5C89A

Crystal structure of the human brpf1 bromodomain in complex with 917
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Crystal structure of the human BRPF1 bromodomain in complex with 917
rcsb
source organism Homo sapiens
total genus 38
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5c89A00
4YH4A 4NUCA 5A5PA 5CFWA 5DW1A 4MR5A 3ZYUA 4Q0OA 4OGIA 4YYNA 2D9EA 5F1LA 5DKCA 3UVWA 4A9NA 5L97A 1N72A 5FG4A 1JSPB 5H85A 5FE6A 4A9HA 2YW5A 3MB3A 5CP5A 1E6IA 4OGJA 5HCLA 4YATA 4O74A 4QNSA 5ENGA 5E9KA 4QC3A 4YYKA 5DYCA 4E96A 4NUDA 2YEKA 3LQJA 4O75A 3QZSA 3JVMA 4BW4A 3UV5A 4QSQA 4O7FA 5G4RA 5FE8A 5IGKA 2DVQA 4TS8A 3JVKA 5IG6A 4QB3A 4UYFA 4NQNA 5CQ5A 2FSAA 4A9MA 5L99A 4UYDA 3MXFA 5EWVA 4O77A 3P1DA 4ZC9A 2WP1A 4CLBA 4QEUA 5A5SA 4QR3A 5AD2A 4IORA 5KTUA 5CUGA 4TT2A 3U5PA 5CQ4A 3O37A 2OO1A 3ONIA 3HMFA 5F63A 5C4QA 4C67A 5COIA 5FE9A 5CU8A 5CQ7A 3G0LA 4YBMA 2E7NA 4LRGA 5ENBA 4YYHA 3JVLA 4NRBA 5DKDA 5FG6A 5A82A 4UIWA 5LKXA 4LR6A 4NXJA 4XYAA 4UYEA 4XY8A 5DKHA 5FBXA 5CUEA 2OUOA 5DFBA 5L98A 4N4GA 4WIVA 4ZW1A 5JI8A 5FE3A 4Z1QA 4HBXA 5F3AA 4QEWA 5FE2A 3U5LA 3AQAA 5CRZA 5JWMA 4J0RA 2RI7A 5F60A 5HRXA 4N4FA 1X0JA 5ENHA 2I7KA 4HXMA 4IR5A 4O7BA 5LKTA 3U5JA 5CUAA 2NXBA 5LJ2A 5DLZA 4YYIA 4PS5A 2DVSA 4UITA 4HXLA 1WUGA 4QR5A 5DX4A 5C8GA 4YY4A 2YEMA 4NR9A 5LUUA 5C85A 4CFKA 2DVVA 5ENEA 5CQAA 2RNYA 3HMHA 5I89A 2RO1A 5DLXA 5I7XA 5EWHA 5D26A 5HQ6A 4O71A 2MJVB 4KCXA 3UVYA 4QYDA 3UV2A 5HLSA 5E73A 4PTBA 3TLPA 4X2IA 4NYXA 4HBYA 5HENA 4UIXA 4CUPA 5HRVA 5FE1A 5DFCA 5HEMA 5A5QA 5I29A 4HXKA 3MQMA 3IU6A 5FDZA 4N4IA 2DVRA 5CRMA 4UYGA 4IR3A 2N9GA 4CUSA 5DFDA 5FH6A 4QSWA 4MENA 4PKLA 5EICA 4YC9A 4IR4A 2DWWA 5D3RA 3O34A 4UYFB 5D3NA 4CURA 2YYNA 5FE0A 5E0RA 5C7NA 5DYXA 2RFJA 5CUBA 5FG5A 4YYMA 5I80A 3SVHA 5FB0A 4YY6A 4UIVA 1JM4B 5EA1A 5EVAA 3DWYA 5EGUA 3LQIA 4NQMA 5FB1A 4QUTA 4NYWA 4UIUA 4LZRA 4LYIA 4TT6A 5EISA 5CUCA 4BHWA 3MB4A 4LC2A 4UYHA 5II2A 4J0SA 5A81A 4MEPA 5EV9A 2R0YA 5I7YA 5EWWA 2I8NA 5D3LA 5LVRA 4MR6A 5LKUA 4O78A 5EPSA 4O7AA 2YELA 4A9OA 5L8UA 4NR6A 5I40A 5FE5A 1EQFA 5CQ8A 5L8TA 5L96A 5AMFA 1WUMA 3SVGA 5ETDA 4YYJA 4UIYA 4BJXA 5E74A 3I3JA 4N4HA 4HXNA 4TYLA 5D0CA 5BT4A 4LZSA 5HFRA 4HXRA 5K29A 5D3PA 5FFYA 4QSPA 5HFQA 5D3SA 5F2PA 4QSTA 2YDWA 4CUUA 5ENFA 5CQ3A 4PY6A 5KHMA 2D82A 4NRCA 5A7CA 3P1EA 4A9KA 4QZSA 5F1HA 5FFWA 5IBNA 5D3HA 5E7DA 4HBWA 4XUAA 5E9MA 4XY9A 5BT3A 4NR4A 4A9FA 2OSSA 5LJ1A 5FH7A 4YADA 2RS9B 5D24A 4WHUA 5KTXA 2R10A 3NXBA 5KO4A 5A85A 5EPBA 5EI4A 5FE4A 5ENCA 5DY7A 4IR6A 4YK0A 5G4SA 4TTEA 4TU4A 4MR4A 4BW3A 3DAIA 4A9JA 4TZ8A 4QSVA 4FLPA 4TT4A 4RVRA 4QYLA 3Q2EA 5EQ1A 5ETBA 4IOQA 4LDFA 4NS5A 5D25A 4PCIA 2L84A 2E7OA 5DBMA 3HMEA 4QSUA 3P5OA 5F36A 4Y03A 5IGMA 3K2JA 3UV4A 3UVDA 4Z6HA 5LVQA 2GRCA 3UVXA 4YYGA 3U5NA 4GPJA 3Q2FA 4NYVA 4YBSA 2RNWA 3U5KA 5E9VA 5EWDA 5FFVA 3SVFA 3O35A 3P1CA 5CPEA 5J0DA 5EK9A 4O7CA 2H60A 4NR7A 5HM0A 3S92A 5EPRA 5H1VA 5HQ5A 4NUEA 4LYSA 5E3GA 4NR8A 5IIDA 5IGLA 5TCMA 4HBVA 5ACYA 4A9LA 5H1TA 5CQTA 4HXSA 2L85A 4YH3A 3U5MA 4ALHA 5A5OA 4J1PA 4C66A 5BT5A 4LYWA 4TQNA 5LJ0A 4CFLA 4BW1A 5DYUA 4OUFA 5F25A 4A9EA 5TB6A 5FE7A 4O72A 5D7XA 4UIZA 3S91A 4WHWA 2DATA 4O7EA 5I1QA 4NRAA 5C87A 4Z6IA 3O36A 5E9LA 4N3WA 5EWCA 2RNXA 4QC1A 3U5OA 4ZQLA 3O33A 5CQ6A 4J3IA 4QSSA 5E9IA 2G4AA 3FKMX 4TZ2A 2KTBB 5A83A 5KTWA 5DYAA 4HXPA 3LXJA 4NR5A 4XUBA 3QZVA 3MULA 5CZGA 4CUQA 5LKZA 5DW2A 5HRWA 3G0JA 5AD3A 3RCWA 4PCEA 5I83A 4HXOA 5D3JA 5E9YA 5II1A 4DONA 5CTLA 5F61A 5F62A 4YABA 2YQDA 5KU3A 4QSXA 4YBTA 5HELA 4KV4A 4BW2A 5A5NA 4YAXA 4LZ2A 4Z1SA 4ALGA 4CUTA 5CGPA 4MR3A 5CS8A 5E3DA 5F5ZA 3UW9A 5EP7A 2F6NA 2WP2A 5FH8A 2F6JA 4AKNA 3IU5A 4KV1A 3P1FA 3D7CA 3MUKA 5CUDA 4QUUA 3JVJA 3AADA 5IGNA 2DKWA 5CY9A 5EU1A 4QSRA 5ENIA 5EM3A 3LQHA 4CL9A 2LSPB 4IOOA 5A5RA 4QBMA 5D3TA 4YYDA 5C89A 5HQ7A 3QZTA 5HJCA 4O76A 2E3KA 5H1UA 4O70A 4MEOA 5I86A 1ZS5A 5ENJA 2R0SA 3LJWA 4A9IA 2L5EA 3GG3A 4QY4A 4QEVA 5AMEA 4Z93A 1F68A 2R0VA 4Q0NA 4MEQA 4F3IA 4TU6A 4QR4A 5I88A
chains in the Genus database with same CATH superfamily
4YH4A 4NUCA 5A5PA 5CFWA 5DW1A 4MR5A 3ZYUA 4Q0OA 4OGIA 4YYNA 2D9EA 5F1LA 5DKCA 3UVWA 4A9NA 5L97A 1N72A 5FG4A 1JSPB 5H85A 5FE6A 4A9HA 2YW5A 3MB3A 5CP5A 1E6IA 4OGJA 5HCLA 4YATA 4O74A 4QNSA 5ENGA 5E9KA 4QC3A 4YYKA 5DYCA 4E96A 4NUDA 2YEKA 3LQJA 4O75A 3QZSA 3JVMA 4BW4A 3UV5A 4QSQA 4O7FA 5G4RA 5FE8A 5IGKA 4AKHA 2DVQA 4TS8A 3JVKA 5IG6A 4AI6A 4QB3A 4UYFA 4NQNA 5CQ5A 2FSAA 4A9MA 5L99A 4UYDA 3MXFA 5EWVA 4O77A 3P1DA 4ZC9A 2WP1A 4CLBA 4QEUA 5A5SA 4QR3A 5AD2A 4IORA 5KTUA 5CUGA 4TT2A 3U5PA 5CQ4A 3O37A 2OO1A 3ONIA 3HMFA 5F63A 5C4QA 4C67A 5COIA 5FE9A 5CU8A 5CQ7A 3G0LA 4YBMA 2E7NA 4LRGA 5ENBA 4YYHA 3JVLA 4NRBA 5DKDA 5FG6A 5A82A 4UIWA 5LKXA 4LR6A 4NXJA 4XYAA 4UYEA 4XY8A 5DKHA 5FBXA 5CUEA 2OUOA 5DFBA 5L98A 4N4GA 4WIVA 4ZW1A 5JI8A 5FE3A 4Z1QA 4HBXA 5F3AA 4QEWA 5FE2A 3U5LA 3AQAA 5CRZA 5JWMA 4J0RA 2RI7A 5F60A 5HRXA 4N4FA 1X0JA 5ENHA 2I7KA 4HXMA 4IR5A 4O7BA 5LKTA 3U5JA 5CUAA 2NXBA 5LJ2A 5DLZA 4YYIA 4PS5A 2DVSA 4UITA 4HXLA 1WUGA 4QR5A 5DX4A 5C8GA 4YY4A 2YEMA 4NR9A 5LUUA 5C85A 4CFKA 2DVVA 5ENEA 5CQAA 2RNYA 3HMHA 5I89A 2RO1A 5DLXA 5I7XA 5EWHA 5D26A 5HQ6A 4O71A 2MJVB 4KCXA 3UVYA 4QYDA 3UV2A 5HLSA 5E73A 4PTBA 3TLPA 4X2IA 4NYXA 4HBYA 5HENA 4UIXA 4CUPA 5HRVA 5FE1A 5DFCA 5HEMA 5A5QA 5I29A 4HXKA 3MQMA 3IU6A 5FDZA 4N4IA 2DVRA 5CRMA 4UYGA 4IR3A 2N9GA 3D1BA 4CUSA 5DFDA 5FH6A 4QSWA 4MENA 4PKLA 5EICA 4YC9A 4IR4A 2DWWA 5D3RA 3O34A 4UYFB 5D3NA 4CURA 2YYNA 5FE0A 5E0RA 5C7NA 5DYXA 2RFJA 5CUBA 5FG5A 4YYMA 5I80A 3SVHA 5FB0A 4YY6A 4UIVA 1JM4B 5EA1A 5EVAA 3DWYA 5EGUA 3LQIA 4NQMA 5FB1A 4QUTA 4NYWA 4UIUA 4LZRA 4LYIA 4TT6A 5EISA 5CUCA 4BHWA 3MB4A 4LC2A 4UYHA 2EJNA 5II2A 4J0SA 5A81A 4MEPA 5EV9A 2R0YA 5I7YA 5EWWA 2I8NA 5D3LA 5LVRA 4MR6A 5LKUA 4O78A 5EPSA 4O7AA 2YELA 4A9OA 5L8UA 4NR6A 5I40A 5FE5A 1EQFA 5CQ8A 5L8TA 5L96A 5AMFA 1WUMA 3SVGA 5ETDA 4YYJA 4UIYA 4BJXA 5E74A 1PUOA 3I3JA 4N4HA 4HXNA 4TYLA 5D0CA 5BT4A 4LZSA 5HFRA 4HXRA 5K29A 5D3PA 5FFYA 4QSPA 5HFQA 5D3SA 5F2PA 4QSTA 2YDWA 4CUUA 5ENFA 5CQ3A 4PY6A 5KHMA 2D82A 4NRCA 5A7CA 3P1EA 4A9KA 4QZSA 5F1HA 5FFWA 5IBNA 5D3HA 5E7DA 4HBWA 4XUAA 5E9MA 4XY9A 5BT3A 4NR4A 4A9FA 2OSSA 5LJ1A 5FH7A 4YADA 2RS9B 5D24A 4WHUA 5KTXA 2R10A 3NXBA 5KO4A 5A85A 5EPBA 5EI4A 5FE4A 5ENCA 5DY7A 4IR6A 4YK0A 5G4SA 4TTEA 4TU4A 4MR4A 4BW3A 3DAIA 4A9JA 4TZ8A 4QSVA 4FLPA 4TT4A 4RVRA 4QYLA 3Q2EA 5EQ1A 5ETBA 4IOQA 4LDFA 4NS5A 5D25A 4PCIA 2L84A 2E7OA 3HMEA 5DBMA 4QSUA 3P5OA 5F36A 4Y03A 5IGMA 3K2JA 3UV4A 3UVDA 4Z6HA 5LVQA 2GRCA 3UVXA 4YYGA 3U5NA 4GPJA 3Q2FA 4NYVA 4YBSA 2RNWA 3U5KA 5E9VA 5EWDA 5FFVA 3SVFA 3O35A 3P1CA 5CPEA 5J0DA 5EK9A 4O7CA 2H60A 4NR7A 5HM0A 3S92A 5EPRA 5H1VA 5HQ5A 4NUEA 3VKHA 4LYSA 5E3GA 4NR8A 5IIDA 5IGLA 1ZKRA 5TCMA 3VKGA 4HBVA 5ACYA 4A9LA 5H1TA 5CQTA 4HXSA 2L85A 4YH3A 3U5MA 4ALHA 5A5OA 4J1PA 4C66A 5BT5A 4LYWA 4AKGA 4TQNA 5LJ0A 4CFLA 4BW1A 5DYUA 4OUFA 5F25A 4A9EA 5TB6A 5FE7A 4O72A 5D7XA 4UIZA 3S91A 4WHWA 2DATA 4O7EA 5I1QA 4NRAA 5C87A 4Z6IA 3O36A 5E9LA 4N3WA 5EWCA 2RNXA 4QC1A 3U5OA 4ZQLA 3O33A 5CQ6A 4J3IA 4QSSA 5E9IA 3ERRA 2G4AA 3FKMX 4TZ2A 2KTBB 5A83A 5KTWA 5DYAA 4HXPA 3LXJA 4NR5A 4XUBA 3QZVA 3MULA 5CZGA 4CUQA 5LKZA 5DW2A 5HRWA 3G0JA 5AD3A 3RCWA 4PCEA 5I83A 4HXOA 5D3JA 5E9YA 5II1A 4DONA 5CTLA 5F61A 5F62A 4YABA 2YQDA 5KU3A 4QSXA 4YBTA 5HELA 4KV4A 4BW2A 5A5NA 4YAXA 4LZ2A 4Z1SA 4ALGA 4CUTA 5CGPA 4MR3A 5CS8A 5E3DA 5F5ZA 3UW9A 5EP7A 2F6NA 2WP2A 5FH8A 2F6JA 4AKNA 3IU5A 4KV1A 3P1FA 3D7CA 3MUKA 5CUDA 4QUUA 3JVJA 3AADA 5IGNA 2DKWA 5CY9A 4AKIA 5EU1A 4QSRA 5ENIA 5EM3A 3LQHA 4CL9A 2LSPB 4IOOA 5A5RA 4QBMA 5D3TA 4YYDA 5C89A 5HQ7A 3QZTA 5HJCA 4O76A 2E3KA 5H1UA 4O70A 4MEOA 5I86A 1ZS5A 5ENJA 2R0SA 3D1DA 3LJWA 4A9IA 2L5EA 3GG3A 4QY4A 4QEVA 5AMEA 4Z93A 1F68A 2R0VA 4Q0NA 4MEQA 4F3IA 4TU6A 4QR4A 5I88A
chains in the Genus database with same CATH topology
4YH4A 4NUCA 5A5PA 5CFWA 5DW1A 4MR5A 3ZYUA 4Q0OA 4OGIA 4YYNA 2D9EA 5F1LA 5DKCA 3UVWA 4A9NA 5L97A 1N72A 5FG4A 1JSPB 5H85A 5FE6A 4A9HA 2YW5A 3MB3A 5CP5A 1E6IA 4OGJA 5HCLA 4YATA 4O74A 4QNSA 5ENGA 5E9KA 4QC3A 4YYKA 5DYCA 4E96A 4NUDA 2YEKA 3LQJA 4O75A 3QZSA 3JVMA 4BW4A 3UV5A 4QSQA 4O7FA 5G4RA 5FE8A 5IGKA 2DVQA 4TS8A 3JVKA 5IG6A 4QB3A 4UYFA 4NQNA 5CQ5A 2FSAA 4A9MA 5L99A 4UYDA 3MXFA 5EWVA 4O77A 3P1DA 4ZC9A 2WP1A 4CLBA 4QEUA 5A5SA 4QR3A 5AD2A 4IORA 5KTUA 5CUGA 4TT2A 3U5PA 5CQ4A 3O37A 2OO1A 3ONIA 3HMFA 5F63A 5C4QA 4C67A 5COIA 5FE9A 5CU8A 5CQ7A 3G0LA 4YBMA 2E7NA 4LRGA 5ENBA 4YYHA 3JVLA 4NRBA 5DKDA 5FG6A 5A82A 4UIWA 5LKXA 4LR6A 4NXJA 4XYAA 4UYEA 4XY8A 5DKHA 5FBXA 5CUEA 2OUOA 5DFBA 5L98A 4N4GA 4WIVA 4ZW1A 5JI8A 5FE3A 4Z1QA 4HBXA 5F3AA 4QEWA 5FE2A 3U5LA 3AQAA 5CRZA 5JWMA 4J0RA 2RI7A 5F60A 5HRXA 4N4FA 1X0JA 5ENHA 2I7KA 4HXMA 4IR5A 4O7BA 5LKTA 3U5JA 5CUAA 2NXBA 5LJ2A 5DLZA 4YYIA 4PS5A 2DVSA 4UITA 4HXLA 1WUGA 4QR5A 5DX4A 5C8GA 4YY4A 2YEMA 4NR9A 5LUUA 5C85A 4CFKA 2DVVA 5ENEA 5CQAA 2RNYA 3HMHA 5I89A 2RO1A 5DLXA 5I7XA 5EWHA 5D26A 5HQ6A 4O71A 2MJVB 4KCXA 3UVYA 4QYDA 3UV2A 5HLSA 5E73A 4PTBA 3TLPA 4X2IA 4NYXA 4HBYA 5HENA 4UIXA 4CUPA 5HRVA 5FE1A 5DFCA 5HEMA 5A5QA 5I29A 4HXKA 3MQMA 3IU6A 5FDZA 4N4IA 2DVRA 5CRMA 4UYGA 4IR3A 2N9GA 4CUSA 5DFDA 5FH6A 4QSWA 4MENA 4PKLA 5EICA 4YC9A 4IR4A 2DWWA 5D3RA 3O34A 4UYFB 5D3NA 4CURA 2YYNA 5FE0A 5E0RA 5C7NA 5DYXA 2RFJA 5CUBA 5FG5A 4YYMA 5I80A 3SVHA 5FB0A 4YY6A 4UIVA 1JM4B 5EA1A 5EVAA 3DWYA 5EGUA 3LQIA 4NQMA 5FB1A 4QUTA 4NYWA 4UIUA 4LZRA 4LYIA 4TT6A 5EISA 5CUCA 4BHWA 3MB4A 4LC2A 4UYHA 5II2A 4J0SA 5A81A 4MEPA 5EV9A 2R0YA 5I7YA 5EWWA 2I8NA 5D3LA 5LVRA 4MR6A 5LKUA 4O78A 5EPSA 4O7AA 2YELA 4A9OA 5L8UA 4NR6A 5I40A 5FE5A 1EQFA 5CQ8A 5L8TA 5L96A 5AMFA 1WUMA 3SVGA 5ETDA 4YYJA 4UIYA 4BJXA 5E74A 3I3JA 4N4HA 4HXNA 4TYLA 5D0CA 5BT4A 4LZSA 5HFRA 4HXRA 5K29A 5D3PA 5FFYA 4QSPA 5HFQA 5D3SA 5F2PA 4QSTA 2YDWA 4CUUA 5ENFA 5CQ3A 4PY6A 5KHMA 2D82A 4NRCA 5A7CA 3P1EA 4A9KA 4QZSA 5F1HA 5FFWA 5IBNA 5D3HA 5E7DA 4HBWA 4XUAA 5E9MA 4XY9A 5BT3A 4NR4A 4A9FA 2OSSA 5LJ1A 5FH7A 4YADA 2RS9B 5D24A 4WHUA 5KTXA 2R10A 3NXBA 5KO4A 5A85A 5EPBA 5EI4A 5FE4A 5ENCA 5DY7A 4IR6A 4YK0A 5G4SA 4TTEA 4TU4A 4MR4A 4BW3A 3DAIA 4A9JA 4TZ8A 4QSVA 4FLPA 4TT4A 4RVRA 4QYLA 3Q2EA 5EQ1A 5ETBA 4IOQA 4LDFA 4NS5A 5D25A 4PCIA 2L84A 2E7OA 5DBMA 3HMEA 4QSUA 3P5OA 5F36A 4Y03A 5IGMA 3K2JA 3UV4A 3UVDA 4Z6HA 5LVQA 2GRCA 3UVXA 4YYGA 3U5NA 4GPJA 3Q2FA 4NYVA 4YBSA 2RNWA 3U5KA 5E9VA 5EWDA 5FFVA 3SVFA 3O35A 3P1CA 5CPEA 5J0DA 5EK9A 4O7CA 2H60A 4NR7A 5HM0A 3S92A 5EPRA 5H1VA 5HQ5A 4NUEA 4LYSA 5E3GA 4NR8A 5IIDA 5IGLA 5TCMA 4HBVA 5ACYA 4A9LA 5H1TA 5CQTA 4HXSA 2L85A 4YH3A 3U5MA 4ALHA 5A5OA 4J1PA 4C66A 5BT5A 4LYWA 4TQNA 5LJ0A 4CFLA 4BW1A 5DYUA 4OUFA 5F25A 4A9EA 5TB6A 5FE7A 4O72A 5D7XA 4UIZA 3S91A 4WHWA 2DATA 4O7EA 5I1QA 4NRAA 5C87A 4Z6IA 3O36A 5E9LA 4N3WA 5EWCA 2RNXA 4QC1A 3U5OA 4ZQLA 3O33A 5CQ6A 4J3IA 4QSSA 5E9IA 2G4AA 3FKMX 4TZ2A 2KTBB 5A83A 5KTWA 5DYAA 4HXPA 3LXJA 4NR5A 4XUBA 3QZVA 3MULA 5CZGA 4CUQA 5LKZA 5DW2A 5HRWA 3G0JA 5AD3A 3RCWA 4PCEA 5I83A 4HXOA 5D3JA 5E9YA 5II1A 4DONA 5CTLA 5F61A 5F62A 4YABA 2YQDA 5KU3A 4QSXA 4YBTA 5HELA 4KV4A 4BW2A 5A5NA 4YAXA 4LZ2A 4Z1SA 4ALGA 4CUTA 5CGPA 4MR3A 5CS8A 5E3DA 5F5ZA 3UW9A 5EP7A 2F6NA 2WP2A 5FH8A 2F6JA 4AKNA 3IU5A 4KV1A 3P1FA 3D7CA 3MUKA 5CUDA 4QUUA 3JVJA 3AADA 5IGNA 2DKWA 5CY9A 5EU1A 4QSRA 5ENIA 5EM3A 3LQHA 4CL9A 2LSPB 4IOOA 5A5RA 4QBMA 5D3TA 4YYDA 5C89A 5HQ7A 3QZTA 5HJCA 4O76A 2E3KA 5H1UA 4O70A 4MEOA 5I86A 1ZS5A 5ENJA 2R0SA 3LJWA 4A9IA 2L5EA 3GG3A 4QY4A 4QEVA 5AMEA 4Z93A 1F68A 2R0VA 4Q0NA 4MEQA 4F3IA 4TU6A 4QR4A 5I88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YH4 A;  4NUC A;  5A5P A;  5CFW A;  5DW1 A;  4MR5 A;  3ZYU A;  4Q0O A;  4OGI A;  4YYN A;  2D9E A;  5F1L A;  5DKC A;  3UVW A;  4A9N A;  5L97 A;  1N72 A;  5FG4 A;  1JSP B;  5H85 A;  5FE6 A;  4A9H A;  2YW5 A;  3MB3 A;  5CP5 A;  1E6I A;  4OGJ A;  5HCL A;  4YAT A;  4O74 A;  4QNS A;  5ENG A;  5E9K A;  4QC3 A;  4YYK A;  5DYC A;  4E96 A;  4NUD A;  2YEK A;  3LQJ A;  4O75 A;  3QZS A;  3JVM A;  4BW4 A;  3UV5 A;  4QSQ A;  4O7F A;  5G4R A;  5FE8 A;  5IGK A;  2DVQ A;  4TS8 A;  3JVK A;  5IG6 A;  4QB3 A;  4UYF A;  4NQN A;  5CQ5 A;  2FSA A;  4A9M A;  5L99 A;  4UYD A;  3MXF A;  5EWV A;  4O77 A;  3P1D A;  4ZC9 A;  2WP1 A;  4CLB A;  4QEU A;  5A5S A;  4QR3 A;  5AD2 A;  4IOR A;  5KTU A;  5CUG A;  4TT2 A;  3U5P A;  5CQ4 A;  3O37 A;  2OO1 A;  3ONI A;  3HMF A;  5F63 A;  5C4Q A;  4C67 A;  5COI A;  5FE9 A;  5CU8 A;  5CQ7 A;  3G0L A;  4YBM A;  2E7N A;  4LRG A;  5ENB A;  4YYH A;  3JVL A;  4NRB A;  5DKD A;  5FG6 A;  5A82 A;  4UIW A;  5LKX A;  4LR6 A;  4NXJ A;  4XYA A;  4UYE A;  4XY8 A;  5DKH A;  5FBX A;  5CUE A;  2OUO A;  5DFB A;  5L98 A;  4N4G A;  4WIV A;  4ZW1 A;  5JI8 A;  5FE3 A;  4Z1Q A;  4HBX A;  5F3A A;  4QEW A;  5FE2 A;  3U5L A;  3AQA A;  5CRZ A;  5JWM A;  4J0R A;  2RI7 A;  5F60 A;  5HRX A;  4N4F A;  1X0J A;  5ENH A;  2I7K A;  4HXM A;  4IR5 A;  4O7B A;  5LKT A;  3U5J A;  5CUA A;  2NXB A;  5LJ2 A;  5DLZ A;  4YYI A;  4PS5 A;  2DVS A;  4UIT A;  4HXL A;  1WUG A;  4QR5 A;  5DX4 A;  5C8G A;  4YY4 A;  2YEM A;  4NR9 A;  5LUU A;  5C85 A;  4CFK A;  2DVV A;  5ENE A;  5CQA A;  2RNY A;  3HMH A;  5I89 A;  2RO1 A;  5DLX A;  5I7X A;  5EWH A;  5D26 A;  5HQ6 A;  4O71 A;  2MJV B;  4KCX A;  3UVY A;  4QYD A;  3UV2 A;  5HLS A;  5E73 A;  4PTB A;  3TLP A;  4X2I A;  4NYX A;  4HBY A;  5HEN A;  4UIX A;  4CUP A;  5HRV A;  5FE1 A;  5DFC A;  5HEM A;  5A5Q A;  5I29 A;  4HXK A;  3MQM A;  3IU6 A;  5FDZ A;  4N4I A;  2DVR A;  5CRM A;  4UYG A;  4IR3 A;  2N9G A;  4CUS A;  5DFD A;  5FH6 A;  4QSW A;  4MEN A;  4PKL A;  5EIC A;  4YC9 A;  4IR4 A;  2DWW A;  5D3R A;  3O34 A;  4UYF B;  5D3N A;  4CUR A;  2YYN A;  5FE0 A;  5E0R A;  5C7N A;  5DYX A;  2RFJ A;  5CUB A;  5FG5 A;  4YYM A;  5I80 A;  3SVH A;  5FB0 A;  4YY6 A;  4UIV A;  1JM4 B;  5EA1 A;  5EVA A;  3DWY A;  5EGU A;  3LQI A;  4NQM A;  5FB1 A;  4QUT A;  4NYW A;  4UIU A;  4LZR A;  4LYI A;  4TT6 A;  5EIS A;  5CUC A;  4BHW A;  3MB4 A;  4LC2 A;  4UYH A;  5II2 A;  4J0S A;  5A81 A;  4MEP A;  5EV9 A;  2R0Y A;  5I7Y A;  5EWW A;  2I8N A;  5D3L A;  5LVR A;  4MR6 A;  5LKU A;  4O78 A;  5EPS A;  4O7A A;  2YEL A;  4A9O A;  5L8U A;  4NR6 A;  5I40 A;  5FE5 A;  1EQF A;  5CQ8 A;  5L8T A;  5L96 A;  5AMF A;  1WUM A;  3SVG A;  5ETD A;  4YYJ A;  4UIY A;  4BJX A;  5E74 A;  3I3J A;  4N4H A;  4HXN A;  4TYL A;  5D0C A;  5BT4 A;  4LZS A;  5HFR A;  4HXR A;  5K29 A;  5D3P A;  5FFY A;  4QSP A;  5HFQ A;  5D3S A;  5F2P A;  4QST A;  2YDW A;  4CUU A;  5ENF A;  5CQ3 A;  4PY6 A;  5KHM A;  2D82 A;  4NRC A;  5A7C A;  3P1E A;  4A9K A;  4QZS A;  5F1H A;  5FFW A;  5IBN A;  5D3H A;  5E7D A;  4HBW A;  4XUA A;  5E9M A;  4XY9 A;  5BT3 A;  4NR4 A;  4A9F A;  2OSS A;  5LJ1 A;  5FH7 A;  4YAD A;  2RS9 B;  5D24 A;  4WHU A;  5KTX A;  2R10 A;  3NXB A;  5KO4 A;  5A85 A;  5EPB A;  5EI4 A;  5FE4 A;  5ENC A;  5DY7 A;  4IR6 A;  4YK0 A;  5G4S A;  4TTE A;  4TU4 A;  4MR4 A;  4BW3 A;  3DAI A;  4A9J A;  4TZ8 A;  4QSV A;  4FLP A;  4TT4 A;  4RVR A;  4QYL A;  3Q2E A;  5EQ1 A;  5ETB A;  4IOQ A;  4LDF A;  4NS5 A;  5D25 A;  4PCI A;  2L84 A;  2E7O A;  5DBM A;  3HME A;  4QSU A;  3P5O A;  5F36 A;  4Y03 A;  5IGM A;  3K2J A;  3UV4 A;  3UVD A;  4Z6H A;  5LVQ A;  2GRC A;  3UVX A;  4YYG A;  3U5N A;  4GPJ A;  3Q2F A;  4NYV A;  4YBS A;  2RNW A;  3U5K A;  5E9V A;  5EWD A;  5FFV A;  3SVF A;  3O35 A;  3P1C A;  5CPE A;  5J0D A;  5EK9 A;  4O7C A;  2H60 A;  4NR7 A;  5HM0 A;  3S92 A;  5EPR A;  5H1V A;  5HQ5 A;  4NUE A;  4LYS A;  5E3G A;  4NR8 A;  5IID A;  5IGL A;  5TCM A;  4HBV A;  5ACY A;  4A9L A;  5H1T A;  5CQT A;  4HXS A;  2L85 A;  4YH3 A;  3U5M A;  4ALH A;  5A5O A;  4J1P A;  4C66 A;  5BT5 A;  4LYW A;  4TQN A;  5LJ0 A;  4CFL A;  4BW1 A;  5DYU A;  4OUF A;  5F25 A;  4A9E A;  5TB6 A;  5FE7 A;  4O72 A;  5D7X A;  4UIZ A;  3S91 A;  4WHW A;  2DAT A;  4O7E A;  5I1Q A;  4NRA A;  5C87 A;  4Z6I A;  3O36 A;  5E9L A;  4N3W A;  5EWC A;  2RNX A;  4QC1 A;  3U5O A;  4ZQL A;  3O33 A;  5CQ6 A;  4J3I A;  4QSS A;  5E9I A;  2G4A A;  3FKM X;  4TZ2 A;  2KTB B;  5A83 A;  5KTW A;  5DYA A;  4HXP A;  3LXJ A;  4NR5 A;  4XUB A;  3QZV A;  3MUL A;  5CZG A;  4CUQ A;  5LKZ A;  5DW2 A;  5HRW A;  3G0J A;  5AD3 A;  3RCW A;  4PCE A;  5I83 A;  4HXO A;  5D3J A;  5E9Y A;  5II1 A;  4DON A;  5CTL A;  5F61 A;  5F62 A;  4YAB A;  2YQD A;  5KU3 A;  4QSX A;  4YBT A;  5HEL A;  4KV4 A;  4BW2 A;  5A5N A;  4YAX A;  4LZ2 A;  4Z1S A;  4ALG A;  4CUT A;  5CGP A;  4MR3 A;  5CS8 A;  5E3D A;  5F5Z A;  3UW9 A;  5EP7 A;  2F6N A;  2WP2 A;  5FH8 A;  2F6J A;  4AKN A;  3IU5 A;  4KV1 A;  3P1F A;  3D7C A;  3MUK A;  5CUD A;  4QUU A;  3JVJ A;  3AAD A;  5IGN A;  2DKW A;  5CY9 A;  5EU1 A;  4QSR A;  5ENI A;  5EM3 A;  3LQH A;  4CL9 A;  2LSP B;  4IOO A;  5A5R A;  4QBM A;  5D3T A;  4YYD A;  5C89 A;  5HQ7 A;  3QZT A;  5HJC A;  4O76 A;  2E3K A;  5H1U A;  4O70 A;  4MEO A;  5I86 A;  1ZS5 A;  5ENJ A;  2R0S A;  3LJW A;  4A9I A;  2L5E A;  3GG3 A;  4QY4 A;  4QEV A;  5AME A;  4Z93 A;  1F68 A;  2R0V A;  4Q0N A;  4MEQ A;  4F3I A;  4TU6 A;  4QR4 A;  5I88 A; 
#chains in the Genus database with same CATH topology
 4YH4 A;  4NUC A;  5A5P A;  5CFW A;  5DW1 A;  4MR5 A;  3ZYU A;  4Q0O A;  4OGI A;  4YYN A;  2D9E A;  5F1L A;  5DKC A;  3UVW A;  4A9N A;  5L97 A;  1N72 A;  5FG4 A;  1JSP B;  5H85 A;  5FE6 A;  4A9H A;  2YW5 A;  3MB3 A;  5CP5 A;  1E6I A;  4OGJ A;  5HCL A;  4YAT A;  4O74 A;  4QNS A;  5ENG A;  5E9K A;  4QC3 A;  4YYK A;  5DYC A;  4E96 A;  4NUD A;  2YEK A;  3LQJ A;  4O75 A;  3QZS A;  3JVM A;  4BW4 A;  3UV5 A;  4QSQ A;  4O7F A;  5G4R A;  5FE8 A;  5IGK A;  4AKH A;  2DVQ A;  4TS8 A;  3JVK A;  5IG6 A;  4AI6 A;  4QB3 A;  4UYF A;  4NQN A;  5CQ5 A;  2FSA A;  4A9M A;  5L99 A;  4UYD A;  3MXF A;  5EWV A;  4O77 A;  3P1D A;  4ZC9 A;  2WP1 A;  4CLB A;  4QEU A;  5A5S A;  4QR3 A;  5AD2 A;  4IOR A;  5KTU A;  5CUG A;  4TT2 A;  3U5P A;  5CQ4 A;  3O37 A;  2OO1 A;  3ONI A;  3HMF A;  5F63 A;  5C4Q A;  4C67 A;  5COI A;  5FE9 A;  5CU8 A;  5CQ7 A;  3G0L A;  4YBM A;  2E7N A;  4LRG A;  5ENB A;  4YYH A;  3JVL A;  4NRB A;  5DKD A;  5FG6 A;  5A82 A;  4UIW A;  5LKX A;  4LR6 A;  4NXJ A;  4XYA A;  4UYE A;  4XY8 A;  5DKH A;  5FBX A;  5CUE A;  2OUO A;  5DFB A;  5L98 A;  4N4G A;  4WIV A;  4ZW1 A;  5JI8 A;  5FE3 A;  4Z1Q A;  4HBX A;  5F3A A;  4QEW A;  5FE2 A;  3U5L A;  3AQA A;  5CRZ A;  5JWM A;  4J0R A;  2RI7 A;  5F60 A;  5HRX A;  4N4F A;  1X0J A;  5ENH A;  2I7K A;  4HXM A;  4IR5 A;  4O7B A;  5LKT A;  3U5J A;  5CUA A;  2NXB A;  5LJ2 A;  5DLZ A;  4YYI A;  4PS5 A;  2DVS A;  4UIT A;  4HXL A;  1WUG A;  4QR5 A;  5DX4 A;  5C8G A;  4YY4 A;  2YEM A;  4NR9 A;  5LUU A;  5C85 A;  4CFK A;  2DVV A;  5ENE A;  5CQA A;  2RNY A;  3HMH A;  5I89 A;  2RO1 A;  5DLX A;  5I7X A;  5EWH A;  5D26 A;  5HQ6 A;  4O71 A;  2MJV B;  4KCX A;  3UVY A;  4QYD A;  3UV2 A;  5HLS A;  5E73 A;  4PTB A;  3TLP A;  4X2I A;  4NYX A;  4HBY A;  5HEN A;  4UIX A;  4CUP A;  5HRV A;  5FE1 A;  5DFC A;  5HEM A;  5A5Q A;  5I29 A;  4HXK A;  3MQM A;  3IU6 A;  5FDZ A;  4N4I A;  2DVR A;  5CRM A;  4UYG A;  4IR3 A;  2N9G A;  3D1B A;  4CUS A;  5DFD A;  5FH6 A;  4QSW A;  4MEN A;  4PKL A;  5EIC A;  4YC9 A;  4IR4 A;  2DWW A;  5D3R A;  3O34 A;  4UYF B;  5D3N A;  4CUR A;  2YYN A;  5FE0 A;  5E0R A;  5C7N A;  5DYX A;  2RFJ A;  5CUB A;  5FG5 A;  4YYM A;  5I80 A;  3SVH A;  5FB0 A;  4YY6 A;  4UIV A;  1JM4 B;  5EA1 A;  5EVA A;  3DWY A;  5EGU A;  3LQI A;  4NQM A;  5FB1 A;  4QUT A;  4NYW A;  4UIU A;  4LZR A;  4LYI A;  4TT6 A;  5EIS A;  5CUC A;  4BHW A;  3MB4 A;  4LC2 A;  4UYH A;  2EJN A;  5II2 A;  4J0S A;  5A81 A;  4MEP A;  5EV9 A;  2R0Y A;  5I7Y A;  5EWW A;  2I8N A;  5D3L A;  5LVR A;  4MR6 A;  5LKU A;  4O78 A;  5EPS A;  4O7A A;  2YEL A;  4A9O A;  5L8U A;  4NR6 A;  5I40 A;  5FE5 A;  1EQF A;  5CQ8 A;  5L8T A;  5L96 A;  5AMF A;  1WUM A;  3SVG A;  5ETD A;  4YYJ A;  4UIY A;  4BJX A;  5E74 A;  1PUO A;  3I3J A;  4N4H A;  4HXN A;  4TYL A;  5D0C A;  5BT4 A;  4LZS A;  5HFR A;  4HXR A;  5K29 A;  5D3P A;  5FFY A;  4QSP A;  5HFQ A;  5D3S A;  5F2P A;  4QST A;  2YDW A;  4CUU A;  5ENF A;  5CQ3 A;  4PY6 A;  5KHM A;  2D82 A;  4NRC A;  5A7C A;  3P1E A;  4A9K A;  4QZS A;  5F1H A;  5FFW A;  5IBN A;  5D3H A;  5E7D A;  4HBW A;  4XUA A;  5E9M A;  4XY9 A;  5BT3 A;  4NR4 A;  4A9F A;  2OSS A;  5LJ1 A;  5FH7 A;  4YAD A;  2RS9 B;  5D24 A;  4WHU A;  5KTX A;  2R10 A;  3NXB A;  5KO4 A;  5A85 A;  5EPB A;  5EI4 A;  5FE4 A;  5ENC A;  5DY7 A;  4IR6 A;  4YK0 A;  5G4S A;  4TTE A;  4TU4 A;  4MR4 A;  4BW3 A;  3DAI A;  4A9J A;  4TZ8 A;  4QSV A;  4FLP A;  4TT4 A;  4RVR A;  4QYL A;  3Q2E A;  5EQ1 A;  5ETB A;  4IOQ A;  4LDF A;  4NS5 A;  5D25 A;  4PCI A;  2L84 A;  2E7O A;  3HME A;  5DBM A;  4QSU A;  3P5O A;  5F36 A;  4Y03 A;  5IGM A;  3K2J A;  3UV4 A;  3UVD A;  4Z6H A;  5LVQ A;  2GRC A;  3UVX A;  4YYG A;  3U5N A;  4GPJ A;  3Q2F A;  4NYV A;  4YBS A;  2RNW A;  3U5K A;  5E9V A;  5EWD A;  5FFV A;  3SVF A;  3O35 A;  3P1C A;  5CPE A;  5J0D A;  5EK9 A;  4O7C A;  2H60 A;  4NR7 A;  5HM0 A;  3S92 A;  5EPR A;  5H1V A;  5HQ5 A;  4NUE A;  3VKH A;  4LYS A;  5E3G A;  4NR8 A;  5IID A;  5IGL A;  1ZKR A;  5TCM A;  3VKG A;  4HBV A;  5ACY A;  4A9L A;  5H1T A;  5CQT A;  4HXS A;  2L85 A;  4YH3 A;  3U5M A;  4ALH A;  5A5O A;  4J1P A;  4C66 A;  5BT5 A;  4LYW A;  4AKG A;  4TQN A;  5LJ0 A;  4CFL A;  4BW1 A;  5DYU A;  4OUF A;  5F25 A;  4A9E A;  5TB6 A;  5FE7 A;  4O72 A;  5D7X A;  4UIZ A;  3S91 A;  4WHW A;  2DAT A;  4O7E A;  5I1Q A;  4NRA A;  5C87 A;  4Z6I A;  3O36 A;  5E9L A;  4N3W A;  5EWC A;  2RNX A;  4QC1 A;  3U5O A;  4ZQL A;  3O33 A;  5CQ6 A;  4J3I A;  4QSS A;  5E9I A;  3ERR A;  2G4A A;  3FKM X;  4TZ2 A;  2KTB B;  5A83 A;  5KTW A;  5DYA A;  4HXP A;  3LXJ A;  4NR5 A;  4XUB A;  3QZV A;  3MUL A;  5CZG A;  4CUQ A;  5LKZ A;  5DW2 A;  5HRW A;  3G0J A;  5AD3 A;  3RCW A;  4PCE A;  5I83 A;  4HXO A;  5D3J A;  5E9Y A;  5II1 A;  4DON A;  5CTL A;  5F61 A;  5F62 A;  4YAB A;  2YQD A;  5KU3 A;  4QSX A;  4YBT A;  5HEL A;  4KV4 A;  4BW2 A;  5A5N A;  4YAX A;  4LZ2 A;  4Z1S A;  4ALG A;  4CUT A;  5CGP A;  4MR3 A;  5CS8 A;  5E3D A;  5F5Z A;  3UW9 A;  5EP7 A;  2F6N A;  2WP2 A;  5FH8 A;  2F6J A;  4AKN A;  3IU5 A;  4KV1 A;  3P1F A;  3D7C A;  3MUK A;  5CUD A;  4QUU A;  3JVJ A;  3AAD A;  5IGN A;  2DKW A;  5CY9 A;  4AKI A;  5EU1 A;  4QSR A;  5ENI A;  5EM3 A;  3LQH A;  4CL9 A;  2LSP B;  4IOO A;  5A5R A;  4QBM A;  5D3T A;  4YYD A;  5C89 A;  5HQ7 A;  3QZT A;  5HJC A;  4O76 A;  2E3K A;  5H1U A;  4O70 A;  4MEO A;  5I86 A;  1ZS5 A;  5ENJ A;  2R0S A;  3D1D A;  3LJW A;  4A9I A;  2L5E A;  3GG3 A;  4QY4 A;  4QEV A;  5AME A;  4Z93 A;  1F68 A;  2R0V A;  4Q0N A;  4MEQ A;  4F3I A;  4TU6 A;  4QR4 A;  5I88 A; 
#chains in the Genus database with same CATH homology
 4YH4 A;  4NUC A;  5A5P A;  5CFW A;  5DW1 A;  4MR5 A;  3ZYU A;  4Q0O A;  4OGI A;  4YYN A;  2D9E A;  5F1L A;  5DKC A;  3UVW A;  4A9N A;  5L97 A;  1N72 A;  5FG4 A;  1JSP B;  5H85 A;  5FE6 A;  4A9H A;  2YW5 A;  3MB3 A;  5CP5 A;  1E6I A;  4OGJ A;  5HCL A;  4YAT A;  4O74 A;  4QNS A;  5ENG A;  5E9K A;  4QC3 A;  4YYK A;  5DYC A;  4E96 A;  4NUD A;  2YEK A;  3LQJ A;  4O75 A;  3QZS A;  3JVM A;  4BW4 A;  3UV5 A;  4QSQ A;  4O7F A;  5G4R A;  5FE8 A;  5IGK A;  2DVQ A;  4TS8 A;  3JVK A;  5IG6 A;  4QB3 A;  4UYF A;  4NQN A;  5CQ5 A;  2FSA A;  4A9M A;  5L99 A;  4UYD A;  3MXF A;  5EWV A;  4O77 A;  3P1D A;  4ZC9 A;  2WP1 A;  4CLB A;  4QEU A;  5A5S A;  4QR3 A;  5AD2 A;  4IOR A;  5KTU A;  5CUG A;  4TT2 A;  3U5P A;  5CQ4 A;  3O37 A;  2OO1 A;  3ONI A;  3HMF A;  5F63 A;  5C4Q A;  4C67 A;  5COI A;  5FE9 A;  5CU8 A;  5CQ7 A;  3G0L A;  4YBM A;  2E7N A;  4LRG A;  5ENB A;  4YYH A;  3JVL A;  4NRB A;  5DKD A;  5FG6 A;  5A82 A;  4UIW A;  5LKX A;  4LR6 A;  4NXJ A;  4XYA A;  4UYE A;  4XY8 A;  5DKH A;  5FBX A;  5CUE A;  2OUO A;  5DFB A;  5L98 A;  4N4G A;  4WIV A;  4ZW1 A;  5JI8 A;  5FE3 A;  4Z1Q A;  4HBX A;  5F3A A;  4QEW A;  5FE2 A;  3U5L A;  3AQA A;  5CRZ A;  5JWM A;  4J0R A;  2RI7 A;  5F60 A;  5HRX A;  4N4F A;  1X0J A;  5ENH A;  2I7K A;  4HXM A;  4IR5 A;  4O7B A;  5LKT A;  3U5J A;  5CUA A;  2NXB A;  5LJ2 A;  5DLZ A;  4YYI A;  4PS5 A;  2DVS A;  4UIT A;  4HXL A;  1WUG A;  4QR5 A;  5DX4 A;  5C8G A;  4YY4 A;  2YEM A;  4NR9 A;  5LUU A;  5C85 A;  4CFK A;  2DVV A;  5ENE A;  5CQA A;  2RNY A;  3HMH A;  5I89 A;  2RO1 A;  5DLX A;  5I7X A;  5EWH A;  5D26 A;  5HQ6 A;  4O71 A;  2MJV B;  4KCX A;  3UVY A;  4QYD A;  3UV2 A;  5HLS A;  5E73 A;  4PTB A;  3TLP A;  4X2I A;  4NYX A;  4HBY A;  5HEN A;  4UIX A;  4CUP A;  5HRV A;  5FE1 A;  5DFC A;  5HEM A;  5A5Q A;  5I29 A;  4HXK A;  3MQM A;  3IU6 A;  5FDZ A;  4N4I A;  2DVR A;  5CRM A;  4UYG A;  4IR3 A;  2N9G A;  4CUS A;  5DFD A;  5FH6 A;  4QSW A;  4MEN A;  4PKL A;  5EIC A;  4YC9 A;  4IR4 A;  2DWW A;  5D3R A;  3O34 A;  4UYF B;  5D3N A;  4CUR A;  2YYN A;  5FE0 A;  5E0R A;  5C7N A;  5DYX A;  2RFJ A;  5CUB A;  5FG5 A;  4YYM A;  5I80 A;  3SVH A;  5FB0 A;  4YY6 A;  4UIV A;  1JM4 B;  5EA1 A;  5EVA A;  3DWY A;  5EGU A;  3LQI A;  4NQM A;  5FB1 A;  4QUT A;  4NYW A;  4UIU A;  4LZR A;  4LYI A;  4TT6 A;  5EIS A;  5CUC A;  4BHW A;  3MB4 A;  4LC2 A;  4UYH A;  5II2 A;  4J0S A;  5A81 A;  4MEP A;  5EV9 A;  2R0Y A;  5I7Y A;  5EWW A;  2I8N A;  5D3L A;  5LVR A;  4MR6 A;  5LKU A;  4O78 A;  5EPS A;  4O7A A;  2YEL A;  4A9O A;  5L8U A;  4NR6 A;  5I40 A;  5FE5 A;  1EQF A;  5CQ8 A;  5L8T A;  5L96 A;  5AMF A;  1WUM A;  3SVG A;  5ETD A;  4YYJ A;  4UIY A;  4BJX A;  5E74 A;  3I3J A;  4N4H A;  4HXN A;  4TYL A;  5D0C A;  5BT4 A;  4LZS A;  5HFR A;  4HXR A;  5K29 A;  5D3P A;  5FFY A;  4QSP A;  5HFQ A;  5D3S A;  5F2P A;  4QST A;  2YDW A;  4CUU A;  5ENF A;  5CQ3 A;  4PY6 A;  5KHM A;  2D82 A;  4NRC A;  5A7C A;  3P1E A;  4A9K A;  4QZS A;  5F1H A;  5FFW A;  5IBN A;  5D3H A;  5E7D A;  4HBW A;  4XUA A;  5E9M A;  4XY9 A;  5BT3 A;  4NR4 A;  4A9F A;  2OSS A;  5LJ1 A;  5FH7 A;  4YAD A;  2RS9 B;  5D24 A;  4WHU A;  5KTX A;  2R10 A;  3NXB A;  5KO4 A;  5A85 A;  5EPB A;  5EI4 A;  5FE4 A;  5ENC A;  5DY7 A;  4IR6 A;  4YK0 A;  5G4S A;  4TTE A;  4TU4 A;  4MR4 A;  4BW3 A;  3DAI A;  4A9J A;  4TZ8 A;  4QSV A;  4FLP A;  4TT4 A;  4RVR A;  4QYL A;  3Q2E A;  5EQ1 A;  5ETB A;  4IOQ A;  4LDF A;  4NS5 A;  5D25 A;  4PCI A;  2L84 A;  2E7O A;  5DBM A;  3HME A;  4QSU A;  3P5O A;  5F36 A;  4Y03 A;  5IGM A;  3K2J A;  3UV4 A;  3UVD A;  4Z6H A;  5LVQ A;  2GRC A;  3UVX A;  4YYG A;  3U5N A;  4GPJ A;  3Q2F A;  4NYV A;  4YBS A;  2RNW A;  3U5K A;  5E9V A;  5EWD A;  5FFV A;  3SVF A;  3O35 A;  3P1C A;  5CPE A;  5J0D A;  5EK9 A;  4O7C A;  2H60 A;  4NR7 A;  5HM0 A;  3S92 A;  5EPR A;  5H1V A;  5HQ5 A;  4NUE A;  4LYS A;  5E3G A;  4NR8 A;  5IID A;  5IGL A;  5TCM A;  4HBV A;  5ACY A;  4A9L A;  5H1T A;  5CQT A;  4HXS A;  2L85 A;  4YH3 A;  3U5M A;  4ALH A;  5A5O A;  4J1P A;  4C66 A;  5BT5 A;  4LYW A;  4TQN A;  5LJ0 A;  4CFL A;  4BW1 A;  5DYU A;  4OUF A;  5F25 A;  4A9E A;  5TB6 A;  5FE7 A;  4O72 A;  5D7X A;  4UIZ A;  3S91 A;  4WHW A;  2DAT A;  4O7E A;  5I1Q A;  4NRA A;  5C87 A;  4Z6I A;  3O36 A;  5E9L A;  4N3W A;  5EWC A;  2RNX A;  4QC1 A;  3U5O A;  4ZQL A;  3O33 A;  5CQ6 A;  4J3I A;  4QSS A;  5E9I A;  2G4A A;  3FKM X;  4TZ2 A;  2KTB B;  5A83 A;  5KTW A;  5DYA A;  4HXP A;  3LXJ A;  4NR5 A;  4XUB A;  3QZV A;  3MUL A;  5CZG A;  4CUQ A;  5LKZ A;  5DW2 A;  5HRW A;  3G0J A;  5AD3 A;  3RCW A;  4PCE A;  5I83 A;  4HXO A;  5D3J A;  5E9Y A;  5II1 A;  4DON A;  5CTL A;  5F61 A;  5F62 A;  4YAB A;  2YQD A;  5KU3 A;  4QSX A;  4YBT A;  5HEL A;  4KV4 A;  4BW2 A;  5A5N A;  4YAX A;  4LZ2 A;  4Z1S A;  4ALG A;  4CUT A;  5CGP A;  4MR3 A;  5CS8 A;  5E3D A;  5F5Z A;  3UW9 A;  5EP7 A;  2F6N A;  2WP2 A;  5FH8 A;  2F6J A;  4AKN A;  3IU5 A;  4KV1 A;  3P1F A;  3D7C A;  3MUK A;  5CUD A;  4QUU A;  3JVJ A;  3AAD A;  5IGN A;  2DKW A;  5CY9 A;  5EU1 A;  4QSR A;  5ENI A;  5EM3 A;  3LQH A;  4CL9 A;  2LSP B;  4IOO A;  5A5R A;  4QBM A;  5D3T A;  4YYD A;  5C89 A;  5HQ7 A;  3QZT A;  5HJC A;  4O76 A;  2E3K A;  5H1U A;  4O70 A;  4MEO A;  5I86 A;  1ZS5 A;  5ENJ A;  2R0S A;  3LJW A;  4A9I A;  2L5E A;  3GG3 A;  4QY4 A;  4QEV A;  5AME A;  4Z93 A;  1F68 A;  2R0V A;  4Q0N A;  4MEQ A;  4F3I A;  4TU6 A;  4QR4 A;  5I88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...