5I89A

Crystal structure of the bromodomain of human crebbp bound to the benzodiazepinone g02857790
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
115
structure length
115
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/inhibitor
molecule keywords CREB-binding protein
publication title Fragment-Based Discovery of a Selective and Cell-Active Benzodiazepinone CBP/EP300 Bromodomain Inhibitor (CPI-637).
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 115
sequence length 115
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i89A00
5HRWA 1N72A 4BW2A 2RNYA 5EWVA 1F68A 5E7DA 3AADA 5KHMA 5E3DA 3JVMA 2DATA 5F3AA 4J0SA 4RVRA 3QZSA 3IU5A 4KCXA 4QSSA 5C8GA 5HCLA 2DWWA 5FFWA 5E3GA 4Z1SA 5LJ2A 4TU4A 5ENCA 4Q0OA 5ENJA 5HENA 2OUOA 5CUDA 3UVWA 4J3IA 1EQFA 4A9IA 2RS9B 3S92A 5HRVA 3RCWA 5L8TA 5I1QA 4QYLA 4A9EA 5LKZA 4CL9A 3O37A 4QSWA 5FB1A 4HBWA 3LQJA 5L99A 4CFLA 5E9LA 5EPRA 5E9KA 4O75A 5HQ6A 5HFQA 5DLXA 4QB3A 5A5NA 4A9OA 1ZS5A 3QZTA 2DVQA 2YYNA 5D3LA 3UVDA 4A9LA 4IOOA 3O36A 5F63A 4DONA 4F3IA 4N3WA 5H1TA 4HXRA 4UIZA 5CRZA 4IR4A 5EWCA 4CUTA 5A5OA 4UYHA 1X0JA 5EI4A 2YW5A 5CQTA 4QSTA 3MQMA 4TT4A 2FSAA 3G0JA 2DVSA 4LZRA 4PCIA 4TS8A 5G4RA 5IIDA 1WUGA 4LYIA 5II2A 4YC9A 4O7AA 4J0RA 5CQ5A 5ETDA 5FBXA 5DY7A 5CQ6A 2E7OA 4Z6IA 5E73A 4A9JA 5CQAA 5FE3A 5HQ5A 5CQ7A 4PY6A 4WHUA 4YYJA 4HXOA 5D3NA 5EVAA 5FE2A 5CS8A 4UIUA 2NXBA 5CUEA 5CZGA 5CUBA 4NR8A 2I8NA 3P1FA 5CQ4A 3O34A 3HMHA 3UW9A 3AQAA 3P1DA 4CUUA 3SVHA 5D24A 4ALGA 5LUUA 3U5OA 4LC2A 4XYAA 3TLPA 4BW1A 4UIWA 5AMFA 4NXJA 5EV9A 3S91A 5DFDA 2D9EA 2OSSA 4YAXA 5E9IA 5TB6A 2DVRA 4O74A 5F2PA 4TQNA 4O7FA 5D25A 5FH6A 5L98A 5EU1A 3UV4A 5EQ1A 5I88A 2OO1A 3MULA 2R0VA 5FE0A 5DKCA 4J1PA 4KV1A 5ENEA 4HXPA 2DVVA 2MJVB 5EA1A 4QC3A 5EM3A 4QZSA 5I29A 2F6JA 3MB4A 5FFVA 5CFWA 3LQHA 4A9MA 5BT5A 4A9NA 3UV5A 2L5EA 5IBNA 4QSVA 3IU6A 2WP2A 5F62A 4NUCA 4MEPA 4CLBA 4TZ8A 2H60A 3U5MA 5FE1A 4HXSA 5G4SA 4N4FA 5A5SA 4NYVA 5C87A 5ENBA 4HBVA 5A7CA 3FKMX 5D3HA 3DWYA 5EWDA 4BW3A 4ZQLA 4QYDA 3U5PA 4CFKA 3GG3A 2R10A 3P5OA 5COIA 5I89A 2R0YA 4LDFA 4O77A 4QC1A 4A9HA 5D3PA 2E3KA 4HBXA 5EPSA 5FG5A 4NYWA 4YYIA 3MUKA 3HMEA 2RI7A 2YDWA 3U5JA 3I3JA 2KTBB 5CUAA 4Z1QA 2YEKA 4O72A 3JVKA 4QSUA 4QUUA 5IGKA 5J0DA 4NUDA 4HXKA 5ENFA 4O7BA 5F36A 2E7NA 4XUBA 2YEMA 4TYLA 2YQDA 5DW1A 5L97A 5DYCA 5D7XA 4HXMA 4YK0A 5E9VA 2D82A 5C7NA 5II1A 5H1VA 4TT2A 4E96A 4QEVA 4KV4A 5LVRA 4UYDA 5CY9A 3HMFA 5KTXA 5CRMA 4UITA 5LKXA 5EWWA 4MEQA 2GRCA 4NR5A 4CUPA 5LVQA 5H85A 5FE7A 3D7CA 5HQ7A 5K29A 5BT3A 4FLPA 3LQIA 5I83A 5KU3A 5FE8A 4CUQA 4O7EA 4LYWA 5KTUA 4N4GA 3MB3A 4QR3A 4YY4A 3Q2FA 5AD2A 4O71A 4QY4A 3UVXA 3ONIA 4NQNA 5CUCA 4C67A 5FE6A 4QSXA 5IGMA 5DBMA 4XY8A 4NRAA 5LKTA 4AKNA 5KTWA 2LSPB 5D3JA 5DKDA 4YYMA 4LR6A 4WIVA 4QNSA 5FE4A 5HRXA 3MXFA 5DFCA 3O35A 5ETBA 5FB0A 4ZC9A 4MR5A 2G4AA 4ALHA 4NRCA 2YELA 4QSRA 4UYFA 4PTBA 4BJXA 3U5LA 3U5KA 4NS5A 4Y03A 2L84A 4YYKA 5A81A 5E74A 2N9GA 5D3RA 5DKHA 5EK9A 4BW4A 5IGLA 5FH8A 4CURA 5C85A 5E9YA 4UYGA 4OGJA 4QEWA 5FE5A 5L8UA 5LJ1A 4NR4A 3U5NA 5FG6A 4QR4A 5HELA 4QUTA 5BT4A 3LJWA 4HBYA 4UIVA 5C4QA 4NR6A 4C66A 4PCEA 4IR3A 4QSPA 2RO1A 4PS5A 4UIXA 5CQ8A 5C89A 5AD3A 5DYAA 5DW2A 5HM0A 4YADA 5ACYA 4NUEA 5A85A 5LJ0A 4A9FA 2RNXA 2RFJA 4QSQA 4YYNA 5KO4A 5CGPA 4YH4A 1JM4B 5HFRA 4X2IA 5EICA 3K2JA 2R0SA 4ZW1A 5A5PA 5EP7A 4O76A 5FG4A 5F25A 4Z6HA 4OUFA 5H1UA 4MEOA 5CQ3A 4GPJA 4QBMA 4HXNA 5EWHA 4YYHA 4YBMA 5ENGA 4CUSA 5D0CA 5DX4A 5CTLA 5CPEA 5DYUA 4OGIA 4YATA 5JI8A 5JWMA 4O78A 5FDZA 3NXBA 5FE9A 4MR3A 5FH7A 5F1HA 4UYEA 4LYSA 5DFBA 5I86A 5TCMA 4MR6A 4TZ2A 4YH3A 2I7KA 5E0RA 1JSPB 4TT6A 5CUGA 4NYXA 5CU8A 5I80A 4LZSA 5D26A 5HEMA 4Z93A 5A82A 4TTEA 3LXJA 1WUMA 5HJCA 4UYFB 2F6NA 4HXLA 5ENIA 5L96A 4XUAA 1E6IA 5IG6A 2L85A 4IORA 4LRGA 4NQMA 5D3TA 5EPBA 4O7CA 5I7YA 5F5ZA 4NR7A 5AMEA 5F61A 4QR5A 5I7XA 5DLZA 3P1CA 4YBTA 4YYDA 3P1EA 5CP5A 4NR9A 4IR5A 5FFYA 2DKWA 4O70A 4IR6A 5A5QA 2RNWA 3Q2EA 5EGUA 3UVYA 4BHWA 5HLSA 5F1LA 5I40A 3SVGA 4UIYA 3JVLA 3QZVA 5E9MA 4MENA 4NRBA 5EISA 3DAIA 5D3SA 4N4IA 4MR4A 4QEUA 4N4HA 4YY6A 3JVJA 4A9KA 5LKUA 3G0LA 4IOQA 4LZ2A 4Q0NA 5F60A 4PKLA 3ZYUA 4YBSA 4YYGA 5ENHA 4XY9A 4WHWA 5A83A 4TU6A 3SVFA 4YABA 5A5RA 3UV2A 5IGNA 2WP1A 5DYXA 3O33A
chains in the Genus database with same CATH superfamily
5HRWA 1N72A 4BW2A 4AKGA 2RNYA 5EWVA 1F68A 5E7DA 3AADA 1PUOA 5KHMA 5E3DA 3JVMA 2DATA 5F3AA 4J0SA 4RVRA 3QZSA 3IU5A 4KCXA 4QSSA 3ERRA 5C8GA 5HCLA 2DWWA 5FFWA 5E3GA 4Z1SA 5LJ2A 4TU4A 5ENCA 4Q0OA 5ENJA 5HENA 2OUOA 5CUDA 3UVWA 4J3IA 1EQFA 4A9IA 2RS9B 3S92A 5HRVA 3RCWA 5L8TA 5I1QA 4QYLA 4A9EA 5LKZA 4CL9A 3O37A 4QSWA 5FB1A 4HBWA 3LQJA 5L99A 4CFLA 5E9LA 5EPRA 5E9KA 4O75A 5HQ6A 5HFQA 5DLXA 4QB3A 5A5NA 4A9OA 1ZS5A 3QZTA 2DVQA 2YYNA 5D3LA 3UVDA 4A9LA 4IOOA 3O36A 5F63A 4DONA 4F3IA 4N3WA 5H1TA 4HXRA 4UIZA 5CRZA 4IR4A 5EWCA 4CUTA 5A5OA 4UYHA 1X0JA 5EI4A 2YW5A 5CQTA 4QSTA 3MQMA 4TT4A 2FSAA 3G0JA 2DVSA 4LZRA 4PCIA 4TS8A 5G4RA 5IIDA 1WUGA 4LYIA 5II2A 4YC9A 4O7AA 4J0RA 5CQ5A 5ETDA 5FBXA 5DY7A 5CQ6A 2E7OA 4Z6IA 5E73A 4A9JA 5CQAA 5FE3A 5HQ5A 5CQ7A 4PY6A 4WHUA 4YYJA 4HXOA 5D3NA 3D1BA 5EVAA 5FE2A 5CS8A 4UIUA 2NXBA 5CUEA 5CZGA 5CUBA 4NR8A 2I8NA 3P1FA 5CQ4A 3O34A 3HMHA 3UW9A 3AQAA 3P1DA 4CUUA 3SVHA 5D24A 4ALGA 5LUUA 3U5OA 4LC2A 4XYAA 3TLPA 4BW1A 4UIWA 5AMFA 4NXJA 5EV9A 3S91A 5DFDA 2D9EA 2OSSA 4YAXA 5E9IA 5TB6A 2DVRA 4O74A 3D1DA 4TQNA 5F2PA 4O7FA 5D25A 5FH6A 5L98A 5EU1A 3UV4A 5EQ1A 5I88A 2OO1A 3MULA 2R0VA 5FE0A 5DKCA 4J1PA 4KV1A 5ENEA 4HXPA 2DVVA 2MJVB 5EA1A 4QC3A 5EM3A 4QZSA 5I29A 2F6JA 3MB4A 5FFVA 5CFWA 3LQHA 4A9MA 5BT5A 4A9NA 3UV5A 2L5EA 5IBNA 4QSVA 3IU6A 2WP2A 5F62A 4NUCA 4MEPA 4CLBA 4TZ8A 3VKHA 2H60A 3U5MA 5FE1A 4HXSA 5G4SA 4N4FA 5A5SA 4NYVA 5C87A 5ENBA 4HBVA 5A7CA 3FKMX 5D3HA 3DWYA 5EWDA 3VKGA 4BW3A 4ZQLA 4QYDA 3U5PA 4CFKA 3GG3A 2R10A 3P5OA 5COIA 5I89A 2R0YA 4LDFA 4O77A 4QC1A 4A9HA 5D3PA 2E3KA 4HBXA 5EPSA 5FG5A 4NYWA 4YYIA 2EJNA 3MUKA 3HMEA 2RI7A 2YDWA 3U5JA 3I3JA 2KTBB 5CUAA 4Z1QA 2YEKA 4O72A 3JVKA 4QSUA 4QUUA 5IGKA 5J0DA 4NUDA 4HXKA 5ENFA 4O7BA 5F36A 2E7NA 4XUBA 2YEMA 4TYLA 2YQDA 5DW1A 5L97A 5DYCA 5D7XA 4HXMA 4YK0A 5E9VA 2D82A 5C7NA 5II1A 5H1VA 4TT2A 4E96A 4QEVA 4KV4A 5LVRA 4UYDA 5CY9A 3HMFA 5KTXA 5CRMA 4UITA 5LKXA 5EWWA 4MEQA 2GRCA 4NR5A 4CUPA 5LVQA 5H85A 5FE7A 3D7CA 5HQ7A 5K29A 5BT3A 4FLPA 3LQIA 5I83A 5KU3A 5FE8A 4CUQA 4O7EA 4LYWA 5KTUA 4N4GA 3MB3A 4QR3A 4AI6A 4YY4A 3Q2FA 5AD2A 4O71A 4QY4A 3UVXA 3ONIA 4NQNA 5CUCA 4C67A 5FE6A 4QSXA 5IGMA 5DBMA 4XY8A 4NRAA 5LKTA 4AKNA 5KTWA 2LSPB 5D3JA 5DKDA 4YYMA 4LR6A 4WIVA 4QNSA 5FE4A 5HRXA 3MXFA 5DFCA 3O35A 5ETBA 5FB0A 4ZC9A 4MR5A 2G4AA 4ALHA 4NRCA 2YELA 4QSRA 4UYFA 4PTBA 4BJXA 3U5LA 3U5KA 4NS5A 4Y03A 2L84A 4YYKA 5A81A 5E74A 2N9GA 5D3RA 5DKHA 5EK9A 4BW4A 5IGLA 5FH8A 4CURA 5C85A 5E9YA 4UYGA 4OGJA 4QEWA 5FE5A 5L8UA 5LJ1A 4AKHA 4NR4A 3U5NA 5FG6A 4QR4A 5HELA 4QUTA 5BT4A 3LJWA 4HBYA 4UIVA 5C4QA 4NR6A 4C66A 4PCEA 4IR3A 4QSPA 2RO1A 4PS5A 4UIXA 5CQ8A 5C89A 5AD3A 5DYAA 5DW2A 5HM0A 4YADA 5ACYA 4NUEA 5A85A 5LJ0A 4A9FA 2RNXA 2RFJA 4QSQA 4YYNA 5KO4A 5CGPA 4YH4A 1JM4B 5HFRA 4X2IA 5EICA 3K2JA 2R0SA 4ZW1A 5A5PA 5EP7A 4O76A 5FG4A 5F25A 4Z6HA 4OUFA 5H1UA 4MEOA 5CQ3A 4GPJA 4QBMA 4HXNA 5EWHA 4YYHA 4YBMA 5ENGA 4CUSA 5D0CA 5DX4A 5CTLA 5CPEA 5DYUA 4OGIA 4YATA 5JI8A 5JWMA 4O78A 5FDZA 3NXBA 5FE9A 4MR3A 5FH7A 5F1HA 4UYEA 4LYSA 5DFBA 5I86A 5TCMA 4MR6A 4TZ2A 4YH3A 2I7KA 5E0RA 1JSPB 4TT6A 5CUGA 4NYXA 5CU8A 5I80A 4LZSA 5D26A 5HEMA 4Z93A 5A82A 4TTEA 3LXJA 1WUMA 5HJCA 4UYFB 2F6NA 4HXLA 5ENIA 5L96A 4XUAA 1E6IA 5IG6A 2L85A 4IORA 4LRGA 4NQMA 5D3TA 5EPBA 4O7CA 5I7YA 5F5ZA 4NR7A 5AMEA 5F61A 4QR5A 5I7XA 4AKIA 5DLZA 3P1CA 4YBTA 4YYDA 3P1EA 5CP5A 4NR9A 4IR5A 5FFYA 1ZKRA 2DKWA 4O70A 4IR6A 5A5QA 2RNWA 3Q2EA 5EGUA 3UVYA 4BHWA 5HLSA 5F1LA 5I40A 3SVGA 4UIYA 3JVLA 3QZVA 5E9MA 4MENA 4NRBA 5EISA 3DAIA 5D3SA 4N4IA 4MR4A 4QEUA 4N4HA 4YY6A 3JVJA 4A9KA 5LKUA 3G0LA 4IOQA 4LZ2A 4Q0NA 5F60A 4PKLA 3ZYUA 4YBSA 4YYGA 5ENHA 4XY9A 4WHWA 5A83A 4TU6A 3SVFA 4YABA 5A5RA 3UV2A 5IGNA 2WP1A 5DYXA 3O33A
chains in the Genus database with same CATH topology
5HRWA 1N72A 4BW2A 2RNYA 5EWVA 1F68A 5E7DA 3AADA 5KHMA 5E3DA 3JVMA 2DATA 5F3AA 4J0SA 4RVRA 3QZSA 3IU5A 4KCXA 4QSSA 5C8GA 5HCLA 2DWWA 5FFWA 5E3GA 4Z1SA 5LJ2A 4TU4A 5ENCA 4Q0OA 5ENJA 5HENA 2OUOA 5CUDA 3UVWA 4J3IA 1EQFA 4A9IA 2RS9B 3S92A 5HRVA 3RCWA 5L8TA 5I1QA 4QYLA 4A9EA 5LKZA 4CL9A 3O37A 4QSWA 5FB1A 4HBWA 3LQJA 5L99A 4CFLA 5E9LA 5EPRA 5E9KA 4O75A 5HQ6A 5HFQA 5DLXA 4QB3A 5A5NA 4A9OA 1ZS5A 3QZTA 2DVQA 2YYNA 5D3LA 3UVDA 4A9LA 4IOOA 3O36A 5F63A 4DONA 4F3IA 4N3WA 5H1TA 4HXRA 4UIZA 5CRZA 4IR4A 5EWCA 4CUTA 5A5OA 4UYHA 1X0JA 5EI4A 2YW5A 5CQTA 4QSTA 3MQMA 4TT4A 2FSAA 3G0JA 2DVSA 4LZRA 4PCIA 4TS8A 5G4RA 5IIDA 1WUGA 4LYIA 5II2A 4YC9A 4O7AA 4J0RA 5CQ5A 5ETDA 5FBXA 5DY7A 5CQ6A 2E7OA 4Z6IA 5E73A 4A9JA 5CQAA 5FE3A 5HQ5A 5CQ7A 4PY6A 4WHUA 4YYJA 4HXOA 5D3NA 5EVAA 5FE2A 5CS8A 4UIUA 2NXBA 5CUEA 5CZGA 5CUBA 4NR8A 2I8NA 3P1FA 5CQ4A 3O34A 3HMHA 3UW9A 3AQAA 3P1DA 4CUUA 3SVHA 5D24A 4ALGA 5LUUA 3U5OA 4LC2A 4XYAA 3TLPA 4BW1A 4UIWA 5AMFA 4NXJA 5EV9A 3S91A 5DFDA 2D9EA 2OSSA 4YAXA 5E9IA 5TB6A 2DVRA 4O74A 5F2PA 4TQNA 4O7FA 5D25A 5FH6A 5L98A 5EU1A 3UV4A 5EQ1A 5I88A 2OO1A 3MULA 2R0VA 5FE0A 5DKCA 4J1PA 4KV1A 5ENEA 4HXPA 2DVVA 2MJVB 5EA1A 4QC3A 5EM3A 4QZSA 5I29A 2F6JA 3MB4A 5FFVA 5CFWA 3LQHA 4A9MA 5BT5A 4A9NA 3UV5A 2L5EA 5IBNA 4QSVA 3IU6A 2WP2A 5F62A 4NUCA 4MEPA 4CLBA 4TZ8A 2H60A 3U5MA 5FE1A 4HXSA 5G4SA 4N4FA 5A5SA 4NYVA 5C87A 5ENBA 4HBVA 5A7CA 3FKMX 5D3HA 3DWYA 5EWDA 4BW3A 4ZQLA 4QYDA 3U5PA 4CFKA 3GG3A 2R10A 3P5OA 5COIA 5I89A 2R0YA 4LDFA 4O77A 4QC1A 4A9HA 5D3PA 2E3KA 4HBXA 5EPSA 5FG5A 4NYWA 4YYIA 3MUKA 3HMEA 2RI7A 2YDWA 3U5JA 3I3JA 2KTBB 5CUAA 4Z1QA 2YEKA 4O72A 3JVKA 4QSUA 4QUUA 5IGKA 5J0DA 4NUDA 4HXKA 5ENFA 4O7BA 5F36A 2E7NA 4XUBA 2YEMA 4TYLA 2YQDA 5DW1A 5L97A 5DYCA 5D7XA 4HXMA 4YK0A 5E9VA 2D82A 5C7NA 5II1A 5H1VA 4TT2A 4E96A 4QEVA 4KV4A 5LVRA 4UYDA 5CY9A 3HMFA 5KTXA 5CRMA 4UITA 5LKXA 5EWWA 4MEQA 2GRCA 4NR5A 4CUPA 5LVQA 5H85A 5FE7A 3D7CA 5HQ7A 5K29A 5BT3A 4FLPA 3LQIA 5I83A 5KU3A 5FE8A 4CUQA 4O7EA 4LYWA 5KTUA 4N4GA 3MB3A 4QR3A 4YY4A 3Q2FA 5AD2A 4O71A 4QY4A 3UVXA 3ONIA 4NQNA 5CUCA 4C67A 5FE6A 4QSXA 5IGMA 5DBMA 4XY8A 4NRAA 5LKTA 4AKNA 5KTWA 2LSPB 5D3JA 5DKDA 4YYMA 4LR6A 4WIVA 4QNSA 5FE4A 5HRXA 3MXFA 5DFCA 3O35A 5ETBA 5FB0A 4ZC9A 4MR5A 2G4AA 4ALHA 4NRCA 2YELA 4QSRA 4UYFA 4PTBA 4BJXA 3U5LA 3U5KA 4NS5A 4Y03A 2L84A 4YYKA 5A81A 5E74A 2N9GA 5D3RA 5DKHA 5EK9A 4BW4A 5IGLA 5FH8A 4CURA 5C85A 5E9YA 4UYGA 4OGJA 4QEWA 5FE5A 5L8UA 5LJ1A 4NR4A 3U5NA 5FG6A 4QR4A 5HELA 4QUTA 5BT4A 3LJWA 4HBYA 4UIVA 5C4QA 4NR6A 4C66A 4PCEA 4IR3A 4QSPA 2RO1A 4PS5A 4UIXA 5CQ8A 5C89A 5AD3A 5DYAA 5DW2A 5HM0A 4YADA 5ACYA 4NUEA 5A85A 5LJ0A 4A9FA 2RNXA 2RFJA 4QSQA 4YYNA 5KO4A 5CGPA 4YH4A 1JM4B 5HFRA 4X2IA 5EICA 3K2JA 2R0SA 4ZW1A 5A5PA 5EP7A 4O76A 5FG4A 5F25A 4Z6HA 4OUFA 5H1UA 4MEOA 5CQ3A 4GPJA 4QBMA 4HXNA 5EWHA 4YYHA 4YBMA 5ENGA 4CUSA 5D0CA 5DX4A 5CTLA 5CPEA 5DYUA 4OGIA 4YATA 5JI8A 5JWMA 4O78A 5FDZA 3NXBA 5FE9A 4MR3A 5FH7A 5F1HA 4UYEA 4LYSA 5DFBA 5I86A 5TCMA 4MR6A 4TZ2A 4YH3A 2I7KA 5E0RA 1JSPB 4TT6A 5CUGA 4NYXA 5CU8A 5I80A 4LZSA 5D26A 5HEMA 4Z93A 5A82A 4TTEA 3LXJA 1WUMA 5HJCA 4UYFB 2F6NA 4HXLA 5ENIA 5L96A 4XUAA 1E6IA 5IG6A 2L85A 4IORA 4LRGA 4NQMA 5D3TA 5EPBA 4O7CA 5I7YA 5F5ZA 4NR7A 5AMEA 5F61A 4QR5A 5I7XA 5DLZA 3P1CA 4YBTA 4YYDA 3P1EA 5CP5A 4NR9A 4IR5A 5FFYA 2DKWA 4O70A 4IR6A 5A5QA 2RNWA 3Q2EA 5EGUA 3UVYA 4BHWA 5HLSA 5F1LA 5I40A 3SVGA 4UIYA 3JVLA 3QZVA 5E9MA 4MENA 4NRBA 5EISA 3DAIA 5D3SA 4N4IA 4MR4A 4QEUA 4N4HA 4YY6A 3JVJA 4A9KA 5LKUA 3G0LA 4IOQA 4LZ2A 4Q0NA 5F60A 4PKLA 3ZYUA 4YBSA 4YYGA 5ENHA 4XY9A 4WHWA 5A83A 4TU6A 3SVFA 4YABA 5A5RA 3UV2A 5IGNA 2WP1A 5DYXA 3O33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRW A;  1N72 A;  4BW2 A;  2RNY A;  5EWV A;  1F68 A;  5E7D A;  3AAD A;  5KHM A;  5E3D A;  3JVM A;  2DAT A;  5F3A A;  4J0S A;  4RVR A;  3QZS A;  3IU5 A;  4KCX A;  4QSS A;  5C8G A;  5HCL A;  2DWW A;  5FFW A;  5E3G A;  4Z1S A;  5LJ2 A;  4TU4 A;  5ENC A;  4Q0O A;  5ENJ A;  5HEN A;  2OUO A;  5CUD A;  3UVW A;  4J3I A;  1EQF A;  4A9I A;  2RS9 B;  3S92 A;  5HRV A;  3RCW A;  5L8T A;  5I1Q A;  4QYL A;  4A9E A;  5LKZ A;  4CL9 A;  3O37 A;  4QSW A;  5FB1 A;  4HBW A;  3LQJ A;  5L99 A;  4CFL A;  5E9L A;  5EPR A;  5E9K A;  4O75 A;  5HQ6 A;  5HFQ A;  5DLX A;  4QB3 A;  5A5N A;  4A9O A;  1ZS5 A;  3QZT A;  2DVQ A;  2YYN A;  5D3L A;  3UVD A;  4A9L A;  4IOO A;  3O36 A;  5F63 A;  4DON A;  4F3I A;  4N3W A;  5H1T A;  4HXR A;  4UIZ A;  5CRZ A;  4IR4 A;  5EWC A;  4CUT A;  5A5O A;  4UYH A;  1X0J A;  5EI4 A;  2YW5 A;  5CQT A;  4QST A;  3MQM A;  4TT4 A;  2FSA A;  3G0J A;  2DVS A;  4LZR A;  4PCI A;  4TS8 A;  5G4R A;  5IID A;  1WUG A;  4LYI A;  5II2 A;  4YC9 A;  4O7A A;  4J0R A;  5CQ5 A;  5ETD A;  5FBX A;  5DY7 A;  5CQ6 A;  2E7O A;  4Z6I A;  5E73 A;  4A9J A;  5CQA A;  5FE3 A;  5HQ5 A;  5CQ7 A;  4PY6 A;  4WHU A;  4YYJ A;  4HXO A;  5D3N A;  5EVA A;  5FE2 A;  5CS8 A;  4UIU A;  2NXB A;  5CUE A;  5CZG A;  5CUB A;  4NR8 A;  2I8N A;  3P1F A;  5CQ4 A;  3O34 A;  3HMH A;  3UW9 A;  3AQA A;  3P1D A;  4CUU A;  3SVH A;  5D24 A;  4ALG A;  5LUU A;  3U5O A;  4LC2 A;  4XYA A;  3TLP A;  4BW1 A;  4UIW A;  5AMF A;  4NXJ A;  5EV9 A;  3S91 A;  5DFD A;  2D9E A;  2OSS A;  4YAX A;  5E9I A;  5TB6 A;  2DVR A;  4O74 A;  5F2P A;  4TQN A;  4O7F A;  5D25 A;  5FH6 A;  5L98 A;  5EU1 A;  3UV4 A;  5EQ1 A;  5I88 A;  2OO1 A;  3MUL A;  2R0V A;  5FE0 A;  5DKC A;  4J1P A;  4KV1 A;  5ENE A;  4HXP A;  2DVV A;  2MJV B;  5EA1 A;  4QC3 A;  5EM3 A;  4QZS A;  5I29 A;  2F6J A;  3MB4 A;  5FFV A;  5CFW A;  3LQH A;  4A9M A;  5BT5 A;  4A9N A;  3UV5 A;  2L5E A;  5IBN A;  4QSV A;  3IU6 A;  2WP2 A;  5F62 A;  4NUC A;  4MEP A;  4CLB A;  4TZ8 A;  2H60 A;  3U5M A;  5FE1 A;  4HXS A;  5G4S A;  4N4F A;  5A5S A;  4NYV A;  5C87 A;  5ENB A;  4HBV A;  5A7C A;  3FKM X;  5D3H A;  3DWY A;  5EWD A;  4BW3 A;  4ZQL A;  4QYD A;  3U5P A;  4CFK A;  3GG3 A;  2R10 A;  3P5O A;  5COI A;  5I89 A;  2R0Y A;  4LDF A;  4O77 A;  4QC1 A;  4A9H A;  5D3P A;  2E3K A;  4HBX A;  5EPS A;  5FG5 A;  4NYW A;  4YYI A;  3MUK A;  3HME A;  2RI7 A;  2YDW A;  3U5J A;  3I3J A;  2KTB B;  5CUA A;  4Z1Q A;  2YEK A;  4O72 A;  3JVK A;  4QSU A;  4QUU A;  5IGK A;  5J0D A;  4NUD A;  4HXK A;  5ENF A;  4O7B A;  5F36 A;  2E7N A;  4XUB A;  2YEM A;  4TYL A;  2YQD A;  5DW1 A;  5L97 A;  5DYC A;  5D7X A;  4HXM A;  4YK0 A;  5E9V A;  2D82 A;  5C7N A;  5II1 A;  5H1V A;  4TT2 A;  4E96 A;  4QEV A;  4KV4 A;  5LVR A;  4UYD A;  5CY9 A;  3HMF A;  5KTX A;  5CRM A;  4UIT A;  5LKX A;  5EWW A;  4MEQ A;  2GRC A;  4NR5 A;  4CUP A;  5LVQ A;  5H85 A;  5FE7 A;  3D7C A;  5HQ7 A;  5K29 A;  5BT3 A;  4FLP A;  3LQI A;  5I83 A;  5KU3 A;  5FE8 A;  4CUQ A;  4O7E A;  4LYW A;  5KTU A;  4N4G A;  3MB3 A;  4QR3 A;  4YY4 A;  3Q2F A;  5AD2 A;  4O71 A;  4QY4 A;  3UVX A;  3ONI A;  4NQN A;  5CUC A;  4C67 A;  5FE6 A;  4QSX A;  5IGM A;  5DBM A;  4XY8 A;  4NRA A;  5LKT A;  4AKN A;  5KTW A;  2LSP B;  5D3J A;  5DKD A;  4YYM A;  4LR6 A;  4WIV A;  4QNS A;  5FE4 A;  5HRX A;  3MXF A;  5DFC A;  3O35 A;  5ETB A;  5FB0 A;  4ZC9 A;  4MR5 A;  2G4A A;  4ALH A;  4NRC A;  2YEL A;  4QSR A;  4UYF A;  4PTB A;  4BJX A;  3U5L A;  3U5K A;  4NS5 A;  4Y03 A;  2L84 A;  4YYK A;  5A81 A;  5E74 A;  2N9G A;  5D3R A;  5DKH A;  5EK9 A;  4BW4 A;  5IGL A;  5FH8 A;  4CUR A;  5C85 A;  5E9Y A;  4UYG A;  4OGJ A;  4QEW A;  5FE5 A;  5L8U A;  5LJ1 A;  4NR4 A;  3U5N A;  5FG6 A;  4QR4 A;  5HEL A;  4QUT A;  5BT4 A;  3LJW A;  4HBY A;  4UIV A;  5C4Q A;  4NR6 A;  4C66 A;  4PCE A;  4IR3 A;  4QSP A;  2RO1 A;  4PS5 A;  4UIX A;  5CQ8 A;  5C89 A;  5AD3 A;  5DYA A;  5DW2 A;  5HM0 A;  4YAD A;  5ACY A;  4NUE A;  5A85 A;  5LJ0 A;  4A9F A;  2RNX A;  2RFJ A;  4QSQ A;  4YYN A;  5KO4 A;  5CGP A;  4YH4 A;  1JM4 B;  5HFR A;  4X2I A;  5EIC A;  3K2J A;  2R0S A;  4ZW1 A;  5A5P A;  5EP7 A;  4O76 A;  5FG4 A;  5F25 A;  4Z6H A;  4OUF A;  5H1U A;  4MEO A;  5CQ3 A;  4GPJ A;  4QBM A;  4HXN A;  5EWH A;  4YYH A;  4YBM A;  5ENG A;  4CUS A;  5D0C A;  5DX4 A;  5CTL A;  5CPE A;  5DYU A;  4OGI A;  4YAT A;  5JI8 A;  5JWM A;  4O78 A;  5FDZ A;  3NXB A;  5FE9 A;  4MR3 A;  5FH7 A;  5F1H A;  4UYE A;  4LYS A;  5DFB A;  5I86 A;  5TCM A;  4MR6 A;  4TZ2 A;  4YH3 A;  2I7K A;  5E0R A;  1JSP B;  4TT6 A;  5CUG A;  4NYX A;  5CU8 A;  5I80 A;  4LZS A;  5D26 A;  5HEM A;  4Z93 A;  5A82 A;  4TTE A;  3LXJ A;  1WUM A;  5HJC A;  4UYF B;  2F6N A;  4HXL A;  5ENI A;  5L96 A;  4XUA A;  1E6I A;  5IG6 A;  2L85 A;  4IOR A;  4LRG A;  4NQM A;  5D3T A;  5EPB A;  4O7C A;  5I7Y A;  5F5Z A;  4NR7 A;  5AME A;  5F61 A;  4QR5 A;  5I7X A;  5DLZ A;  3P1C A;  4YBT A;  4YYD A;  3P1E A;  5CP5 A;  4NR9 A;  4IR5 A;  5FFY A;  2DKW A;  4O70 A;  4IR6 A;  5A5Q A;  2RNW A;  3Q2E A;  5EGU A;  3UVY A;  4BHW A;  5HLS A;  5F1L A;  5I40 A;  3SVG A;  4UIY A;  3JVL A;  3QZV A;  5E9M A;  4MEN A;  4NRB A;  5EIS A;  3DAI A;  5D3S A;  4N4I A;  4MR4 A;  4QEU A;  4N4H A;  4YY6 A;  3JVJ A;  4A9K A;  5LKU A;  3G0L A;  4IOQ A;  4LZ2 A;  4Q0N A;  5F60 A;  4PKL A;  3ZYU A;  4YBS A;  4YYG A;  5ENH A;  4XY9 A;  4WHW A;  5A83 A;  4TU6 A;  3SVF A;  4YAB A;  5A5R A;  3UV2 A;  5IGN A;  2WP1 A;  5DYX A;  3O33 A; 
#chains in the Genus database with same CATH topology
 5HRW A;  1N72 A;  4BW2 A;  4AKG A;  2RNY A;  5EWV A;  1F68 A;  5E7D A;  3AAD A;  1PUO A;  5KHM A;  5E3D A;  3JVM A;  2DAT A;  5F3A A;  4J0S A;  4RVR A;  3QZS A;  3IU5 A;  4KCX A;  4QSS A;  3ERR A;  5C8G A;  5HCL A;  2DWW A;  5FFW A;  5E3G A;  4Z1S A;  5LJ2 A;  4TU4 A;  5ENC A;  4Q0O A;  5ENJ A;  5HEN A;  2OUO A;  5CUD A;  3UVW A;  4J3I A;  1EQF A;  4A9I A;  2RS9 B;  3S92 A;  5HRV A;  3RCW A;  5L8T A;  5I1Q A;  4QYL A;  4A9E A;  5LKZ A;  4CL9 A;  3O37 A;  4QSW A;  5FB1 A;  4HBW A;  3LQJ A;  5L99 A;  4CFL A;  5E9L A;  5EPR A;  5E9K A;  4O75 A;  5HQ6 A;  5HFQ A;  5DLX A;  4QB3 A;  5A5N A;  4A9O A;  1ZS5 A;  3QZT A;  2DVQ A;  2YYN A;  5D3L A;  3UVD A;  4A9L A;  4IOO A;  3O36 A;  5F63 A;  4DON A;  4F3I A;  4N3W A;  5H1T A;  4HXR A;  4UIZ A;  5CRZ A;  4IR4 A;  5EWC A;  4CUT A;  5A5O A;  4UYH A;  1X0J A;  5EI4 A;  2YW5 A;  5CQT A;  4QST A;  3MQM A;  4TT4 A;  2FSA A;  3G0J A;  2DVS A;  4LZR A;  4PCI A;  4TS8 A;  5G4R A;  5IID A;  1WUG A;  4LYI A;  5II2 A;  4YC9 A;  4O7A A;  4J0R A;  5CQ5 A;  5ETD A;  5FBX A;  5DY7 A;  5CQ6 A;  2E7O A;  4Z6I A;  5E73 A;  4A9J A;  5CQA A;  5FE3 A;  5HQ5 A;  5CQ7 A;  4PY6 A;  4WHU A;  4YYJ A;  4HXO A;  5D3N A;  3D1B A;  5EVA A;  5FE2 A;  5CS8 A;  4UIU A;  2NXB A;  5CUE A;  5CZG A;  5CUB A;  4NR8 A;  2I8N A;  3P1F A;  5CQ4 A;  3O34 A;  3HMH A;  3UW9 A;  3AQA A;  3P1D A;  4CUU A;  3SVH A;  5D24 A;  4ALG A;  5LUU A;  3U5O A;  4LC2 A;  4XYA A;  3TLP A;  4BW1 A;  4UIW A;  5AMF A;  4NXJ A;  5EV9 A;  3S91 A;  5DFD A;  2D9E A;  2OSS A;  4YAX A;  5E9I A;  5TB6 A;  2DVR A;  4O74 A;  3D1D A;  4TQN A;  5F2P A;  4O7F A;  5D25 A;  5FH6 A;  5L98 A;  5EU1 A;  3UV4 A;  5EQ1 A;  5I88 A;  2OO1 A;  3MUL A;  2R0V A;  5FE0 A;  5DKC A;  4J1P A;  4KV1 A;  5ENE A;  4HXP A;  2DVV A;  2MJV B;  5EA1 A;  4QC3 A;  5EM3 A;  4QZS A;  5I29 A;  2F6J A;  3MB4 A;  5FFV A;  5CFW A;  3LQH A;  4A9M A;  5BT5 A;  4A9N A;  3UV5 A;  2L5E A;  5IBN A;  4QSV A;  3IU6 A;  2WP2 A;  5F62 A;  4NUC A;  4MEP A;  4CLB A;  4TZ8 A;  3VKH A;  2H60 A;  3U5M A;  5FE1 A;  4HXS A;  5G4S A;  4N4F A;  5A5S A;  4NYV A;  5C87 A;  5ENB A;  4HBV A;  5A7C A;  3FKM X;  5D3H A;  3DWY A;  5EWD A;  3VKG A;  4BW3 A;  4ZQL A;  4QYD A;  3U5P A;  4CFK A;  3GG3 A;  2R10 A;  3P5O A;  5COI A;  5I89 A;  2R0Y A;  4LDF A;  4O77 A;  4QC1 A;  4A9H A;  5D3P A;  2E3K A;  4HBX A;  5EPS A;  5FG5 A;  4NYW A;  4YYI A;  2EJN A;  3MUK A;  3HME A;  2RI7 A;  2YDW A;  3U5J A;  3I3J A;  2KTB B;  5CUA A;  4Z1Q A;  2YEK A;  4O72 A;  3JVK A;  4QSU A;  4QUU A;  5IGK A;  5J0D A;  4NUD A;  4HXK A;  5ENF A;  4O7B A;  5F36 A;  2E7N A;  4XUB A;  2YEM A;  4TYL A;  2YQD A;  5DW1 A;  5L97 A;  5DYC A;  5D7X A;  4HXM A;  4YK0 A;  5E9V A;  2D82 A;  5C7N A;  5II1 A;  5H1V A;  4TT2 A;  4E96 A;  4QEV A;  4KV4 A;  5LVR A;  4UYD A;  5CY9 A;  3HMF A;  5KTX A;  5CRM A;  4UIT A;  5LKX A;  5EWW A;  4MEQ A;  2GRC A;  4NR5 A;  4CUP A;  5LVQ A;  5H85 A;  5FE7 A;  3D7C A;  5HQ7 A;  5K29 A;  5BT3 A;  4FLP A;  3LQI A;  5I83 A;  5KU3 A;  5FE8 A;  4CUQ A;  4O7E A;  4LYW A;  5KTU A;  4N4G A;  3MB3 A;  4QR3 A;  4AI6 A;  4YY4 A;  3Q2F A;  5AD2 A;  4O71 A;  4QY4 A;  3UVX A;  3ONI A;  4NQN A;  5CUC A;  4C67 A;  5FE6 A;  4QSX A;  5IGM A;  5DBM A;  4XY8 A;  4NRA A;  5LKT A;  4AKN A;  5KTW A;  2LSP B;  5D3J A;  5DKD A;  4YYM A;  4LR6 A;  4WIV A;  4QNS A;  5FE4 A;  5HRX A;  3MXF A;  5DFC A;  3O35 A;  5ETB A;  5FB0 A;  4ZC9 A;  4MR5 A;  2G4A A;  4ALH A;  4NRC A;  2YEL A;  4QSR A;  4UYF A;  4PTB A;  4BJX A;  3U5L A;  3U5K A;  4NS5 A;  4Y03 A;  2L84 A;  4YYK A;  5A81 A;  5E74 A;  2N9G A;  5D3R A;  5DKH A;  5EK9 A;  4BW4 A;  5IGL A;  5FH8 A;  4CUR A;  5C85 A;  5E9Y A;  4UYG A;  4OGJ A;  4QEW A;  5FE5 A;  5L8U A;  5LJ1 A;  4AKH A;  4NR4 A;  3U5N A;  5FG6 A;  4QR4 A;  5HEL A;  4QUT A;  5BT4 A;  3LJW A;  4HBY A;  4UIV A;  5C4Q A;  4NR6 A;  4C66 A;  4PCE A;  4IR3 A;  4QSP A;  2RO1 A;  4PS5 A;  4UIX A;  5CQ8 A;  5C89 A;  5AD3 A;  5DYA A;  5DW2 A;  5HM0 A;  4YAD A;  5ACY A;  4NUE A;  5A85 A;  5LJ0 A;  4A9F A;  2RNX A;  2RFJ A;  4QSQ A;  4YYN A;  5KO4 A;  5CGP A;  4YH4 A;  1JM4 B;  5HFR A;  4X2I A;  5EIC A;  3K2J A;  2R0S A;  4ZW1 A;  5A5P A;  5EP7 A;  4O76 A;  5FG4 A;  5F25 A;  4Z6H A;  4OUF A;  5H1U A;  4MEO A;  5CQ3 A;  4GPJ A;  4QBM A;  4HXN A;  5EWH A;  4YYH A;  4YBM A;  5ENG A;  4CUS A;  5D0C A;  5DX4 A;  5CTL A;  5CPE A;  5DYU A;  4OGI A;  4YAT A;  5JI8 A;  5JWM A;  4O78 A;  5FDZ A;  3NXB A;  5FE9 A;  4MR3 A;  5FH7 A;  5F1H A;  4UYE A;  4LYS A;  5DFB A;  5I86 A;  5TCM A;  4MR6 A;  4TZ2 A;  4YH3 A;  2I7K A;  5E0R A;  1JSP B;  4TT6 A;  5CUG A;  4NYX A;  5CU8 A;  5I80 A;  4LZS A;  5D26 A;  5HEM A;  4Z93 A;  5A82 A;  4TTE A;  3LXJ A;  1WUM A;  5HJC A;  4UYF B;  2F6N A;  4HXL A;  5ENI A;  5L96 A;  4XUA A;  1E6I A;  5IG6 A;  2L85 A;  4IOR A;  4LRG A;  4NQM A;  5D3T A;  5EPB A;  4O7C A;  5I7Y A;  5F5Z A;  4NR7 A;  5AME A;  5F61 A;  4QR5 A;  5I7X A;  4AKI A;  5DLZ A;  3P1C A;  4YBT A;  4YYD A;  3P1E A;  5CP5 A;  4NR9 A;  4IR5 A;  5FFY A;  1ZKR A;  2DKW A;  4O70 A;  4IR6 A;  5A5Q A;  2RNW A;  3Q2E A;  5EGU A;  3UVY A;  4BHW A;  5HLS A;  5F1L A;  5I40 A;  3SVG A;  4UIY A;  3JVL A;  3QZV A;  5E9M A;  4MEN A;  4NRB A;  5EIS A;  3DAI A;  5D3S A;  4N4I A;  4MR4 A;  4QEU A;  4N4H A;  4YY6 A;  3JVJ A;  4A9K A;  5LKU A;  3G0L A;  4IOQ A;  4LZ2 A;  4Q0N A;  5F60 A;  4PKL A;  3ZYU A;  4YBS A;  4YYG A;  5ENH A;  4XY9 A;  4WHW A;  5A83 A;  4TU6 A;  3SVF A;  4YAB A;  5A5R A;  3UV2 A;  5IGN A;  2WP1 A;  5DYX A;  3O33 A; 
#chains in the Genus database with same CATH homology
 5HRW A;  1N72 A;  4BW2 A;  2RNY A;  5EWV A;  1F68 A;  5E7D A;  3AAD A;  5KHM A;  5E3D A;  3JVM A;  2DAT A;  5F3A A;  4J0S A;  4RVR A;  3QZS A;  3IU5 A;  4KCX A;  4QSS A;  5C8G A;  5HCL A;  2DWW A;  5FFW A;  5E3G A;  4Z1S A;  5LJ2 A;  4TU4 A;  5ENC A;  4Q0O A;  5ENJ A;  5HEN A;  2OUO A;  5CUD A;  3UVW A;  4J3I A;  1EQF A;  4A9I A;  2RS9 B;  3S92 A;  5HRV A;  3RCW A;  5L8T A;  5I1Q A;  4QYL A;  4A9E A;  5LKZ A;  4CL9 A;  3O37 A;  4QSW A;  5FB1 A;  4HBW A;  3LQJ A;  5L99 A;  4CFL A;  5E9L A;  5EPR A;  5E9K A;  4O75 A;  5HQ6 A;  5HFQ A;  5DLX A;  4QB3 A;  5A5N A;  4A9O A;  1ZS5 A;  3QZT A;  2DVQ A;  2YYN A;  5D3L A;  3UVD A;  4A9L A;  4IOO A;  3O36 A;  5F63 A;  4DON A;  4F3I A;  4N3W A;  5H1T A;  4HXR A;  4UIZ A;  5CRZ A;  4IR4 A;  5EWC A;  4CUT A;  5A5O A;  4UYH A;  1X0J A;  5EI4 A;  2YW5 A;  5CQT A;  4QST A;  3MQM A;  4TT4 A;  2FSA A;  3G0J A;  2DVS A;  4LZR A;  4PCI A;  4TS8 A;  5G4R A;  5IID A;  1WUG A;  4LYI A;  5II2 A;  4YC9 A;  4O7A A;  4J0R A;  5CQ5 A;  5ETD A;  5FBX A;  5DY7 A;  5CQ6 A;  2E7O A;  4Z6I A;  5E73 A;  4A9J A;  5CQA A;  5FE3 A;  5HQ5 A;  5CQ7 A;  4PY6 A;  4WHU A;  4YYJ A;  4HXO A;  5D3N A;  5EVA A;  5FE2 A;  5CS8 A;  4UIU A;  2NXB A;  5CUE A;  5CZG A;  5CUB A;  4NR8 A;  2I8N A;  3P1F A;  5CQ4 A;  3O34 A;  3HMH A;  3UW9 A;  3AQA A;  3P1D A;  4CUU A;  3SVH A;  5D24 A;  4ALG A;  5LUU A;  3U5O A;  4LC2 A;  4XYA A;  3TLP A;  4BW1 A;  4UIW A;  5AMF A;  4NXJ A;  5EV9 A;  3S91 A;  5DFD A;  2D9E A;  2OSS A;  4YAX A;  5E9I A;  5TB6 A;  2DVR A;  4O74 A;  5F2P A;  4TQN A;  4O7F A;  5D25 A;  5FH6 A;  5L98 A;  5EU1 A;  3UV4 A;  5EQ1 A;  5I88 A;  2OO1 A;  3MUL A;  2R0V A;  5FE0 A;  5DKC A;  4J1P A;  4KV1 A;  5ENE A;  4HXP A;  2DVV A;  2MJV B;  5EA1 A;  4QC3 A;  5EM3 A;  4QZS A;  5I29 A;  2F6J A;  3MB4 A;  5FFV A;  5CFW A;  3LQH A;  4A9M A;  5BT5 A;  4A9N A;  3UV5 A;  2L5E A;  5IBN A;  4QSV A;  3IU6 A;  2WP2 A;  5F62 A;  4NUC A;  4MEP A;  4CLB A;  4TZ8 A;  2H60 A;  3U5M A;  5FE1 A;  4HXS A;  5G4S A;  4N4F A;  5A5S A;  4NYV A;  5C87 A;  5ENB A;  4HBV A;  5A7C A;  3FKM X;  5D3H A;  3DWY A;  5EWD A;  4BW3 A;  4ZQL A;  4QYD A;  3U5P A;  4CFK A;  3GG3 A;  2R10 A;  3P5O A;  5COI A;  5I89 A;  2R0Y A;  4LDF A;  4O77 A;  4QC1 A;  4A9H A;  5D3P A;  2E3K A;  4HBX A;  5EPS A;  5FG5 A;  4NYW A;  4YYI A;  3MUK A;  3HME A;  2RI7 A;  2YDW A;  3U5J A;  3I3J A;  2KTB B;  5CUA A;  4Z1Q A;  2YEK A;  4O72 A;  3JVK A;  4QSU A;  4QUU A;  5IGK A;  5J0D A;  4NUD A;  4HXK A;  5ENF A;  4O7B A;  5F36 A;  2E7N A;  4XUB A;  2YEM A;  4TYL A;  2YQD A;  5DW1 A;  5L97 A;  5DYC A;  5D7X A;  4HXM A;  4YK0 A;  5E9V A;  2D82 A;  5C7N A;  5II1 A;  5H1V A;  4TT2 A;  4E96 A;  4QEV A;  4KV4 A;  5LVR A;  4UYD A;  5CY9 A;  3HMF A;  5KTX A;  5CRM A;  4UIT A;  5LKX A;  5EWW A;  4MEQ A;  2GRC A;  4NR5 A;  4CUP A;  5LVQ A;  5H85 A;  5FE7 A;  3D7C A;  5HQ7 A;  5K29 A;  5BT3 A;  4FLP A;  3LQI A;  5I83 A;  5KU3 A;  5FE8 A;  4CUQ A;  4O7E A;  4LYW A;  5KTU A;  4N4G A;  3MB3 A;  4QR3 A;  4YY4 A;  3Q2F A;  5AD2 A;  4O71 A;  4QY4 A;  3UVX A;  3ONI A;  4NQN A;  5CUC A;  4C67 A;  5FE6 A;  4QSX A;  5IGM A;  5DBM A;  4XY8 A;  4NRA A;  5LKT A;  4AKN A;  5KTW A;  2LSP B;  5D3J A;  5DKD A;  4YYM A;  4LR6 A;  4WIV A;  4QNS A;  5FE4 A;  5HRX A;  3MXF A;  5DFC A;  3O35 A;  5ETB A;  5FB0 A;  4ZC9 A;  4MR5 A;  2G4A A;  4ALH A;  4NRC A;  2YEL A;  4QSR A;  4UYF A;  4PTB A;  4BJX A;  3U5L A;  3U5K A;  4NS5 A;  4Y03 A;  2L84 A;  4YYK A;  5A81 A;  5E74 A;  2N9G A;  5D3R A;  5DKH A;  5EK9 A;  4BW4 A;  5IGL A;  5FH8 A;  4CUR A;  5C85 A;  5E9Y A;  4UYG A;  4OGJ A;  4QEW A;  5FE5 A;  5L8U A;  5LJ1 A;  4NR4 A;  3U5N A;  5FG6 A;  4QR4 A;  5HEL A;  4QUT A;  5BT4 A;  3LJW A;  4HBY A;  4UIV A;  5C4Q A;  4NR6 A;  4C66 A;  4PCE A;  4IR3 A;  4QSP A;  2RO1 A;  4PS5 A;  4UIX A;  5CQ8 A;  5C89 A;  5AD3 A;  5DYA A;  5DW2 A;  5HM0 A;  4YAD A;  5ACY A;  4NUE A;  5A85 A;  5LJ0 A;  4A9F A;  2RNX A;  2RFJ A;  4QSQ A;  4YYN A;  5KO4 A;  5CGP A;  4YH4 A;  1JM4 B;  5HFR A;  4X2I A;  5EIC A;  3K2J A;  2R0S A;  4ZW1 A;  5A5P A;  5EP7 A;  4O76 A;  5FG4 A;  5F25 A;  4Z6H A;  4OUF A;  5H1U A;  4MEO A;  5CQ3 A;  4GPJ A;  4QBM A;  4HXN A;  5EWH A;  4YYH A;  4YBM A;  5ENG A;  4CUS A;  5D0C A;  5DX4 A;  5CTL A;  5CPE A;  5DYU A;  4OGI A;  4YAT A;  5JI8 A;  5JWM A;  4O78 A;  5FDZ A;  3NXB A;  5FE9 A;  4MR3 A;  5FH7 A;  5F1H A;  4UYE A;  4LYS A;  5DFB A;  5I86 A;  5TCM A;  4MR6 A;  4TZ2 A;  4YH3 A;  2I7K A;  5E0R A;  1JSP B;  4TT6 A;  5CUG A;  4NYX A;  5CU8 A;  5I80 A;  4LZS A;  5D26 A;  5HEM A;  4Z93 A;  5A82 A;  4TTE A;  3LXJ A;  1WUM A;  5HJC A;  4UYF B;  2F6N A;  4HXL A;  5ENI A;  5L96 A;  4XUA A;  1E6I A;  5IG6 A;  2L85 A;  4IOR A;  4LRG A;  4NQM A;  5D3T A;  5EPB A;  4O7C A;  5I7Y A;  5F5Z A;  4NR7 A;  5AME A;  5F61 A;  4QR5 A;  5I7X A;  5DLZ A;  3P1C A;  4YBT A;  4YYD A;  3P1E A;  5CP5 A;  4NR9 A;  4IR5 A;  5FFY A;  2DKW A;  4O70 A;  4IR6 A;  5A5Q A;  2RNW A;  3Q2E A;  5EGU A;  3UVY A;  4BHW A;  5HLS A;  5F1L A;  5I40 A;  3SVG A;  4UIY A;  3JVL A;  3QZV A;  5E9M A;  4MEN A;  4NRB A;  5EIS A;  3DAI A;  5D3S A;  4N4I A;  4MR4 A;  4QEU A;  4N4H A;  4YY6 A;  3JVJ A;  4A9K A;  5LKU A;  3G0L A;  4IOQ A;  4LZ2 A;  4Q0N A;  5F60 A;  4PKL A;  3ZYU A;  4YBS A;  4YYG A;  5ENH A;  4XY9 A;  4WHW A;  5A83 A;  4TU6 A;  3SVF A;  4YAB A;  5A5R A;  3UV2 A;  5IGN A;  2WP1 A;  5DYX A;  3O33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...