5I89A

Crystal structure of the bromodomain of human crebbp bound to the benzodiazepinone g02857790
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
115
structure length
115
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Fragment-Based Discovery of a Selective and Cell-Active Benzodiazepinone CBP/EP300 Bromodomain Inhibitor (CPI-637).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
total genus 41
structure length 115
sequence length 115
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i89A00
3I3JA 5CRMA 5ACYA 2L84A 4J3IA 2OSSA 4YC9A 4O78A 5ENBA 4RVRA 4UYFB 5ENGA 5LJ0A 5CQ4A 5ENJA 2L85A 4NR7A 4TT6A 4YYDA 5HQ6A 2YQDA 4CL9A 4NQNA 4WIVA 5CUEA 4YBMA 5CRZA 5H1VA 5CP5A 5A5NA 4A9NA 5EA1A 3S91A 4C67A 5HLSA 4NR6A 5EWWA 5F61A 5CU8A 4NR8A 4NRBA 5EGUA 5HENA 2R0VA 5FE2A 5DW2A 4PS5A 4MR3A 5HRVA 5A85A 4ZC9A 5D3SA 2YYNA 4O70A 4NRCA 5FE8A 2L5EA 5L8UA 5FFWA 4QSWA 4Z1SA 4O7CA 4HXPA 4Q0OA 4LRGA 3HMFA 2I8NA 5AD3A 4BHWA 3AADA 4IR4A 3U5KA 4NYXA 3K2JA 5E9LA 5CQ5A 2WP1A 3MUKA 5E9YA 2DWWA 4ALGA 5FG6A 3QZTA 3O36A 4LC2A 4QSQA 3LXJA 5A83A 4QB3A 5DKHA 3JVMA 3MB4A 4ZQLA 5DKCA 5E9IA 5C7NA 5IGNA 5CUAA 5CUDA 4UYGA 1F68A 4QEVA 5D3PA 4WHWA 4O74A 3LQIA 5I88A 5LKTA 5I7YA 5FB1A 4UYDA 5IGKA 4QSPA 4HXMA 5JWMA 3SVGA 3LQHA 5EWCA 4CUTA 5D3RA 5F5ZA 5G4RA 3JVLA 5E9VA 4QBMA 5HRWA 5EWHA 2D9EA 3P1EA 4QUTA 2N9GA 4OGIA 3UV4A 4LYIA 5KU3A 4YBTA 4YADA 5IBNA 4NQMA 3NXBA 3HMHA 5E7DA 4UIVA 4CUUA 4NR4A 5D3TA 5CQ8A 5ENCA 3SVHA 5LVRA 4IR6A 2DKWA 4LYSA 4MEPA 2R0SA 5D24A 5EWDA 5A5PA 2E7NA 4TT4A 4QR5A 5FE9A 2NXBA 3MXFA 5F1HA 5E74A 5CUCA 5L8TA 5FE1A 5L96A 4ALHA 4O7AA 4Z93A 4MEQA 5TCMA 5LVQA 3D7CA 4QC1A 2DVQA 4YYKA 5CZGA 2RNYA 4NR5A 5D0CA 4A9KA 5COIA 5CQTA 4YH4A 5A7CA 4CFLA 5BT3A 4UYFA 5DYUA 5IG6A 4A9MA 5ENIA 4PKLA 5A82A 4KV4A 5FE0A 5EICA 5H1TA 3P1CA 5ENFA 4YY6A 5ENEA 5E3DA 4LR6A 5H1UA 4NYWA 4PTBA 5C89A 3JVKA 4QR3A 5HFQA 4UIYA 5DW1A 2F6JA 4TU6A 4YYJA 5I29A 5FG4A 5CQ7A 4IR3A 5EPSA 4BJXA 2RNXA 4A9FA 4UIWA 5LKZA 5KTWA 5D3JA 4QYDA 3G0LA 4FLPA 3U5PA 3U5JA 4LZ2A 5II1A 3JVJA 5FH6A 3UW9A 5A81A 3LQJA 5CGPA 4IOOA 4LZRA 5CS8A 5I40A 5C8GA 5I89A 5BT4A 5EWVA 5F36A 4KCXA 4KV1A 5DLZA 5DFCA 1X0JA 4YYHA 4HBXA 1N72A 3QZVA 4BW2A 5KTXA 3DWYA 5EVAA 5F63A 4QYLA 2I7KA 4CFKA 5C4QA 4C66A 5EP7A 4F3IA 2YEKA 3RCWA 4N4FA 5AMFA 3LJWA 5G4SA 4O7FA 3P5OA 4HXKA 3Q2EA 5I80A 2RO1A 2D82A 5EQ1A 5LJ2A 5CQ3A 4QUUA 2YELA 4Y03A 4O76A 5CFWA 4TQNA 1WUGA 5TB6A 5EU1A 5E9KA 2F6NA 4OGJA 5DX4A 4A9JA 4N4GA 5EV9A 4Z6IA 4LYWA 5D3NA 4YY4A 5II2A 4YYMA 5C87A 5EK9A 3FKMX 4BW4A 4XY9A 5E9MA 4O7BA 5F60A 4N3WA 5E3GA 5A5RA 4HXOA 5FG5A 4QY4A 4QSSA 5DYCA 4NYVA 4QNSA 5I86A 5ENHA 4Z1QA 3SVFA 2R10A 4LDFA 5EPRA 5I83A 5L97A 1E6IA 3ONIA 4YATA 5FE3A 5HRXA 4UIUA 5L99A 3UVDA 5DYXA 3UV5A 4UITA 5FFVA 3O35A 4LZSA 4PCEA 2FSAA 5HCLA 4NUCA 4NR9A 4A9IA 4CUQA 5HM0A 2DVRA 5IIDA 4HBVA 1JSPB 5CUGA 4TS8A 4O75A 4A9HA 2RFJA 5FDZA 4UYEA 5FE4A 4QSUA 5DY7A 5KO4A 5FBXA 5F2PA 3DAIA 4TYLA 4HBWA 5K29A 5ETDA 4YYGA 4YBSA 4GPJA 1EQFA 1ZS5A 3G0JA 5AD2A 5FB0A 4WHUA 4NRAA 4IORA 4IOQA 2OUOA 4QSXA 5KHMA 4XYAA 2DATA 3GG3A 5J0DA 3IU6A 4DONA 4J0SA 5ETBA 3UVXA 5CQAA 5H85A 4NS5A 4YAXA 5D25A 3P1DA 3AQAA 5KTUA 5D26A 5FH8A 3P1FA 5FH7A 5LKUA 3QZSA 4YABA 4TU4A 5DYAA 5I1QA 2H60A 5F1LA 2E3KA 5EISA 4J1PA 2DVVA 3U5MA 4TTEA 4NXJA 3U5OA 3MQMA 5HEMA 5IGMA 4HXSA 4E96A 5F3AA 4QSVA 2G4AA 5E73A 3TLPA 4A9OA 3IU5A 4HXNA 3UV2A 4N4HA 4O72A 5FE5A 4ZW1A 5C85A 3Q2FA 4QEWA 5L98A 1JM4B 4QC3A 4TZ2A 5DBMA 5LUUA 5HQ7A 4A9EA 3MULA 1WUMA 4XY8A 5CPEA 5HFRA 4CUPA 3MB3A 4O77A 5DFDA 2OO1A 5CTLA 5A5SA 4MENA 3O33A 4O7EA 5AMEA 4MR4A 4TT2A 4UIXA 4BW1A 4N4IA 4QSRA 3UVYA 5JI8A 4MR5A 4XUAA 5CQ6A 4NUEA 4UIZA 4NUDA 5I7XA 4TZ8A 5F62A 5FE6A 4CUSA 3ZYUA 5EI4A 4MEOA 2RNWA 5FE7A 5D3HA 4YYIA 4XUBA 2E7OA 3U5NA 4HBYA 2YEMA 4UYHA 5F25A 2KTBB 5CUBA 2RI7A 5DFBA 4PCIA 4Q0NA 4X2IA 2WP2A 4HXRA 3HMEA 4OUFA 4A9LA 5LJ1A 5CY9A 4QEUA 4QSTA 5EPBA 4QZSA 5FFYA 5EM3A 2YDWA 5D3LA 4MR6A 4PY6A 5E0RA 4QR4A 4IR5A 5A5OA 5DKDA 3O37A 4O71A 2RS9B 5HQ5A 4J0RA 4BW3A 2LSPB 4YYNA 4HXLA 3S92A 2GRCA 5HJCA 2YW5A 4YH3A 3U5LA 4AKNA 5D7XA 4CURA 2MJVB 5LKXA 4Z6HA 5IGLA 2R0YA 5HELA 3UVWA 5BT5A 4YK0A 5A5QA 4CLBA 5DLXA 2DVSA 3O34A
chains in the Genus database with same CATH superfamily
3I3JA 5CRMA 5ACYA 2L84A 4J3IA 2OSSA 4YC9A 4O78A 5ENBA 4RVRA 4UYFB 5ENGA 5LJ0A 5CQ4A 5ENJA 2L85A 4NR7A 4TT6A 4YYDA 5HQ6A 2YQDA 4CL9A 4NQNA 4WIVA 5CUEA 4YBMA 5CRZA 5H1VA 5CP5A 5A5NA 4A9NA 5EA1A 3S91A 4C67A 5HLSA 4NR6A 5EWWA 5F61A 5CU8A 4NR8A 4NRBA 5EGUA 5HENA 2R0VA 5FE2A 5DW2A 4PS5A 4MR3A 3VKGA 5HRVA 5A85A 4ZC9A 5D3SA 2YYNA 4O70A 4NRCA 5FE8A 2L5EA 5L8UA 3D1BA 5FFWA 4QSWA 4Z1SA 4O7CA 4HXPA 4Q0OA 4LRGA 3HMFA 2I8NA 5AD3A 4BHWA 3AADA 4IR4A 3U5KA 4NYXA 3K2JA 5E9LA 5CQ5A 2WP1A 3MUKA 5E9YA 2DWWA 4ALGA 5FG6A 3QZTA 3O36A 4LC2A 4QSQA 3LXJA 5A83A 4QB3A 5DKHA 3JVMA 3MB4A 4ZQLA 5DKCA 5E9IA 5C7NA 5IGNA 5CUAA 5CUDA 4UYGA 1F68A 4QEVA 5D3PA 4WHWA 4O74A 3LQIA 5I88A 5LKTA 4AKHA 5I7YA 5FB1A 4UYDA 5IGKA 4QSPA 4AKGA 4HXMA 5JWMA 3SVGA 3LQHA 5EWCA 4CUTA 5D3RA 5F5ZA 5G4RA 3JVLA 5E9VA 4QBMA 5HRWA 5EWHA 2D9EA 3P1EA 4QUTA 2N9GA 4OGIA 3UV4A 4LYIA 5KU3A 4YBTA 4YADA 5IBNA 4NQMA 3NXBA 3HMHA 5E7DA 4UIVA 4CUUA 4NR4A 5D3TA 5CQ8A 5ENCA 3SVHA 5LVRA 4IR6A 2DKWA 4LYSA 4MEPA 2R0SA 5D24A 5EWDA 5A5PA 2E7NA 4TT4A 4QR5A 5FE9A 2NXBA 3MXFA 5F1HA 5E74A 5CUCA 5L8TA 5FE1A 5L96A 4ALHA 4O7AA 4Z93A 4MEQA 5TCMA 5LVQA 3D7CA 4QC1A 2DVQA 4YYKA 5CZGA 2RNYA 4NR5A 5D0CA 4A9KA 5COIA 5CQTA 4YH4A 5A7CA 4CFLA 5BT3A 4UYFA 5DYUA 5IG6A 4A9MA 5ENIA 4PKLA 5A82A 4KV4A 5FE0A 5EICA 5H1TA 3P1CA 5ENFA 4YY6A 5ENEA 5E3DA 4LR6A 5H1UA 4NYWA 4PTBA 5C89A 3JVKA 4QR3A 5HFQA 4UIYA 5DW1A 2F6JA 4TU6A 4YYJA 5I29A 5FG4A 5CQ7A 4IR3A 5EPSA 4BJXA 2RNXA 4A9FA 4UIWA 5LKZA 5KTWA 5D3JA 4QYDA 3G0LA 4FLPA 3U5PA 3U5JA 4LZ2A 5II1A 3JVJA 5FH6A 3UW9A 5A81A 3LQJA 5CGPA 4IOOA 4LZRA 5CS8A 5I40A 5C8GA 5I89A 5BT4A 5EWVA 5F36A 4KCXA 4KV1A 5DLZA 5DFCA 1X0JA 4YYHA 4HBXA 1N72A 3QZVA 4BW2A 5KTXA 3DWYA 5EVAA 5F63A 4QYLA 2I7KA 4CFKA 5C4QA 4C66A 5EP7A 4F3IA 2YEKA 1ZKRA 4AI6A 3RCWA 4N4FA 5AMFA 3LJWA 5G4SA 4O7FA 3P5OA 4HXKA 3Q2EA 5I80A 2RO1A 3ERRA 2D82A 5EQ1A 5LJ2A 5CQ3A 4QUUA 2YELA 4Y03A 4O76A 5CFWA 4TQNA 1WUGA 5TB6A 5EU1A 5E9KA 2F6NA 4OGJA 5DX4A 4A9JA 4N4GA 5EV9A 4Z6IA 4LYWA 5D3NA 4YY4A 5II2A 4YYMA 5C87A 5EK9A 3FKMX 4BW4A 4XY9A 5E9MA 4O7BA 5F60A 4N3WA 5E3GA 5A5RA 4HXOA 5FG5A 4QY4A 4QSSA 5DYCA 4NYVA 4QNSA 5I86A 5ENHA 4Z1QA 3SVFA 2R10A 4LDFA 5EPRA 5I83A 5L97A 1E6IA 3ONIA 4YATA 5FE3A 5HRXA 3VKHA 4UIUA 5L99A 3UVDA 5DYXA 3UV5A 4UITA 5FFVA 3O35A 4LZSA 4PCEA 2FSAA 5HCLA 4NUCA 4NR9A 4A9IA 4CUQA 5HM0A 2DVRA 5IIDA 4HBVA 1JSPB 5CUGA 4TS8A 4O75A 4A9HA 2RFJA 5FDZA 4UYEA 5FE4A 4QSUA 5DY7A 2EJNA 5KO4A 5FBXA 5F2PA 3DAIA 4TYLA 4HBWA 5K29A 5ETDA 4YYGA 4YBSA 4GPJA 1EQFA 1ZS5A 3G0JA 5AD2A 5FB0A 4WHUA 4NRAA 4IORA 4IOQA 2OUOA 4QSXA 5KHMA 4XYAA 2DATA 3GG3A 5J0DA 3IU6A 4DONA 4J0SA 5ETBA 3UVXA 5CQAA 5H85A 4NS5A 4YAXA 5D25A 3P1DA 3AQAA 5KTUA 5D26A 5FH8A 3P1FA 5FH7A 5LKUA 3QZSA 4YABA 4TU4A 5DYAA 5I1QA 2H60A 5F1LA 2E3KA 5EISA 4J1PA 3D1DA 2DVVA 3U5MA 4TTEA 4NXJA 3U5OA 3MQMA 5HEMA 5IGMA 4HXSA 4E96A 5F3AA 4QSVA 2G4AA 5E73A 3TLPA 4A9OA 3IU5A 4HXNA 3UV2A 4N4HA 4O72A 5FE5A 4ZW1A 5C85A 3Q2FA 4QEWA 5L98A 1JM4B 4QC3A 4TZ2A 5DBMA 5LUUA 5HQ7A 4A9EA 3MULA 1WUMA 4XY8A 5CPEA 5HFRA 4CUPA 3MB3A 4O77A 5DFDA 2OO1A 5CTLA 5A5SA 4MENA 3O33A 4O7EA 5AMEA 4MR4A 4TT2A 4UIXA 4BW1A 4N4IA 4QSRA 3UVYA 4AKIA 5JI8A 4MR5A 4XUAA 5CQ6A 4NUEA 4UIZA 4NUDA 5I7XA 4TZ8A 5F62A 5FE6A 4CUSA 3ZYUA 5EI4A 4MEOA 2RNWA 5FE7A 5D3HA 4YYIA 4XUBA 2E7OA 3U5NA 4HBYA 2YEMA 4UYHA 5F25A 2KTBB 5CUBA 2RI7A 5DFBA 4PCIA 4Q0NA 4X2IA 2WP2A 4HXRA 3HMEA 4OUFA 4A9LA 5LJ1A 5CY9A 4QEUA 4QSTA 5EPBA 4QZSA 5FFYA 5EM3A 1PUOA 2YDWA 5D3LA 4MR6A 4PY6A 5E0RA 4QR4A 4IR5A 5A5OA 5DKDA 3O37A 4O71A 2RS9B 5HQ5A 4J0RA 4BW3A 2LSPB 4YYNA 4HXLA 3S92A 2GRCA 5HJCA 2YW5A 4YH3A 3U5LA 4AKNA 5D7XA 4CURA 2MJVB 5LKXA 4Z6HA 5IGLA 2R0YA 5HELA 3UVWA 5BT5A 4YK0A 5A5QA 4CLBA 5DLXA 2DVSA 3O34A
chains in the Genus database with same CATH topology
3I3JA 5CRMA 5ACYA 2L84A 4J3IA 2OSSA 4YC9A 4O78A 5ENBA 4RVRA 4UYFB 5ENGA 5LJ0A 5CQ4A 5ENJA 2L85A 4NR7A 4TT6A 4YYDA 5HQ6A 2YQDA 4CL9A 4NQNA 4WIVA 5CUEA 4YBMA 5CRZA 5H1VA 5CP5A 5A5NA 4A9NA 5EA1A 3S91A 4C67A 5HLSA 4NR6A 5EWWA 5F61A 5CU8A 4NR8A 4NRBA 5EGUA 5HENA 2R0VA 5FE2A 5DW2A 4PS5A 4MR3A 5HRVA 5A85A 4ZC9A 5D3SA 2YYNA 4O70A 4NRCA 5FE8A 2L5EA 5L8UA 5FFWA 4QSWA 4Z1SA 4O7CA 4HXPA 4Q0OA 4LRGA 3HMFA 2I8NA 5AD3A 4BHWA 3AADA 4IR4A 3U5KA 4NYXA 3K2JA 5E9LA 5CQ5A 2WP1A 3MUKA 5E9YA 2DWWA 4ALGA 5FG6A 3QZTA 3O36A 4LC2A 4QSQA 3LXJA 5A83A 4QB3A 5DKHA 3JVMA 3MB4A 4ZQLA 5DKCA 5E9IA 5C7NA 5IGNA 5CUAA 5CUDA 4UYGA 1F68A 4QEVA 5D3PA 4WHWA 4O74A 3LQIA 5I88A 5LKTA 5I7YA 5FB1A 4UYDA 5IGKA 4QSPA 4HXMA 5JWMA 3SVGA 3LQHA 5EWCA 4CUTA 5D3RA 5F5ZA 5G4RA 3JVLA 5E9VA 4QBMA 5HRWA 5EWHA 2D9EA 3P1EA 4QUTA 2N9GA 4OGIA 3UV4A 4LYIA 5KU3A 4YBTA 4YADA 5IBNA 4NQMA 3NXBA 3HMHA 5E7DA 4UIVA 4CUUA 4NR4A 5D3TA 5CQ8A 5ENCA 3SVHA 5LVRA 4IR6A 2DKWA 4LYSA 4MEPA 2R0SA 5D24A 5EWDA 5A5PA 2E7NA 4TT4A 4QR5A 5FE9A 2NXBA 3MXFA 5F1HA 5E74A 5CUCA 5L8TA 5FE1A 5L96A 4ALHA 4O7AA 4Z93A 4MEQA 5TCMA 5LVQA 3D7CA 4QC1A 2DVQA 4YYKA 5CZGA 2RNYA 4NR5A 5D0CA 4A9KA 5COIA 5CQTA 4YH4A 5A7CA 4CFLA 5BT3A 4UYFA 5DYUA 5IG6A 4A9MA 5ENIA 4PKLA 5A82A 4KV4A 5FE0A 5EICA 5H1TA 3P1CA 5ENFA 4YY6A 5ENEA 5E3DA 4LR6A 5H1UA 4NYWA 4PTBA 5C89A 3JVKA 4QR3A 5HFQA 4UIYA 5DW1A 2F6JA 4TU6A 4YYJA 5I29A 5FG4A 5CQ7A 4IR3A 5EPSA 4BJXA 2RNXA 4A9FA 4UIWA 5LKZA 5KTWA 5D3JA 4QYDA 3G0LA 4FLPA 3U5PA 3U5JA 4LZ2A 5II1A 3JVJA 5FH6A 3UW9A 5A81A 3LQJA 5CGPA 4IOOA 4LZRA 5CS8A 5I40A 5C8GA 5I89A 5BT4A 5EWVA 5F36A 4KCXA 4KV1A 5DLZA 5DFCA 1X0JA 4YYHA 4HBXA 1N72A 3QZVA 4BW2A 5KTXA 3DWYA 5EVAA 5F63A 4QYLA 2I7KA 4CFKA 5C4QA 4C66A 5EP7A 4F3IA 2YEKA 3RCWA 4N4FA 5AMFA 3LJWA 5G4SA 4O7FA 3P5OA 4HXKA 3Q2EA 5I80A 2RO1A 2D82A 5EQ1A 5LJ2A 5CQ3A 4QUUA 2YELA 4Y03A 4O76A 5CFWA 4TQNA 1WUGA 5TB6A 5EU1A 5E9KA 2F6NA 4OGJA 5DX4A 4A9JA 4N4GA 5EV9A 4Z6IA 4LYWA 5D3NA 4YY4A 5II2A 4YYMA 5C87A 5EK9A 3FKMX 4BW4A 4XY9A 5E9MA 4O7BA 5F60A 4N3WA 5E3GA 5A5RA 4HXOA 5FG5A 4QY4A 4QSSA 5DYCA 4NYVA 4QNSA 5I86A 5ENHA 4Z1QA 3SVFA 2R10A 4LDFA 5EPRA 5I83A 5L97A 1E6IA 3ONIA 4YATA 5FE3A 5HRXA 4UIUA 5L99A 3UVDA 5DYXA 3UV5A 4UITA 5FFVA 3O35A 4LZSA 4PCEA 2FSAA 5HCLA 4NUCA 4NR9A 4A9IA 4CUQA 5HM0A 2DVRA 5IIDA 4HBVA 1JSPB 5CUGA 4TS8A 4O75A 4A9HA 2RFJA 5FDZA 4UYEA 5FE4A 4QSUA 5DY7A 5KO4A 5FBXA 5F2PA 3DAIA 4TYLA 4HBWA 5K29A 5ETDA 4YYGA 4YBSA 4GPJA 1EQFA 1ZS5A 3G0JA 5AD2A 5FB0A 4WHUA 4NRAA 4IORA 4IOQA 2OUOA 4QSXA 5KHMA 4XYAA 2DATA 3GG3A 5J0DA 3IU6A 4DONA 4J0SA 5ETBA 3UVXA 5CQAA 5H85A 4NS5A 4YAXA 5D25A 3P1DA 3AQAA 5KTUA 5D26A 5FH8A 3P1FA 5FH7A 5LKUA 3QZSA 4YABA 4TU4A 5DYAA 5I1QA 2H60A 5F1LA 2E3KA 5EISA 4J1PA 2DVVA 3U5MA 4TTEA 4NXJA 3U5OA 3MQMA 5HEMA 5IGMA 4HXSA 4E96A 5F3AA 4QSVA 2G4AA 5E73A 3TLPA 4A9OA 3IU5A 4HXNA 3UV2A 4N4HA 4O72A 5FE5A 4ZW1A 5C85A 3Q2FA 4QEWA 5L98A 1JM4B 4QC3A 4TZ2A 5DBMA 5LUUA 5HQ7A 4A9EA 3MULA 1WUMA 4XY8A 5CPEA 5HFRA 4CUPA 3MB3A 4O77A 5DFDA 2OO1A 5CTLA 5A5SA 4MENA 3O33A 4O7EA 5AMEA 4MR4A 4TT2A 4UIXA 4BW1A 4N4IA 4QSRA 3UVYA 5JI8A 4MR5A 4XUAA 5CQ6A 4NUEA 4UIZA 4NUDA 5I7XA 4TZ8A 5F62A 5FE6A 4CUSA 3ZYUA 5EI4A 4MEOA 2RNWA 5FE7A 5D3HA 4YYIA 4XUBA 2E7OA 3U5NA 4HBYA 2YEMA 4UYHA 5F25A 2KTBB 5CUBA 2RI7A 5DFBA 4PCIA 4Q0NA 4X2IA 2WP2A 4HXRA 3HMEA 4OUFA 4A9LA 5LJ1A 5CY9A 4QEUA 4QSTA 5EPBA 4QZSA 5FFYA 5EM3A 2YDWA 5D3LA 4MR6A 4PY6A 5E0RA 4QR4A 4IR5A 5A5OA 5DKDA 3O37A 4O71A 2RS9B 5HQ5A 4J0RA 4BW3A 2LSPB 4YYNA 4HXLA 3S92A 2GRCA 5HJCA 2YW5A 4YH3A 3U5LA 4AKNA 5D7XA 4CURA 2MJVB 5LKXA 4Z6HA 5IGLA 2R0YA 5HELA 3UVWA 5BT5A 4YK0A 5A5QA 4CLBA 5DLXA 2DVSA 3O34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3J A;  5CRM A;  5ACY A;  2L84 A;  4J3I A;  2OSS A;  4YC9 A;  4O78 A;  5ENB A;  4RVR A;  4UYF B;  5ENG A;  5LJ0 A;  5CQ4 A;  5ENJ A;  2L85 A;  4NR7 A;  4TT6 A;  4YYD A;  5HQ6 A;  2YQD A;  4CL9 A;  4NQN A;  4WIV A;  5CUE A;  4YBM A;  5CRZ A;  5H1V A;  5CP5 A;  5A5N A;  4A9N A;  5EA1 A;  3S91 A;  4C67 A;  5HLS A;  4NR6 A;  5EWW A;  5F61 A;  5CU8 A;  4NR8 A;  4NRB A;  5EGU A;  5HEN A;  2R0V A;  5FE2 A;  5DW2 A;  4PS5 A;  4MR3 A;  5HRV A;  5A85 A;  4ZC9 A;  5D3S A;  2YYN A;  4O70 A;  4NRC A;  5FE8 A;  2L5E A;  5L8U A;  5FFW A;  4QSW A;  4Z1S A;  4O7C A;  4HXP A;  4Q0O A;  4LRG A;  3HMF A;  2I8N A;  5AD3 A;  4BHW A;  3AAD A;  4IR4 A;  3U5K A;  4NYX A;  3K2J A;  5E9L A;  5CQ5 A;  2WP1 A;  3MUK A;  5E9Y A;  2DWW A;  4ALG A;  5FG6 A;  3QZT A;  3O36 A;  4LC2 A;  4QSQ A;  3LXJ A;  5A83 A;  4QB3 A;  5DKH A;  3JVM A;  3MB4 A;  4ZQL A;  5DKC A;  5E9I A;  5C7N A;  5IGN A;  5CUA A;  5CUD A;  4UYG A;  1F68 A;  4QEV A;  5D3P A;  4WHW A;  4O74 A;  3LQI A;  5I88 A;  5LKT A;  5I7Y A;  5FB1 A;  4UYD A;  5IGK A;  4QSP A;  4HXM A;  5JWM A;  3SVG A;  3LQH A;  5EWC A;  4CUT A;  5D3R A;  5F5Z A;  5G4R A;  3JVL A;  5E9V A;  4QBM A;  5HRW A;  5EWH A;  2D9E A;  3P1E A;  4QUT A;  2N9G A;  4OGI A;  3UV4 A;  4LYI A;  5KU3 A;  4YBT A;  4YAD A;  5IBN A;  4NQM A;  3NXB A;  3HMH A;  5E7D A;  4UIV A;  4CUU A;  4NR4 A;  5D3T A;  5CQ8 A;  5ENC A;  3SVH A;  5LVR A;  4IR6 A;  2DKW A;  4LYS A;  4MEP A;  2R0S A;  5D24 A;  5EWD A;  5A5P A;  2E7N A;  4TT4 A;  4QR5 A;  5FE9 A;  2NXB A;  3MXF A;  5F1H A;  5E74 A;  5CUC A;  5L8T A;  5FE1 A;  5L96 A;  4ALH A;  4O7A A;  4Z93 A;  4MEQ A;  5TCM A;  5LVQ A;  3D7C A;  4QC1 A;  2DVQ A;  4YYK A;  5CZG A;  2RNY A;  4NR5 A;  5D0C A;  4A9K A;  5COI A;  5CQT A;  4YH4 A;  5A7C A;  4CFL A;  5BT3 A;  4UYF A;  5DYU A;  5IG6 A;  4A9M A;  5ENI A;  4PKL A;  5A82 A;  4KV4 A;  5FE0 A;  5EIC A;  5H1T A;  3P1C A;  5ENF A;  4YY6 A;  5ENE A;  5E3D A;  4LR6 A;  5H1U A;  4NYW A;  4PTB A;  5C89 A;  3JVK A;  4QR3 A;  5HFQ A;  4UIY A;  5DW1 A;  2F6J A;  4TU6 A;  4YYJ A;  5I29 A;  5FG4 A;  5CQ7 A;  4IR3 A;  5EPS A;  4BJX A;  2RNX A;  4A9F A;  4UIW A;  5LKZ A;  5KTW A;  5D3J A;  4QYD A;  3G0L A;  4FLP A;  3U5P A;  3U5J A;  4LZ2 A;  5II1 A;  3JVJ A;  5FH6 A;  3UW9 A;  5A81 A;  3LQJ A;  5CGP A;  4IOO A;  4LZR A;  5CS8 A;  5I40 A;  5C8G A;  5I89 A;  5BT4 A;  5EWV A;  5F36 A;  4KCX A;  4KV1 A;  5DLZ A;  5DFC A;  1X0J A;  4YYH A;  4HBX A;  1N72 A;  3QZV A;  4BW2 A;  5KTX A;  3DWY A;  5EVA A;  5F63 A;  4QYL A;  2I7K A;  4CFK A;  5C4Q A;  4C66 A;  5EP7 A;  4F3I A;  2YEK A;  3RCW A;  4N4F A;  5AMF A;  3LJW A;  5G4S A;  4O7F A;  3P5O A;  4HXK A;  3Q2E A;  5I80 A;  2RO1 A;  2D82 A;  5EQ1 A;  5LJ2 A;  5CQ3 A;  4QUU A;  2YEL A;  4Y03 A;  4O76 A;  5CFW A;  4TQN A;  1WUG A;  5TB6 A;  5EU1 A;  5E9K A;  2F6N A;  4OGJ A;  5DX4 A;  4A9J A;  4N4G A;  5EV9 A;  4Z6I A;  4LYW A;  5D3N A;  4YY4 A;  5II2 A;  4YYM A;  5C87 A;  5EK9 A;  3FKM X;  4BW4 A;  4XY9 A;  5E9M A;  4O7B A;  5F60 A;  4N3W A;  5E3G A;  5A5R A;  4HXO A;  5FG5 A;  4QY4 A;  4QSS A;  5DYC A;  4NYV A;  4QNS A;  5I86 A;  5ENH A;  4Z1Q A;  3SVF A;  2R10 A;  4LDF A;  5EPR A;  5I83 A;  5L97 A;  1E6I A;  3ONI A;  4YAT A;  5FE3 A;  5HRX A;  4UIU A;  5L99 A;  3UVD A;  5DYX A;  3UV5 A;  4UIT A;  5FFV A;  3O35 A;  4LZS A;  4PCE A;  2FSA A;  5HCL A;  4NUC A;  4NR9 A;  4A9I A;  4CUQ A;  5HM0 A;  2DVR A;  5IID A;  4HBV A;  1JSP B;  5CUG A;  4TS8 A;  4O75 A;  4A9H A;  2RFJ A;  5FDZ A;  4UYE A;  5FE4 A;  4QSU A;  5DY7 A;  5KO4 A;  5FBX A;  5F2P A;  3DAI A;  4TYL A;  4HBW A;  5K29 A;  5ETD A;  4YYG A;  4YBS A;  4GPJ A;  1EQF A;  1ZS5 A;  3G0J A;  5AD2 A;  5FB0 A;  4WHU A;  4NRA A;  4IOR A;  4IOQ A;  2OUO A;  4QSX A;  5KHM A;  4XYA A;  2DAT A;  3GG3 A;  5J0D A;  3IU6 A;  4DON A;  4J0S A;  5ETB A;  3UVX A;  5CQA A;  5H85 A;  4NS5 A;  4YAX A;  5D25 A;  3P1D A;  3AQA A;  5KTU A;  5D26 A;  5FH8 A;  3P1F A;  5FH7 A;  5LKU A;  3QZS A;  4YAB A;  4TU4 A;  5DYA A;  5I1Q A;  2H60 A;  5F1L A;  2E3K A;  5EIS A;  4J1P A;  2DVV A;  3U5M A;  4TTE A;  4NXJ A;  3U5O A;  3MQM A;  5HEM A;  5IGM A;  4HXS A;  4E96 A;  5F3A A;  4QSV A;  2G4A A;  5E73 A;  3TLP A;  4A9O A;  3IU5 A;  4HXN A;  3UV2 A;  4N4H A;  4O72 A;  5FE5 A;  4ZW1 A;  5C85 A;  3Q2F A;  4QEW A;  5L98 A;  1JM4 B;  4QC3 A;  4TZ2 A;  5DBM A;  5LUU A;  5HQ7 A;  4A9E A;  3MUL A;  1WUM A;  4XY8 A;  5CPE A;  5HFR A;  4CUP A;  3MB3 A;  4O77 A;  5DFD A;  2OO1 A;  5CTL A;  5A5S A;  4MEN A;  3O33 A;  4O7E A;  5AME A;  4MR4 A;  4TT2 A;  4UIX A;  4BW1 A;  4N4I A;  4QSR A;  3UVY A;  5JI8 A;  4MR5 A;  4XUA A;  5CQ6 A;  4NUE A;  4UIZ A;  4NUD A;  5I7X A;  4TZ8 A;  5F62 A;  5FE6 A;  4CUS A;  3ZYU A;  5EI4 A;  4MEO A;  2RNW A;  5FE7 A;  5D3H A;  4YYI A;  4XUB A;  2E7O A;  3U5N A;  4HBY A;  2YEM A;  4UYH A;  5F25 A;  2KTB B;  5CUB A;  2RI7 A;  5DFB A;  4PCI A;  4Q0N A;  4X2I A;  2WP2 A;  4HXR A;  3HME A;  4OUF A;  4A9L A;  5LJ1 A;  5CY9 A;  4QEU A;  4QST A;  5EPB A;  4QZS A;  5FFY A;  5EM3 A;  2YDW A;  5D3L A;  4MR6 A;  4PY6 A;  5E0R A;  4QR4 A;  4IR5 A;  5A5O A;  5DKD A;  3O37 A;  4O71 A;  2RS9 B;  5HQ5 A;  4J0R A;  4BW3 A;  2LSP B;  4YYN A;  4HXL A;  3S92 A;  2GRC A;  5HJC A;  2YW5 A;  4YH3 A;  3U5L A;  4AKN A;  5D7X A;  4CUR A;  2MJV B;  5LKX A;  4Z6H A;  5IGL A;  2R0Y A;  5HEL A;  3UVW A;  5BT5 A;  4YK0 A;  5A5Q A;  4CLB A;  5DLX A;  2DVS A;  3O34 A; 
#chains in the Genus database with same CATH topology
 3I3J A;  5CRM A;  5ACY A;  2L84 A;  4J3I A;  2OSS A;  4YC9 A;  4O78 A;  5ENB A;  4RVR A;  4UYF B;  5ENG A;  5LJ0 A;  5CQ4 A;  5ENJ A;  2L85 A;  4NR7 A;  4TT6 A;  4YYD A;  5HQ6 A;  2YQD A;  4CL9 A;  4NQN A;  4WIV A;  5CUE A;  4YBM A;  5CRZ A;  5H1V A;  5CP5 A;  5A5N A;  4A9N A;  5EA1 A;  3S91 A;  4C67 A;  5HLS A;  4NR6 A;  5EWW A;  5F61 A;  5CU8 A;  4NR8 A;  4NRB A;  5EGU A;  5HEN A;  2R0V A;  5FE2 A;  5DW2 A;  4PS5 A;  4MR3 A;  3VKG A;  5HRV A;  5A85 A;  4ZC9 A;  5D3S A;  2YYN A;  4O70 A;  4NRC A;  5FE8 A;  2L5E A;  5L8U A;  3D1B A;  5FFW A;  4QSW A;  4Z1S A;  4O7C A;  4HXP A;  4Q0O A;  4LRG A;  3HMF A;  2I8N A;  5AD3 A;  4BHW A;  3AAD A;  4IR4 A;  3U5K A;  4NYX A;  3K2J A;  5E9L A;  5CQ5 A;  2WP1 A;  3MUK A;  5E9Y A;  2DWW A;  4ALG A;  5FG6 A;  3QZT A;  3O36 A;  4LC2 A;  4QSQ A;  3LXJ A;  5A83 A;  4QB3 A;  5DKH A;  3JVM A;  3MB4 A;  4ZQL A;  5DKC A;  5E9I A;  5C7N A;  5IGN A;  5CUA A;  5CUD A;  4UYG A;  1F68 A;  4QEV A;  5D3P A;  4WHW A;  4O74 A;  3LQI A;  5I88 A;  5LKT A;  4AKH A;  5I7Y A;  5FB1 A;  4UYD A;  5IGK A;  4QSP A;  4AKG A;  4HXM A;  5JWM A;  3SVG A;  3LQH A;  5EWC A;  4CUT A;  5D3R A;  5F5Z A;  5G4R A;  3JVL A;  5E9V A;  4QBM A;  5HRW A;  5EWH A;  2D9E A;  3P1E A;  4QUT A;  2N9G A;  4OGI A;  3UV4 A;  4LYI A;  5KU3 A;  4YBT A;  4YAD A;  5IBN A;  4NQM A;  3NXB A;  3HMH A;  5E7D A;  4UIV A;  4CUU A;  4NR4 A;  5D3T A;  5CQ8 A;  5ENC A;  3SVH A;  5LVR A;  4IR6 A;  2DKW A;  4LYS A;  4MEP A;  2R0S A;  5D24 A;  5EWD A;  5A5P A;  2E7N A;  4TT4 A;  4QR5 A;  5FE9 A;  2NXB A;  3MXF A;  5F1H A;  5E74 A;  5CUC A;  5L8T A;  5FE1 A;  5L96 A;  4ALH A;  4O7A A;  4Z93 A;  4MEQ A;  5TCM A;  5LVQ A;  3D7C A;  4QC1 A;  2DVQ A;  4YYK A;  5CZG A;  2RNY A;  4NR5 A;  5D0C A;  4A9K A;  5COI A;  5CQT A;  4YH4 A;  5A7C A;  4CFL A;  5BT3 A;  4UYF A;  5DYU A;  5IG6 A;  4A9M A;  5ENI A;  4PKL A;  5A82 A;  4KV4 A;  5FE0 A;  5EIC A;  5H1T A;  3P1C A;  5ENF A;  4YY6 A;  5ENE A;  5E3D A;  4LR6 A;  5H1U A;  4NYW A;  4PTB A;  5C89 A;  3JVK A;  4QR3 A;  5HFQ A;  4UIY A;  5DW1 A;  2F6J A;  4TU6 A;  4YYJ A;  5I29 A;  5FG4 A;  5CQ7 A;  4IR3 A;  5EPS A;  4BJX A;  2RNX A;  4A9F A;  4UIW A;  5LKZ A;  5KTW A;  5D3J A;  4QYD A;  3G0L A;  4FLP A;  3U5P A;  3U5J A;  4LZ2 A;  5II1 A;  3JVJ A;  5FH6 A;  3UW9 A;  5A81 A;  3LQJ A;  5CGP A;  4IOO A;  4LZR A;  5CS8 A;  5I40 A;  5C8G A;  5I89 A;  5BT4 A;  5EWV A;  5F36 A;  4KCX A;  4KV1 A;  5DLZ A;  5DFC A;  1X0J A;  4YYH A;  4HBX A;  1N72 A;  3QZV A;  4BW2 A;  5KTX A;  3DWY A;  5EVA A;  5F63 A;  4QYL A;  2I7K A;  4CFK A;  5C4Q A;  4C66 A;  5EP7 A;  4F3I A;  2YEK A;  1ZKR A;  4AI6 A;  3RCW A;  4N4F A;  5AMF A;  3LJW A;  5G4S A;  4O7F A;  3P5O A;  4HXK A;  3Q2E A;  5I80 A;  2RO1 A;  3ERR A;  2D82 A;  5EQ1 A;  5LJ2 A;  5CQ3 A;  4QUU A;  2YEL A;  4Y03 A;  4O76 A;  5CFW A;  4TQN A;  1WUG A;  5TB6 A;  5EU1 A;  5E9K A;  2F6N A;  4OGJ A;  5DX4 A;  4A9J A;  4N4G A;  5EV9 A;  4Z6I A;  4LYW A;  5D3N A;  4YY4 A;  5II2 A;  4YYM A;  5C87 A;  5EK9 A;  3FKM X;  4BW4 A;  4XY9 A;  5E9M A;  4O7B A;  5F60 A;  4N3W A;  5E3G A;  5A5R A;  4HXO A;  5FG5 A;  4QY4 A;  4QSS A;  5DYC A;  4NYV A;  4QNS A;  5I86 A;  5ENH A;  4Z1Q A;  3SVF A;  2R10 A;  4LDF A;  5EPR A;  5I83 A;  5L97 A;  1E6I A;  3ONI A;  4YAT A;  5FE3 A;  5HRX A;  3VKH A;  4UIU A;  5L99 A;  3UVD A;  5DYX A;  3UV5 A;  4UIT A;  5FFV A;  3O35 A;  4LZS A;  4PCE A;  2FSA A;  5HCL A;  4NUC A;  4NR9 A;  4A9I A;  4CUQ A;  5HM0 A;  2DVR A;  5IID A;  4HBV A;  1JSP B;  5CUG A;  4TS8 A;  4O75 A;  4A9H A;  2RFJ A;  5FDZ A;  4UYE A;  5FE4 A;  4QSU A;  5DY7 A;  2EJN A;  5KO4 A;  5FBX A;  5F2P A;  3DAI A;  4TYL A;  4HBW A;  5K29 A;  5ETD A;  4YYG A;  4YBS A;  4GPJ A;  1EQF A;  1ZS5 A;  3G0J A;  5AD2 A;  5FB0 A;  4WHU A;  4NRA A;  4IOR A;  4IOQ A;  2OUO A;  4QSX A;  5KHM A;  4XYA A;  2DAT A;  3GG3 A;  5J0D A;  3IU6 A;  4DON A;  4J0S A;  5ETB A;  3UVX A;  5CQA A;  5H85 A;  4NS5 A;  4YAX A;  5D25 A;  3P1D A;  3AQA A;  5KTU A;  5D26 A;  5FH8 A;  3P1F A;  5FH7 A;  5LKU A;  3QZS A;  4YAB A;  4TU4 A;  5DYA A;  5I1Q A;  2H60 A;  5F1L A;  2E3K A;  5EIS A;  4J1P A;  3D1D A;  2DVV A;  3U5M A;  4TTE A;  4NXJ A;  3U5O A;  3MQM A;  5HEM A;  5IGM A;  4HXS A;  4E96 A;  5F3A A;  4QSV A;  2G4A A;  5E73 A;  3TLP A;  4A9O A;  3IU5 A;  4HXN A;  3UV2 A;  4N4H A;  4O72 A;  5FE5 A;  4ZW1 A;  5C85 A;  3Q2F A;  4QEW A;  5L98 A;  1JM4 B;  4QC3 A;  4TZ2 A;  5DBM A;  5LUU A;  5HQ7 A;  4A9E A;  3MUL A;  1WUM A;  4XY8 A;  5CPE A;  5HFR A;  4CUP A;  3MB3 A;  4O77 A;  5DFD A;  2OO1 A;  5CTL A;  5A5S A;  4MEN A;  3O33 A;  4O7E A;  5AME A;  4MR4 A;  4TT2 A;  4UIX A;  4BW1 A;  4N4I A;  4QSR A;  3UVY A;  4AKI A;  5JI8 A;  4MR5 A;  4XUA A;  5CQ6 A;  4NUE A;  4UIZ A;  4NUD A;  5I7X A;  4TZ8 A;  5F62 A;  5FE6 A;  4CUS A;  3ZYU A;  5EI4 A;  4MEO A;  2RNW A;  5FE7 A;  5D3H A;  4YYI A;  4XUB A;  2E7O A;  3U5N A;  4HBY A;  2YEM A;  4UYH A;  5F25 A;  2KTB B;  5CUB A;  2RI7 A;  5DFB A;  4PCI A;  4Q0N A;  4X2I A;  2WP2 A;  4HXR A;  3HME A;  4OUF A;  4A9L A;  5LJ1 A;  5CY9 A;  4QEU A;  4QST A;  5EPB A;  4QZS A;  5FFY A;  5EM3 A;  1PUO A;  2YDW A;  5D3L A;  4MR6 A;  4PY6 A;  5E0R A;  4QR4 A;  4IR5 A;  5A5O A;  5DKD A;  3O37 A;  4O71 A;  2RS9 B;  5HQ5 A;  4J0R A;  4BW3 A;  2LSP B;  4YYN A;  4HXL A;  3S92 A;  2GRC A;  5HJC A;  2YW5 A;  4YH3 A;  3U5L A;  4AKN A;  5D7X A;  4CUR A;  2MJV B;  5LKX A;  4Z6H A;  5IGL A;  2R0Y A;  5HEL A;  3UVW A;  5BT5 A;  4YK0 A;  5A5Q A;  4CLB A;  5DLX A;  2DVS A;  3O34 A; 
#chains in the Genus database with same CATH homology
 3I3J A;  5CRM A;  5ACY A;  2L84 A;  4J3I A;  2OSS A;  4YC9 A;  4O78 A;  5ENB A;  4RVR A;  4UYF B;  5ENG A;  5LJ0 A;  5CQ4 A;  5ENJ A;  2L85 A;  4NR7 A;  4TT6 A;  4YYD A;  5HQ6 A;  2YQD A;  4CL9 A;  4NQN A;  4WIV A;  5CUE A;  4YBM A;  5CRZ A;  5H1V A;  5CP5 A;  5A5N A;  4A9N A;  5EA1 A;  3S91 A;  4C67 A;  5HLS A;  4NR6 A;  5EWW A;  5F61 A;  5CU8 A;  4NR8 A;  4NRB A;  5EGU A;  5HEN A;  2R0V A;  5FE2 A;  5DW2 A;  4PS5 A;  4MR3 A;  5HRV A;  5A85 A;  4ZC9 A;  5D3S A;  2YYN A;  4O70 A;  4NRC A;  5FE8 A;  2L5E A;  5L8U A;  5FFW A;  4QSW A;  4Z1S A;  4O7C A;  4HXP A;  4Q0O A;  4LRG A;  3HMF A;  2I8N A;  5AD3 A;  4BHW A;  3AAD A;  4IR4 A;  3U5K A;  4NYX A;  3K2J A;  5E9L A;  5CQ5 A;  2WP1 A;  3MUK A;  5E9Y A;  2DWW A;  4ALG A;  5FG6 A;  3QZT A;  3O36 A;  4LC2 A;  4QSQ A;  3LXJ A;  5A83 A;  4QB3 A;  5DKH A;  3JVM A;  3MB4 A;  4ZQL A;  5DKC A;  5E9I A;  5C7N A;  5IGN A;  5CUA A;  5CUD A;  4UYG A;  1F68 A;  4QEV A;  5D3P A;  4WHW A;  4O74 A;  3LQI A;  5I88 A;  5LKT A;  5I7Y A;  5FB1 A;  4UYD A;  5IGK A;  4QSP A;  4HXM A;  5JWM A;  3SVG A;  3LQH A;  5EWC A;  4CUT A;  5D3R A;  5F5Z A;  5G4R A;  3JVL A;  5E9V A;  4QBM A;  5HRW A;  5EWH A;  2D9E A;  3P1E A;  4QUT A;  2N9G A;  4OGI A;  3UV4 A;  4LYI A;  5KU3 A;  4YBT A;  4YAD A;  5IBN A;  4NQM A;  3NXB A;  3HMH A;  5E7D A;  4UIV A;  4CUU A;  4NR4 A;  5D3T A;  5CQ8 A;  5ENC A;  3SVH A;  5LVR A;  4IR6 A;  2DKW A;  4LYS A;  4MEP A;  2R0S A;  5D24 A;  5EWD A;  5A5P A;  2E7N A;  4TT4 A;  4QR5 A;  5FE9 A;  2NXB A;  3MXF A;  5F1H A;  5E74 A;  5CUC A;  5L8T A;  5FE1 A;  5L96 A;  4ALH A;  4O7A A;  4Z93 A;  4MEQ A;  5TCM A;  5LVQ A;  3D7C A;  4QC1 A;  2DVQ A;  4YYK A;  5CZG A;  2RNY A;  4NR5 A;  5D0C A;  4A9K A;  5COI A;  5CQT A;  4YH4 A;  5A7C A;  4CFL A;  5BT3 A;  4UYF A;  5DYU A;  5IG6 A;  4A9M A;  5ENI A;  4PKL A;  5A82 A;  4KV4 A;  5FE0 A;  5EIC A;  5H1T A;  3P1C A;  5ENF A;  4YY6 A;  5ENE A;  5E3D A;  4LR6 A;  5H1U A;  4NYW A;  4PTB A;  5C89 A;  3JVK A;  4QR3 A;  5HFQ A;  4UIY A;  5DW1 A;  2F6J A;  4TU6 A;  4YYJ A;  5I29 A;  5FG4 A;  5CQ7 A;  4IR3 A;  5EPS A;  4BJX A;  2RNX A;  4A9F A;  4UIW A;  5LKZ A;  5KTW A;  5D3J A;  4QYD A;  3G0L A;  4FLP A;  3U5P A;  3U5J A;  4LZ2 A;  5II1 A;  3JVJ A;  5FH6 A;  3UW9 A;  5A81 A;  3LQJ A;  5CGP A;  4IOO A;  4LZR A;  5CS8 A;  5I40 A;  5C8G A;  5I89 A;  5BT4 A;  5EWV A;  5F36 A;  4KCX A;  4KV1 A;  5DLZ A;  5DFC A;  1X0J A;  4YYH A;  4HBX A;  1N72 A;  3QZV A;  4BW2 A;  5KTX A;  3DWY A;  5EVA A;  5F63 A;  4QYL A;  2I7K A;  4CFK A;  5C4Q A;  4C66 A;  5EP7 A;  4F3I A;  2YEK A;  3RCW A;  4N4F A;  5AMF A;  3LJW A;  5G4S A;  4O7F A;  3P5O A;  4HXK A;  3Q2E A;  5I80 A;  2RO1 A;  2D82 A;  5EQ1 A;  5LJ2 A;  5CQ3 A;  4QUU A;  2YEL A;  4Y03 A;  4O76 A;  5CFW A;  4TQN A;  1WUG A;  5TB6 A;  5EU1 A;  5E9K A;  2F6N A;  4OGJ A;  5DX4 A;  4A9J A;  4N4G A;  5EV9 A;  4Z6I A;  4LYW A;  5D3N A;  4YY4 A;  5II2 A;  4YYM A;  5C87 A;  5EK9 A;  3FKM X;  4BW4 A;  4XY9 A;  5E9M A;  4O7B A;  5F60 A;  4N3W A;  5E3G A;  5A5R A;  4HXO A;  5FG5 A;  4QY4 A;  4QSS A;  5DYC A;  4NYV A;  4QNS A;  5I86 A;  5ENH A;  4Z1Q A;  3SVF A;  2R10 A;  4LDF A;  5EPR A;  5I83 A;  5L97 A;  1E6I A;  3ONI A;  4YAT A;  5FE3 A;  5HRX A;  4UIU A;  5L99 A;  3UVD A;  5DYX A;  3UV5 A;  4UIT A;  5FFV A;  3O35 A;  4LZS A;  4PCE A;  2FSA A;  5HCL A;  4NUC A;  4NR9 A;  4A9I A;  4CUQ A;  5HM0 A;  2DVR A;  5IID A;  4HBV A;  1JSP B;  5CUG A;  4TS8 A;  4O75 A;  4A9H A;  2RFJ A;  5FDZ A;  4UYE A;  5FE4 A;  4QSU A;  5DY7 A;  5KO4 A;  5FBX A;  5F2P A;  3DAI A;  4TYL A;  4HBW A;  5K29 A;  5ETD A;  4YYG A;  4YBS A;  4GPJ A;  1EQF A;  1ZS5 A;  3G0J A;  5AD2 A;  5FB0 A;  4WHU A;  4NRA A;  4IOR A;  4IOQ A;  2OUO A;  4QSX A;  5KHM A;  4XYA A;  2DAT A;  3GG3 A;  5J0D A;  3IU6 A;  4DON A;  4J0S A;  5ETB A;  3UVX A;  5CQA A;  5H85 A;  4NS5 A;  4YAX A;  5D25 A;  3P1D A;  3AQA A;  5KTU A;  5D26 A;  5FH8 A;  3P1F A;  5FH7 A;  5LKU A;  3QZS A;  4YAB A;  4TU4 A;  5DYA A;  5I1Q A;  2H60 A;  5F1L A;  2E3K A;  5EIS A;  4J1P A;  2DVV A;  3U5M A;  4TTE A;  4NXJ A;  3U5O A;  3MQM A;  5HEM A;  5IGM A;  4HXS A;  4E96 A;  5F3A A;  4QSV A;  2G4A A;  5E73 A;  3TLP A;  4A9O A;  3IU5 A;  4HXN A;  3UV2 A;  4N4H A;  4O72 A;  5FE5 A;  4ZW1 A;  5C85 A;  3Q2F A;  4QEW A;  5L98 A;  1JM4 B;  4QC3 A;  4TZ2 A;  5DBM A;  5LUU A;  5HQ7 A;  4A9E A;  3MUL A;  1WUM A;  4XY8 A;  5CPE A;  5HFR A;  4CUP A;  3MB3 A;  4O77 A;  5DFD A;  2OO1 A;  5CTL A;  5A5S A;  4MEN A;  3O33 A;  4O7E A;  5AME A;  4MR4 A;  4TT2 A;  4UIX A;  4BW1 A;  4N4I A;  4QSR A;  3UVY A;  5JI8 A;  4MR5 A;  4XUA A;  5CQ6 A;  4NUE A;  4UIZ A;  4NUD A;  5I7X A;  4TZ8 A;  5F62 A;  5FE6 A;  4CUS A;  3ZYU A;  5EI4 A;  4MEO A;  2RNW A;  5FE7 A;  5D3H A;  4YYI A;  4XUB A;  2E7O A;  3U5N A;  4HBY A;  2YEM A;  4UYH A;  5F25 A;  2KTB B;  5CUB A;  2RI7 A;  5DFB A;  4PCI A;  4Q0N A;  4X2I A;  2WP2 A;  4HXR A;  3HME A;  4OUF A;  4A9L A;  5LJ1 A;  5CY9 A;  4QEU A;  4QST A;  5EPB A;  4QZS A;  5FFY A;  5EM3 A;  2YDW A;  5D3L A;  4MR6 A;  4PY6 A;  5E0R A;  4QR4 A;  4IR5 A;  5A5O A;  5DKD A;  3O37 A;  4O71 A;  2RS9 B;  5HQ5 A;  4J0R A;  4BW3 A;  2LSP B;  4YYN A;  4HXL A;  3S92 A;  2GRC A;  5HJC A;  2YW5 A;  4YH3 A;  3U5L A;  4AKN A;  5D7X A;  4CUR A;  2MJV B;  5LKX A;  4Z6H A;  5IGL A;  2R0Y A;  5HEL A;  3UVW A;  5BT5 A;  4YK0 A;  5A5Q A;  4CLB A;  5DLX A;  2DVS A;  3O34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...