SVGA 4YH4A 5EISA 5F2PA 5I7YA 4O71A 5D3SA 4TQNA 5D24A 5IGKA 4YY4A 5K29A 4GPJA 5ENIA 5ENCA 2RO1A 4Q0OA 4UYEA 4YYKA 4NR7A 3ONIA 4X2IA 5E0RA 4UIZA 5FE2A 3JVKA 4C66A 3Q2FA 3UV5A 4CUPA 3UVDA 2YEMA 4BJXA 5FE8A 5DY7A 5LJ1A 4F3IA 5EV9A 3O35A 4NUDA 5CQ4A 5H1UA 4LC2A 4N4IA 5CPEA 2I7KA 4QUTA 5DFDA 5H85A 5LKUA 5DKCA 3LXJA 4YBTA 4HXKA 5IG6A 5A5OA 3U5PA 4BW2A 5FE7A 5I40A 5A5QA 2RNWA 4A9IA 4RVRA 4IOQA 5E74A 4E96A 5CQ3A 3MB4A 2F6JA 5FE5A 2KTBB 4O76A 5ACYA 4QSVA 4HBYA 5FH7A 5E73A 4IR6A 4O7EA 5F36A 5I29A 5A81A 2H60A 5H1VA 3D7CA 5LJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NYV A;  3SVF A;  3IU6 A;  4ZQL A;  3O36 A;  5D3T A;  4J0R A;  4A9M A;  4BW3 A;  4NQM A;  5FFY A;  2I8N A;  3LQH A;  5BT4 A;  5COI A;  3UVY A;  4OGI A;  5LKT A;  5F1H A;  4NRC A;  5D3N A;  4UYF A;  5EWD A;  3O37 A;  5EQ1 A;  5HRW A;  4OGJ A;  2WP1 A;  4O75 A;  5EPR A;  4O7F A;  4NR5 A;  5F62 A;  5CRM A;  5C8G A;  5IGN A;  5ENE A;  4A9N A;  4UYF B;  4LRG A;  5I1Q A;  4XYA A;  4A9O A;  2YW5 A;  4QR5 A;  5ENB A;  5FH6 A;  5KTU A;  4N3W A;  3JVJ A;  5CFW A;  4PS5 A;  5AME A;  5E7D A;  5LJ0 A;  5D3J A;  5L98 A;  4J3I A;  1N72 A;  5DFC A;  4YYM A;  3U5O A;  2OUO A;  4O7A A;  4YC9 A;  4BW1 A;  5DYX A;  5HJC A;  5F1L A;  5KU3 A;  4OUF A;  5DLX A;  5HFQ A;  1ZS5 A;  2G4A A;  3HMH A;  3O34 A;  5ENH A;  4TU6 A;  3FKM X;  5I83 A;  5CUB A;  5A5N A;  5C7N A;  4TT2 A;  5FB1 A;  4QZS A;  4CFK A;  4MEO A;  4Y03 A;  5D3H A;  5D7X A;  4ZW1 A;  4MR6 A;  3HMF A;  3P1F A;  4TTE A;  5CQ8 A;  5HEL A;  5EWH A;  4NXJ A;  5FE9 A;  5IGM A;  4TT4 A;  2LSP B;  3RCW A;  4J1P A;  3G0J A;  5FE1 A;  5L99 A;  4QYD A;  4WHW A;  2R0Y A;  2YEL A;  3P1D A;  4PTB A;  3P1E A;  4Z93 A;  4YYG A;  3UVX A;  5BT5 A;  5CZG A;  2RNX A;  4HXN A;  4UIU A;  5TB6 A;  5D25 A;  4O77 A;  3UVW A;  5CQ6 A;  4LYW A;  4UYD A;  4PCI A;  5ENJ A;  3MXF A;  4YYJ A;  4Z6I A;  4LYS A;  3DWY A;  4MR4 A;  2NXB A;  2R0V A;  5E9L A;  5FB0 A;  5FE4 A;  4N4G A;  5CQA A;  5FFW A;  5C4Q A;  5IGL A;  4WIV A;  4LYI A;  4TS8 A;  2R10 A;  3P1C A;  4HBV A;  4IR4 A;  4BW4 A;  2R0S A;  4UIY A;  4HXO A;  3HME A;  5EGU A;  5FG6 A;  4CUQ A;  5D26 A;  4PCE A;  3K2J A;  5D3R A;  5BT3 A;  2DVV A;  5EPS A;  3MQM A;  5CUE A;  5HLS A;  5II1 A;  4QB3 A;  3U5M A;  4YK0 A;  5HEN A;  3G0L A;  3I3J A;  4QUU A;  2D82 A;  5II2 A;  2MJV B;  5F5Z A;  5F61 A;  4PKL A;  3NXB A;  5FE3 A;  5A83 A;  3U5N A;  4NR6 A;  1F68 A;  5KO4 A;  5TCM A;  4UIX A;  5E9Y A;  4A9H A;  3AAD A;  4HXM A;  4QSR A;  4QSU A;  4XUB A;  4YYN A;  5DKD A;  5HM0 A;  5CUA A;  4Z6H A;  4QSQ A;  4ALG A;  5F3A A;  4UIT A;  5EM3 A;  5EPB A;  1EQF A;  4YAX A;  5A5R A;  5F63 A;  5A82 A;  2DWW A;  5IID A;  4IOO A;  3UV4 A;  2OO1 A;  4MR5 A;  4Q0N A;  4UYH A;  4YYH A;  5HQ7 A;  4NR8 A;  5G4S A;  5CY9 A;  4QSP A;  4TT6 A;  4QSS A;  5CQT A;  4QNS A;  5FFV A;  5IBN A;  5KTW A;  3LQJ A;  4TU4 A;  5HRV A;  4TYL A;  4IR5 A;  4O70 A;  4QYL A;  5DYU A;  5E9V A;  5LVR A;  4CLB A;  5I80 A;  5L97 A;  4TZ2 A;  2E7O A;  5DFB A;  5I7X A;  4IR3 A;  3O33 A;  5EWV A;  4UIW A;  2D9E A;  4HXL A;  4QEW A;  4Z1Q A;  4LZ2 A;  4XUA A;  1WUG A;  4CUT A;  4YYD A;  5ETB A;  4FLP A;  2N9G A;  3MUK A;  4YAD A;  4LZR A;  5L8U A;  4QR3 A;  5EWC A;  4CUR A;  4PY6 A;  4NUC A;  3S92 A;  5HCL A;  5F25 A;  5AMF A;  5EK9 A;  4QBM A;  5DX4 A;  5F60 A;  4KV1 A;  4NS5 A;  5FG5 A;  4YY6 A;  3Q2E A;  4MEN A;  4Z1S A;  5DW2 A;  4YBM A;  5ENG A;  2RI7 A;  4O74 A;  2E7N A;  4KV4 A;  3P5O A;  2E3K A;  4NYW A;  3LJW A;  2L85 A;  5ENF A;  4ALH A;  4NQN A;  5CTL A;  4XY9 A;  5A5P A;  4A9J A;  3U5K A;  5EI4 A;  5E3G A;  2YEK A;  4NRB A;  4A9K A;  4NRA A;  5DLZ A;  3MB3 A;  4MEQ A;  5I86 A;  5CQ7 A;  4O7C A;  4AKN A;  1WUM A;  2YDW A;  5FE6 A;  5A5S A;  3QZS A;  4HBW A;  2DVS A;  5EU1 A;  5EVA A;  4A9L A;  3JVM A;  4LR6 A;  5EA1 A;  3QZT A;  4YYI A;  4YH3 A;  5AD2 A;  4YAB A;  5CU8 A;  5E9I A;  4YBS A;  4KCX A;  4QR4 A;  3IU5 A;  3TLP A;  4DON A;  2DAT A;  3UW9 A;  5FE0 A;  1E6I A;  5HQ6 A;  5LKX A;  4WHU A;  5CUD A;  5LUU A;  5H1T A;  2FSA A;  4N4H A;  4J0S A;  5EIC A;  4YAT A;  2DVR A;  4QC1 A;  5A7C A;  4HXR A;  4MEP A;  5DYC A;  1JM4 B;  5EWW A;  5HEM A;  3MUL A;  4CUS A;  5G4R A;  3GG3 A;  4CL9 A;  5FBX A;  1JSP B;  3QZV A;  4O72 A;  5A85 A;  3U5J A;  4UYG A;  5EP7 A;  5LKZ A;  5FDZ A;  5LVQ A;  4QSX A;  4CFL A;  2YQD A;  4HXP A;  5KTX A;  5CP5 A;  4XY8 A;  2F6N A;  4HXS A;  4CUU A;  5C89 A;  3LQI A;  3U5L A;  4TZ8 A;  5C85 A;  2DVQ A;  5DYA A;  4O78 A;  5CS8 A;  5L96 A;  5DW1 A;  2L5E A;  3ZYU A;  3UV2 A;  4QSW A;  4A9F A;  5CUG A;  5I89 A;  5CQ5 A;  5JI8 A;  2RNY A;  5JWM A;  4QC3 A;  4HBX A;  2YYN A;  5HRX A;  4UIV A;  5J0D A;  3DAI A;  4NR4 A;  4BHW A;  4N4F A;  4LZS A;  5E3D A;  4QST A;  5AD3 A;  4QEV A;  5FG4 A;  4NR9 A;  5D0C A;  5DBM A;  5D3L A;  2RS9 B;  5CUC A;  4ZC9 A;  2WP2 A;  5CRZ A;  4IOR A;  4A9E A;  5L8T A;  3AQA A;  4QEU A;  2RFJ A;  3JVL A;  2DKW A;  2OSS A;  4LDF A;  4NUE A;  4NYX A;  5D3P A;  5DKH A;  4QY4 A;  3SVH A;  5KHM A;  5ETD A;  3S91 A;  5I88 A;  5HFR A;  5C87 A;  5CGP A;  5E9K A;  1X0J A;  2L84 A;  5E9M A;  5FH8 A;  4MR3 A;  4O7B A;  4C67 A;  5HQ5 A;  2GRC A;  3SVG A;  4YH4 A;  5EIS A;  5F2P A;  5I7Y A;  4O71 A;  5D3S A;  4TQN A;  5D24 A;  5IGK A;  4YY4 A;  5K29 A;  4GPJ A;  5ENI A;  5ENC A;  2RO1 A;  4Q0O A;  4UYE A;  4YYK A;  4NR7 A;  3ONI A;  4X2I A;  5E0R A;  4UIZ A;  5FE2 A;  3JVK A;  4C66 A;  3Q2F A;  3UV5 A;  4CUP A;  3UVD A;  2YEM A;  4BJX A;  5FE8 A;  5DY7 A;  5LJ1 A;  4F3I A;  5EV9 A;  3O35 A;  4NUD A;  5CQ4 A;  5H1U A;  4LC2 A;  4N4I A;  5CPE A;  2I7K A;  4QUT A;  5DFD A;  5H85 A;  5LKU A;  5DKC A;  3LXJ A;  4YBT A;  4HXK A;  5IG6 A;  5A5O A;  3U5P A;  4BW2 A;  5FE7 A;  5I40 A;  5A5Q A;  2RNW A;  4A9I A;  4RVR A;  4IOQ A;  5E74 A;  4E96 A;  5CQ3 A;  3MB4 A;  2F6J A;  5FE5 A;  2KTB B;  4O76 A;  5ACY A;  4QSV A;  4HBY A;  5FH7 A;  5E73 A;  4IR6 A;  4O7E A;  5F36 A;  5I29 A;  5A81 A;  2H60 A;  5H1V A;  3D7C A;  5LJ2 A; 
#chains in the Genus database with same CATH topology
 4NYV A;  3SVF A;  3IU6 A;  4ZQL A;  3O36 A;  5D3T A;  4J0R A;  4A9M A;  4BW3 A;  4NQM A;  5FFY A;  2I8N A;  3LQH A;  5BT4 A;  5COI A;  3UVY A;  4OGI A;  5LKT A;  5F1H A;  4NRC A;  5D3N A;  4UYF A;  5EWD A;  3O37 A;  5EQ1 A;  5HRW A;  4OGJ A;  2WP1 A;  4O75 A;  5EPR A;  4O7F A;  4NR5 A;  5F62 A;  5CRM A;  5C8G A;  5IGN A;  5ENE A;  4A9N A;  4UYF B;  4LRG A;  5I1Q A;  4XYA A;  4A9O A;  2YW5 A;  4QR5 A;  5ENB A;  5FH6 A;  5KTU A;  4N3W A;  3JVJ A;  5CFW A;  4PS5 A;  5AME A;  5E7D A;  5LJ0 A;  5D3J A;  5L98 A;  4J3I A;  1N72 A;  5DFC A;  4YYM A;  3U5O A;  2OUO A;  4O7A A;  4YC9 A;  4BW1 A;  5DYX A;  5HJC A;  5F1L A;  5KU3 A;  4OUF A;  5DLX A;  5HFQ A;  1ZS5 A;  2G4A A;  3HMH A;  3O34 A;  5ENH A;  4TU6 A;  3FKM X;  5I83 A;  5CUB A;  5A5N A;  5C7N A;  4TT2 A;  4AKI A;  5FB1 A;  4QZS A;  4CFK A;  4MEO A;  4Y03 A;  5D3H A;  5D7X A;  4ZW1 A;  4MR6 A;  3HMF A;  3P1F A;  4TTE A;  5CQ8 A;  5HEL A;  5EWH A;  4NXJ A;  5FE9 A;  5IGM A;  4TT4 A;  2LSP B;  3RCW A;  4J1P A;  3G0J A;  5FE1 A;  5L99 A;  4QYD A;  4WHW A;  2R0Y A;  2YEL A;  3P1D A;  4PTB A;  3P1E A;  4Z93 A;  4YYG A;  3UVX A;  5BT5 A;  5CZG A;  2RNX A;  4HXN A;  4UIU A;  5TB6 A;  5D25 A;  4O77 A;  3UVW A;  5CQ6 A;  4LYW A;  4UYD A;  4PCI A;  5ENJ A;  3MXF A;  4YYJ A;  4Z6I A;  4LYS A;  3DWY A;  4MR4 A;  4AKG A;  2NXB A;  2R0V A;  5E9L A;  5FB0 A;  5FE4 A;  4N4G A;  5CQA A;  5FFW A;  5C4Q A;  5IGL A;  4WIV A;  4LYI A;  4TS8 A;  1ZKR A;  2R10 A;  3P1C A;  4HBV A;  4IR4 A;  4BW4 A;  2R0S A;  4UIY A;  4HXO A;  3HME A;  5EGU A;  5FG6 A;  4CUQ A;  5D26 A;  4PCE A;  3K2J A;  5D3R A;  5BT3 A;  2DVV A;  5EPS A;  3MQM A;  5CUE A;  5HLS A;  5II1 A;  4QB3 A;  3U5M A;  4YK0 A;  5HEN A;  3G0L A;  3I3J A;  4QUU A;  2D82 A;  5II2 A;  2MJV B;  5F5Z A;  5F61 A;  4PKL A;  3NXB A;  5FE3 A;  5A83 A;  3U5N A;  4NR6 A;  1F68 A;  5KO4 A;  5TCM A;  4UIX A;  5E9Y A;  4A9H A;  3AAD A;  4HXM A;  4QSR A;  4QSU A;  3VKH A;  4XUB A;  4YYN A;  5DKD A;  5HM0 A;  5CUA A;  4Z6H A;  4QSQ A;  4AI6 A;  4ALG A;  5F3A A;  3D1B A;  4UIT A;  5EM3 A;  5EPB A;  1EQF A;  4YAX A;  5A5R A;  5F63 A;  5A82 A;  2DWW A;  5IID A;  4IOO A;  3UV4 A;  2OO1 A;  4MR5 A;  4Q0N A;  4UYH A;  4YYH A;  5HQ7 A;  4NR8 A;  5G4S A;  5CY9 A;  4QSP A;  4TT6 A;  4QSS A;  5CQT A;  4QNS A;  5FFV A;  5IBN A;  5KTW A;  3LQJ A;  4TU4 A;  5HRV A;  4TYL A;  4IR5 A;  4O70 A;  4QYL A;  5DYU A;  5E9V A;  5LVR A;  4CLB A;  5I80 A;  5L97 A;  4TZ2 A;  2E7O A;  5DFB A;  5I7X A;  4IR3 A;  3O33 A;  5EWV A;  4UIW A;  2D9E A;  4HXL A;  4QEW A;  4Z1Q A;  4LZ2 A;  4XUA A;  1WUG A;  4CUT A;  4YYD A;  5ETB A;  4FLP A;  2N9G A;  3MUK A;  4YAD A;  4LZR A;  5L8U A;  4QR3 A;  5EWC A;  4CUR A;  4PY6 A;  4NUC A;  3S92 A;  5HCL A;  5F25 A;  5AMF A;  5EK9 A;  4QBM A;  5DX4 A;  5F60 A;  4KV1 A;  4NS5 A;  5FG5 A;  4YY6 A;  3Q2E A;  4MEN A;  4Z1S A;  5DW2 A;  4YBM A;  5ENG A;  2RI7 A;  4O74 A;  2E7N A;  4KV4 A;  3P5O A;  2E3K A;  4NYW A;  3VKG A;  3LJW A;  2L85 A;  5ENF A;  4ALH A;  4NQN A;  5CTL A;  4XY9 A;  5A5P A;  4A9J A;  3U5K A;  5EI4 A;  5E3G A;  2YEK A;  4NRB A;  4A9K A;  4NRA A;  5DLZ A;  3MB3 A;  4MEQ A;  5I86 A;  5CQ7 A;  4O7C A;  4AKN A;  1WUM A;  2YDW A;  5FE6 A;  5A5S A;  3QZS A;  4HBW A;  2DVS A;  5EU1 A;  5EVA A;  4A9L A;  3JVM A;  4LR6 A;  5EA1 A;  3QZT A;  4YYI A;  4YH3 A;  5AD2 A;  4YAB A;  5CU8 A;  5E9I A;  4YBS A;  4KCX A;  4QR4 A;  3IU5 A;  3TLP A;  4DON A;  2DAT A;  3UW9 A;  5FE0 A;  1E6I A;  5HQ6 A;  5LKX A;  4WHU A;  5CUD A;  5LUU A;  5H1T A;  2FSA A;  4N4H A;  4J0S A;  5EIC A;  4YAT A;  2DVR A;  4QC1 A;  5A7C A;  4HXR A;  4MEP A;  5DYC A;  1JM4 B;  5EWW A;  5HEM A;  3MUL A;  4CUS A;  5G4R A;  3GG3 A;  4CL9 A;  5FBX A;  1JSP B;  3QZV A;  4O72 A;  5A85 A;  3U5J A;  4UYG A;  5EP7 A;  5LKZ A;  5FDZ A;  5LVQ A;  4QSX A;  4CFL A;  2YQD A;  4HXP A;  5KTX A;  5CP5 A;  4XY8 A;  2F6N A;  4HXS A;  4CUU A;  5C89 A;  3LQI A;  3U5L A;  4TZ8 A;  5C85 A;  2DVQ A;  5DYA A;  4O78 A;  5CS8 A;  5L96 A;  5DW1 A;  2L5E A;  3ZYU A;  3UV2 A;  4QSW A;  4A9F A;  5CUG A;  5I89 A;  5CQ5 A;  5JI8 A;  2RNY A;  5JWM A;  4QC3 A;  4HBX A;  2YYN A;  5HRX A;  4UIV A;  5J0D A;  3DAI A;  4NR4 A;  4BHW A;  4N4F A;  4LZS A;  5E3D A;  4QST A;  5AD3 A;  4QEV A;  5FG4 A;  4NR9 A;  5D0C A;  5DBM A;  5D3L A;  2RS9 B;  5CUC A;  4ZC9 A;  2WP2 A;  5CRZ A;  4IOR A;  4A9E A;  5L8T A;  3AQA A;  4QEU A;  2RFJ A;  3JVL A;  2DKW A;  2OSS A;  4LDF A;  4NUE A;  4NYX A;  5D3P A;  5DKH A;  4QY4 A;  3SVH A;  5KHM A;  5ETD A;  3S91 A;  5I88 A;  5HFR A;  5C87 A;  5CGP A;  5E9K A;  1X0J A;  2L84 A;  5E9M A;  5FH8 A;  4MR3 A;  4O7B A;  4C67 A;  5HQ5 A;  2GRC A;  3SVG A;  4YH4 A;  5EIS A;  5F2P A;  5I7Y A;  4O71 A;  5D3S A;  4TQN A;  5D24 A;  5IGK A;  4YY4 A;  4AKH A;  5K29 A;  4GPJ A;  5ENI A;  5ENC A;  2RO1 A;  4Q0O A;  4UYE A;  4YYK A;  4NR7 A;  2EJN A;  3ONI A;  4X2I A;  5E0R A;  4UIZ A;  5FE2 A;  3JVK A;  4C66 A;  3Q2F A;  3UV5 A;  4CUP A;  3UVD A;  2YEM A;  4BJX A;  5FE8 A;  5DY7 A;  5LJ1 A;  3ERR A;  4F3I A;  5EV9 A;  3O35 A;  4NUD A;  5CQ4 A;  5H1U A;  4LC2 A;  4N4I A;  5CPE A;  2I7K A;  4QUT A;  5DFD A;  5H85 A;  5LKU A;  5DKC A;  3D1D A;  4YBT A;  3LXJ A;  4HXK A;  5IG6 A;  5A5O A;  3U5P A;  4BW2 A;  5FE7 A;  5I40 A;  5A5Q A;  2RNW A;  4A9I A;  4RVR A;  4IOQ A;  5E74 A;  4E96 A;  5CQ3 A;  3MB4 A;  2F6J A;  5FE5 A;  2KTB B;  4O76 A;  5ACY A;  4QSV A;  4HBY A;  5FH7 A;  5E73 A;  1PUO A;  4IR6 A;  4O7E A;  5F36 A;  5I29 A;  5A81 A;  2H60 A;  5H1V A;  3D7C A;  5LJ2 A; 
#chains in the Genus database with same CATH homology
 4NYV A;  3SVF A;  3IU6 A;  4ZQL A;  3O36 A;  5D3T A;  4J0R A;  4A9M A;  4BW3 A;  4NQM A;  5FFY A;  2I8N A;  3LQH A;  5BT4 A;  5COI A;  3UVY A;  4OGI A;  5LKT A;  5F1H A;  4NRC A;  5D3N A;  4UYF A;  5EWD A;  3O37 A;  5EQ1 A;  5HRW A;  4OGJ A;  2WP1 A;  4O75 A;  5EPR A;  4O7F A;  4NR5 A;  5F62 A;  5CRM A;  5C8G A;  5IGN A;  5ENE A;  4A9N A;  4UYF B;  4LRG A;  5I1Q A;  4XYA A;  4A9O A;  2YW5 A;  4QR5 A;  5ENB A;  5FH6 A;  5KTU A;  4N3W A;  3JVJ A;  5CFW A;  4PS5 A;  5AME A;  5E7D A;  5LJ0 A;  5D3J A;  5L98 A;  4J3I A;  1N72 A;  5DFC A;  4YYM A;  3U5O A;  2OUO A;  4O7A A;  4YC9 A;  4BW1 A;  5DYX A;  5HJC A;  5F1L A;  5KU3 A;  4OUF A;  5DLX A;  5HFQ A;  1ZS5 A;  2G4A A;  3HMH A;  3O34 A;  5ENH A;  4TU6 A;  3FKM X;  5I83 A;  5CUB A;  5A5N A;  5C7N A;  4TT2 A;  5FB1 A;  4QZS A;  4CFK A;  4MEO A;  4Y03 A;  5D3H A;  5D7X A;  4ZW1 A;  4MR6 A;  3HMF A;  3P1F A;  4TTE A;  5CQ8 A;  5HEL A;  5EWH A;  4NXJ A;  5FE9 A;  5IGM A;  4TT4 A;  2LSP B;  3RCW A;  4J1P A;  3G0J A;  5FE1 A;  5L99 A;  4QYD A;  4WHW A;  2R0Y A;  2YEL A;  3P1D A;  4PTB A;  3P1E A;  4Z93 A;  4YYG A;  3UVX A;  5BT5 A;  5CZG A;  2RNX A;  4HXN A;  4UIU A;  5TB6 A;  5D25 A;  4O77 A;  3UVW A;  5CQ6 A;  4LYW A;  4UYD A;  4PCI A;  5ENJ A;  3MXF A;  4YYJ A;  4Z6I A;  4LYS A;  3DWY A;  4MR4 A;  2NXB A;  2R0V A;  5E9L A;  5FB0 A;  5FE4 A;  4N4G A;  5CQA A;  5FFW A;  5C4Q A;  5IGL A;  4WIV A;  4LYI A;  4TS8 A;  2R10 A;  3P1C A;  4HBV A;  4IR4 A;  4BW4 A;  2R0S A;  4UIY A;  4HXO A;  3HME A;  5EGU A;  5FG6 A;  4CUQ A;  5D26 A;  4PCE A;  3K2J A;  5D3R A;  5BT3 A;  2DVV A;  5EPS A;  3MQM A;  5CUE A;  5HLS A;  5II1 A;  4QB3 A;  3U5M A;  4YK0 A;  5HEN A;  3G0L A;  3I3J A;  4QUU A;  2D82 A;  5II2 A;  2MJV B;  5F5Z A;  5F61 A;  4PKL A;  3NXB A;  5FE3 A;  5A83 A;  3U5N A;  4NR6 A;  1F68 A;  5KO4 A;  5TCM A;  4UIX A;  5E9Y A;  4A9H A;  3AAD A;  4HXM A;  4QSR A;  4QSU A;  4XUB A;  4YYN A;  5DKD A;  5HM0 A;  5CUA A;  4Z6H A;  4QSQ A;  4ALG A;  5F3A A;  4UIT A;  5EM3 A;  5EPB A;  1EQF A;  4YAX A;  5A5R A;  5F63 A;  5A82 A;  2DWW A;  5IID A;  4IOO A;  3UV4 A;  2OO1 A;  4MR5 A;  4Q0N A;  4UYH A;  4YYH A;  5HQ7 A;  4NR8 A;  5G4S A;  5CY9 A;  4QSP A;  4TT6 A;  4QSS A;  5CQT A;  4QNS A;  5FFV A;  5IBN A;  5KTW A;  3LQJ A;  4TU4 A;  5HRV A;  4TYL A;  4IR5 A;  4O70 A;  4QYL A;  5DYU A;  5E9V A;  5LVR A;  4CLB A;  5I80 A;  5L97 A;  4TZ2 A;  2E7O A;  5DFB A;  5I7X A;  4IR3 A;  3O33 A;  5EWV A;  4UIW A;  2D9E A;  4HXL A;  4QEW A;  4Z1Q A;  4LZ2 A;  4XUA A;  1WUG A;  4CUT A;  4YYD A;  5ETB A;  4FLP A;  2N9G A;  3MUK A;  4YAD A;  4LZR A;  5L8U A;  4QR3 A;  5EWC A;  4CUR A;  4PY6 A;  4NUC A;  3S92 A;  5HCL A;  5F25 A;  5AMF A;  5EK9 A;  4QBM A;  5DX4 A;  5F60 A;  4KV1 A;  4NS5 A;  5FG5 A;  4YY6 A;  3Q2E A;  4MEN A;  4Z1S A;  5DW2 A;  4YBM A;  5ENG A;  2RI7 A;  4O74 A;  2E7N A;  4KV4 A;  3P5O A;  2E3K A;  4NYW A;  3LJW A;  2L85 A;  5ENF A;  4ALH A;  4NQN A;  5CTL A;  4XY9 A;  5A5P A;  4A9J A;  3U5K A;  5EI4 A;  5E3G A;  2YEK A;  4NRB A;  4A9K A;  4NRA A;  5DLZ A;  3MB3 A;  4MEQ A;  5I86 A;  5CQ7 A;  4O7C A;  4AKN A;  1WUM A;  2YDW A;  5FE6 A;  5A5S A;  3QZS A;  4HBW A;  2DVS A;  5EU1 A;  5EVA A;  4A9L A;  3JVM A;  4LR6 A;  5EA1 A;  3QZT A;  4YYI A;  4YH3 A;  5AD2 A;  4YAB A;  5CU8 A;  5E9I A;  4YBS A;  4KCX A;  4QR4 A;  3IU5 A;  3TLP A;  4DON A;  2DAT A;  3UW9 A;  5FE0 A;  1E6I A;  5HQ6 A;  5LKX A;  4WHU A;  5CUD A;  5LUU A;  5H1T A;  2FSA A;  4N4H A;  4J0S A;  5EIC A;  4YAT A;  2DVR A;  4QC1 A;  5A7C A;  4HXR A;  4MEP A;  5DYC A;  1JM4 B;  5EWW A;  5HEM A;  3MUL A;  4CUS A;  5G4R A;  3GG3 A;  4CL9 A;  5FBX A;  1JSP B;  3QZV A;  4O72 A;  5A85 A;  3U5J A;  4UYG A;  5EP7 A;  5LKZ A;  5FDZ A;  5LVQ A;  4QSX A;  4CFL A;  2YQD A;  4HXP A;  5KTX A;  5CP5 A;  4XY8 A;  2F6N A;  4HXS A;  4CUU A;  5C89 A;  3LQI A;  3U5L A;  4TZ8 A;  5C85 A;  2DVQ A;  5DYA A;  4O78 A;  5CS8 A;  5L96 A;  5DW1 A;  2L5E A;  3ZYU A;  3UV2 A;  4QSW A;  4A9F A;  5CUG A;  5I89 A;  5CQ5 A;  5JI8 A;  2RNY A;  5JWM A;  4QC3 A;  4HBX A;  2YYN A;  5HRX A;  4UIV A;  5J0D A;  3DAI A;  4NR4 A;  4BHW A;  4N4F A;  4LZS A;  5E3D A;  4QST A;  5AD3 A;  4QEV A;  5FG4 A;  4NR9 A;  5D0C A;  5DBM A;  5D3L A;  2RS9 B;  5CUC A;  4ZC9 A;  2WP2 A;  5CRZ A;  4IOR A;  4A9E A;  5L8T A;  3AQA A;  4QEU A;  2RFJ A;  3JVL A;  2DKW A;  2OSS A;  4LDF A;  4NUE A;  4NYX A;  5D3P A;  5DKH A;  4QY4 A;  3SVH A;  5KHM A;  5ETD A;  3S91 A;  5I88 A;  5HFR A;  5C87 A;  5CGP A;  5E9K A;  1X0J A;  2L84 A;  5E9M A;  5FH8 A;  4MR3 A;  4O7B A;  4C67 A;  5HQ5 A;  2GRC A;  3SVG A;  4YH4 A;  5EIS A;  5F2P A;  5I7Y A;  4O71 A;  5D3S A;  4TQN A;  5D24 A;  5IGK A;  4YY4 A;  5K29 A;  4GPJ A;  5ENI A;  5ENC A;  2RO1 A;  4Q0O A;  4UYE A;  4YYK A;  4NR7 A;  3ONI A;  4X2I A;  5E0R A;  4UIZ A;  5FE2 A;  3JVK A;  4C66 A;  3Q2F A;  3UV5 A;  4CUP A;  3UVD A;  2YEM A;  4BJX A;  5FE8 A;  5DY7 A;  5LJ1 A;  4F3I A;  5EV9 A;  3O35 A;  4NUD A;  5CQ4 A;  5H1U A;  4LC2 A;  4N4I A;  5CPE A;  2I7K A;  4QUT A;  5DFD A;  5H85 A;  5LKU A;  5DKC A;  3LXJ A;  4YBT A;  4HXK A;  5IG6 A;  5A5O A;  3U5P A;  4BW2 A;  5FE7 A;  5I40 A;  5A5Q A;  2RNW A;  4A9I A;  4RVR A;  4IOQ A;  5E74 A;  4E96 A;  5CQ3 A;  3MB4 A;  2F6J A;  5FE5 A;  2KTB B;  4O76 A;  5ACY A;  4QSV A;  4HBY A;  5FH7 A;  5E73 A;  4IR6 A;  4O7E A;  5F36 A;  5I29 A;  5A81 A;  2H60 A;  5H1V A;  3D7C A;  5LJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...