4YY6A

Crystal structure of brd9 bromodomain bound to a butyryllysine peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
102
structure length
102
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 9
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 36
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yy6A00
5DW2A 2YELA 3LQHA 1WUGA 3TLPA 3SVGA 4XYAA 4QNSA 5A5PA 4HXMA 4FLPA 5FH6A 2FSAA 4UIUA 4UIWA 5LVQA 5LJ1A 3LQIA 4O7EA 2DWWA 5KTWA 5CQ4A 5A5RA 4MEPA 5LKUA 3ZYUA 4O77A 4PCIA 4QSWA 4IR6A 4E96A 4IR4A 4LZ2A 2DVSA 4YYIA 5E7DA 4ALHA 4YADA 4QYDA 4ZW1A 5EK9A 2E7OA 3O35A 5CFWA 4QZSA 3UW9A 4TT2A 4OGJA 4TS8A 3DAIA 5DKCA 4N4IA 4BJXA 4QEWA 5EICA 3QZTA 3NXBA 4LDFA 5KTUA 2DVQA 2R10A 4TU6A 5II1A 3G0LA 2GRCA 5IGNA 5KHMA 4A9LA 4O75A 4QSVA 5CGPA 5KTXA 4TT6A 5F1LA 3U5MA 4QYLA 4Z6IA 5C8GA 4KCXA 5HEMA 4QSPA 4HBVA 4QUUA 5D3SA 4UYFB 5DYXA 4BHWA 4NYWA 2RNYA 3UV4A 5D25A 5DYCA 5I80A 4CFLA 4UIVA 4YYDA 4HXPA 5EU1A 5TCMA 4IOQA 5ENGA 5HFQA 3LXJA 5E9MA 5C4QA 4DONA 3GG3A 5LVRA 2YEKA 4F3IA 3D7CA 4A9EA 5FE6A 4Z6HA 2E7NA 5CQTA 4Q0NA 2R0VA 4HXNA 5DX4A 5FE8A 4BW1A 2I8NA 3P1EA 4QEVA 1WUMA 4HBWA 4XY8A 5FG5A 4YBSA 5C89A 2RNXA 1E6IA 3JVKA 5EPRA 5EWWA 4YY4A 5FDZA 4IORA 3AQAA 5IBNA 5C85A 4UYHA 4YAXA 4N4GA 5DYAA 4BW4A 4QEUA 4LRGA 4QSSA 4PTBA 3K2JA 2L84A 4PKLA 4PY6A 5DFCA 5D3LA 5E9VA 4TZ2A 5FE5A 3IU5A 4ZQLA 4LC2A 5EPSA 5I7XA 3RCWA 3JVMA 4LR6A 5LKXA 5L99A 5FG4A 5CUDA 3P5OA 5E9IA 4YH3A 4CL9A 4O74A 5EP7A 3MB4A 2RI7A 5F2PA 2DVVA 2F6JA 4N4HA 4ZC9A 4CUUA 5CUCA 4MEQA 4BW3A 5FH7A 4YBTA 1JM4B 3UVWA 4O70A 5H1VA 5DLXA 3O33A 5I86A 5EGUA 5E0RA 3SVFA 4A9KA 4LZRA 2KTBB 4PCEA 5LKTA 5D3HA 5A5SA 4HXOA 2DATA 4LZSA 5CRMA 4UIYA 4NR5A 5DFBA 1ZS5A 4KV4A 5FE3A 4MR3A 5CQAA 4LYSA 5IGMA 4NRBA 4NR6A 5FB0A 5HFRA 5E9YA 4YYNA 4A9HA 4HXKA 4XY9A 2RS9B 5BT5A 4KV1A 4O72A 5CUAA 4J1PA 4UYFA 4CUPA 2I7KA 3MB3A 4LYWA 5EPBA 5I29A 4NQNA 5I88A 5BT3A 4QR3A 5HRXA 5KO4A 4TYLA 4A9IA 4NYVA 4OGIA 5AMFA 4AKNA 5A83A 4CUQA 5F61A 5EWVA 4XUBA 4TZ8A 4QR5A 4CUTA 4IOOA 5DFDA 5FE7A 2L85A 3JVLA 5E3DA 4QSUA 5G4RA 4YYGA 5I1QA 2LSPB 5IIDA 3Q2FA 4PS5A 3HMHA 5LUUA 2WP2A 4HXLA 2D82A 3U5KA 5D7XA 5ACYA 4NR8A 4YABA 5ENIA 2YDWA 4A9OA 3SVHA 5H85A 4UYDA 2DVRA 5E3GA 4IR3A 5HQ5A 5I40A 5FE1A 5D0CA 5CUBA 5A82A 3G0JA 5H1TA 5JWMA 5II2A 5CQ8A 4MR4A 5CPEA 4C67A 5D3TA 4TTEA 4YC9A 5CS8A 5I89A 5I83A 5CQ7A 2YYNA 4RVRA 2R0SA 4UITA 5EA1A 4QUTA 3S92A 5FG6A 5AD2A 5HQ7A 4YYKA 4TT4A 5LJ2A 5ENJA 5CY9A 2G4AA 5HELA 5C7NA 4YK0A 5EWDA 4O76A 4QSTA 3MXFA 4C66A 4HBYA 5ENCA 4J0RA 3U5OA 3O34A 3U5LA 4J3IA 3UVYA 2OO1A 1EQFA 4Y03A 1X0JA 4O7CA 3I3JA 4MR5A 5D26A 4ALGA 5L98A 3QZVA 5DKDA 2F6NA 4NUCA 4A9JA 4XUAA 4HBXA 4TU4A 4Z93A 5ENBA 4YBMA 4A9MA 3S91A 5ETBA 2L5EA 3AADA 5H1UA 2D9EA 5HLSA 5EISA 3JVJA 3MULA 5K29A 5CUGA 5F60A 5HQ6A 3O36A 5F62A 5E9LA 5CZGA 4IR5A 4NQMA 3UVXA 5CTLA 5FFVA 4YYHA 4WIVA 5CQ6A 1JSPB 4UYEA 4NR4A 2RNWA 4NYXA 5CP5A 4QR4A 4Z1QA 5IGLA 3HMFA 5LKZA 4CUSA 5A7CA 4BW2A 4HXRA 5HENA 5FE9A 3DWYA 4NS5A 4O7FA 5ENHA 5A85A 5DLZA 3P1DA 5G4SA 4X2IA 4Q0OA 4NRCA 5EQ1A 4QB3A 3UV5A 4NRAA 3MUKA 4O7BA 5DY7A 4O7AA 5F36A 5E9KA 2YQDA 5EV9A 5LJ0A 5A5QA 4OUFA 5FE4A 5FH8A 5CQ5A 4QSRA 4CLBA 5I7YA 5CRZA 5FFYA 1N72A 5EWHA 5IGKA 5TB6A 4LYIA 2OSSA 4QC1A 5D24A 3P1FA 5EI4A 5FB1A 5A5OA 5D3NA 4QSQA 4QC3A 2R0YA 3HMEA 4MR6A 4N4FA 5BT4A 2DKWA 2YEMA 2NXBA 5FE2A 4NR9A 5CU8A 5ENFA 4WHUA 4YY6A 2RO1A 5HM0A 4UYGA 4A9FA 4WHWA 5F1HA 5EVAA 4NUEA 3QZSA 3UV2A 3FKMX 4YH4A 5D3JA 5C87A 2N9GA 5J0DA 4NUDA 5F63A 4O71A 5EM3A 5AMEA 4HXSA 4CFKA 5FE0A 4YYJA 5A5NA 5COIA 3IU6A 3P1CA 5F3AA 5HCLA 5JI8A 4YATA 5L97A 3ONIA 5D3RA 5L8UA 4YYMA 5E74A 3U5PA 3MQMA 4CURA 5AD3A 4UIXA 5D3PA 5IG6A 4NXJA 3Q2EA 2RFJA 4A9NA 5HJCA 2MJVB 5DBMA 4MENA 2E3KA 4Z1SA 4QY4A 5HRVA 5L8TA 4J0SA 5F5ZA 3U5JA 3LQJA 4N3WA 5CUEA 5HRWA 1F68A 4O78A 3LJWA 5DW1A 5F25A 4GPJA 3UVDA 5CQ3A 2YW5A 5KU3A 4TQNA 4NR7A 2OUOA 4MEOA 5E73A 5FFWA 5EWCA 5FBXA 4QSXA 2H60A 5ETDA 3O37A 5A81A 5L96A 4QBMA 3U5NA 2WP1A 5ENEA 5DYUA 5DKHA 4UIZA
chains in the Genus database with same CATH superfamily
5DW2A 2YELA 3LQHA 1WUGA 3TLPA 3SVGA 4XYAA 4QNSA 5A5PA 4HXMA 4FLPA 5FH6A 2FSAA 4UIUA 4UIWA 5LVQA 5LJ1A 3LQIA 4O7EA 1ZKRA 2DWWA 5KTWA 5CQ4A 5A5RA 4MEPA 5LKUA 3ZYUA 4O77A 4PCIA 4QSWA 4IR6A 4E96A 4IR4A 4LZ2A 2DVSA 4YYIA 5E7DA 4ALHA 4YADA 4QYDA 4ZW1A 5EK9A 2E7OA 3O35A 5CFWA 4QZSA 3UW9A 4TT2A 4OGJA 4TS8A 3DAIA 5DKCA 4N4IA 4BJXA 4QEWA 5EICA 3QZTA 3NXBA 4AKGA 4LDFA 5KTUA 2DVQA 2R10A 4TU6A 5II1A 3G0LA 2GRCA 5IGNA 5KHMA 4A9LA 4O75A 4QSVA 5CGPA 5KTXA 4TT6A 5F1LA 3U5MA 4QYLA 4Z6IA 5C8GA 4KCXA 5HEMA 4QSPA 4HBVA 4QUUA 5D3SA 4UYFB 5DYXA 4BHWA 4NYWA 2RNYA 4AKHA 3UV4A 5D25A 5DYCA 5I80A 4CFLA 4UIVA 4YYDA 4HXPA 5EU1A 5TCMA 4IOQA 5ENGA 5HFQA 3LXJA 4AKIA 5E9MA 5C4QA 4DONA 3GG3A 1PUOA 2YEKA 4F3IA 3D7CA 5LVRA 4A9EA 5FE6A 4Z6HA 2E7NA 5CQTA 4Q0NA 2R0VA 4HXNA 5DX4A 5FE8A 4BW1A 2I8NA 3P1EA 4QEVA 1WUMA 4HBWA 4XY8A 5FG5A 4YBSA 5C89A 2RNXA 1E6IA 3JVKA 5EPRA 5EWWA 4YY4A 5FDZA 4IORA 3AQAA 5IBNA 5C85A 4UYHA 4YAXA 4N4GA 5DYAA 4BW4A 4QEUA 4LRGA 4QSSA 4PTBA 3K2JA 3ERRA 2L84A 4PKLA 4PY6A 5DFCA 5D3LA 5E9VA 4TZ2A 5FE5A 3IU5A 4ZQLA 4LC2A 5EPSA 5I7XA 3RCWA 3D1BA 3JVMA 4LR6A 5LKXA 5L99A 5FG4A 5CUDA 3P5OA 5E9IA 4YH3A 4CL9A 4O74A 5EP7A 3MB4A 2RI7A 5F2PA 2EJNA 2DVVA 2F6JA 4N4HA 4ZC9A 4CUUA 5CUCA 4MEQA 4BW3A 5FH7A 4YBTA 1JM4B 3UVWA 4O70A 5H1VA 5DLXA 3O33A 5I86A 5EGUA 5E0RA 3VKHA 3SVFA 4A9KA 4LZRA 2KTBB 4PCEA 5LKTA 5D3HA 5A5SA 4HXOA 2DATA 4LZSA 5CRMA 4UIYA 4NR5A 5DFBA 1ZS5A 4KV4A 5FE3A 4MR3A 5CQAA 4LYSA 5IGMA 4NRBA 4NR6A 5FB0A 5HFRA 5E9YA 4YYNA 4A9HA 4HXKA 4XY9A 2RS9B 5BT5A 4KV1A 4O72A 5CUAA 4J1PA 4UYFA 4CUPA 2I7KA 3MB3A 4LYWA 5EPBA 5I29A 4NQNA 5I88A 5BT3A 4QR3A 5HRXA 5KO4A 4TYLA 4A9IA 4NYVA 4OGIA 5AMFA 4AKNA 5A83A 4CUQA 5F61A 5EWVA 4XUBA 4TZ8A 4QR5A 4CUTA 4IOOA 5DFDA 5FE7A 2L85A 3JVLA 5E3DA 4QSUA 5G4RA 4YYGA 5I1QA 2LSPB 5IIDA 3Q2FA 4PS5A 3HMHA 5LUUA 2WP2A 4HXLA 2D82A 3U5KA 5D7XA 5ACYA 4NR8A 4YABA 5ENIA 2YDWA 4A9OA 3SVHA 5H85A 4UYDA 4AI6A 2DVRA 5E3GA 4IR3A 5HQ5A 5I40A 5FE1A 5D0CA 5CUBA 5A82A 3G0JA 5H1TA 5JWMA 5II2A 5CQ8A 4MR4A 5CPEA 4C67A 5D3TA 4TTEA 4YC9A 5CS8A 5I89A 5I83A 5CQ7A 2YYNA 4RVRA 2R0SA 4UITA 5EA1A 4QUTA 3S92A 5FG6A 5AD2A 5HQ7A 4YYKA 4TT4A 5LJ2A 5ENJA 5CY9A 2G4AA 5HELA 5C7NA 4YK0A 5EWDA 4O76A 4QSTA 3MXFA 4C66A 4HBYA 5ENCA 4J0RA 3U5OA 3O34A 3U5LA 4J3IA 3UVYA 2OO1A 1EQFA 4Y03A 1X0JA 4O7CA 3I3JA 4MR5A 5D26A 4ALGA 5L98A 3QZVA 5DKDA 2F6NA 4NUCA 4A9JA 4XUAA 4HBXA 4TU4A 4Z93A 5ENBA 4YBMA 4A9MA 3S91A 5ETBA 2L5EA 3AADA 5H1UA 2D9EA 5HLSA 5EISA 3JVJA 3MULA 5K29A 5CUGA 5F60A 5HQ6A 3O36A 5F62A 5E9LA 5CZGA 4IR5A 4NQMA 3VKGA 3UVXA 5CTLA 5FFVA 4YYHA 4WIVA 5CQ6A 1JSPB 4UYEA 4NR4A 2RNWA 4NYXA 5CP5A 4QR4A 4Z1QA 5IGLA 3HMFA 5LKZA 4CUSA 5A7CA 4BW2A 4HXRA 5HENA 5FE9A 3DWYA 4NS5A 4O7FA 5ENHA 5A85A 5DLZA 3P1DA 5G4SA 4X2IA 4Q0OA 4NRCA 5EQ1A 4QB3A 3UV5A 4NRAA 3MUKA 4O7BA 5DY7A 4O7AA 5F36A 5E9KA 2YQDA 5EV9A 5LJ0A 5A5QA 4OUFA 5FE4A 5FH8A 5CQ5A 4QSRA 4CLBA 5I7YA 5CRZA 5FFYA 1N72A 5EWHA 5IGKA 5TB6A 4LYIA 2OSSA 4QC1A 5D24A 3P1FA 5EI4A 5FB1A 5A5OA 5D3NA 4QSQA 4QC3A 2R0YA 3HMEA 4MR6A 4N4FA 5BT4A 2DKWA 2YEMA 2NXBA 5FE2A 4NR9A 5CU8A 5ENFA 4WHUA 4YY6A 2RO1A 5HM0A 4UYGA 4A9FA 4WHWA 5F1HA 5EVAA 4NUEA 3QZSA 3UV2A 3FKMX 4YH4A 5D3JA 5C87A 2N9GA 5J0DA 4NUDA 5F63A 4O71A 5EM3A 5AMEA 4HXSA 4CFKA 5FE0A 4YYJA 5A5NA 5COIA 3IU6A 3P1CA 5F3AA 5HCLA 5JI8A 4YATA 5L97A 3ONIA 5D3RA 5L8UA 4YYMA 5E74A 3U5PA 3MQMA 4CURA 5AD3A 4UIXA 5D3PA 5IG6A 4NXJA 3Q2EA 2RFJA 4A9NA 5HJCA 3D1DA 2MJVB 5DBMA 4MENA 2E3KA 4Z1SA 4QY4A 5HRVA 5L8TA 4J0SA 5F5ZA 3U5JA 3LQJA 4N3WA 5CUEA 5HRWA 1F68A 4O78A 3LJWA 5DW1A 5F25A 4GPJA 3UVDA 5CQ3A 2YW5A 5KU3A 4TQNA 4NR7A 2OUOA 4MEOA 5E73A 5FFWA 5EWCA 5FBXA 4QSXA 2H60A 5ETDA 3O37A 5A81A 5L96A 4QBMA 3U5NA 2WP1A 5ENEA 5DYUA 5DKHA 4UIZA
chains in the Genus database with same CATH topology
5DW2A 2YELA 3LQHA 1WUGA 3TLPA 3SVGA 4XYAA 4QNSA 5A5PA 4HXMA 4FLPA 5FH6A 2FSAA 4UIUA 4UIWA 5LVQA 5LJ1A 3LQIA 4O7EA 2DWWA 5KTWA 5CQ4A 5A5RA 4MEPA 5LKUA 3ZYUA 4O77A 4PCIA 4QSWA 4IR6A 4E96A 4IR4A 4LZ2A 2DVSA 4YYIA 5E7DA 4ALHA 4YADA 4QYDA 4ZW1A 5EK9A 2E7OA 3O35A 5CFWA 4QZSA 3UW9A 4TT2A 4OGJA 4TS8A 3DAIA 5DKCA 4N4IA 4BJXA 4QEWA 5EICA 3QZTA 3NXBA 4LDFA 5KTUA 2DVQA 2R10A 4TU6A 5II1A 3G0LA 2GRCA 5IGNA 5KHMA 4A9LA 4O75A 4QSVA 5CGPA 5KTXA 4TT6A 5F1LA 3U5MA 4QYLA 4Z6IA 5C8GA 4KCXA 5HEMA 4QSPA 4HBVA 4QUUA 5D3SA 4UYFB 5DYXA 4BHWA 4NYWA 2RNYA 3UV4A 5D25A 5DYCA 5I80A 4CFLA 4UIVA 4YYDA 4HXPA 5EU1A 5TCMA 4IOQA 5ENGA 5HFQA 3LXJA 5E9MA 5C4QA 4DONA 3GG3A 5LVRA 2YEKA 4F3IA 3D7CA 4A9EA 5FE6A 4Z6HA 2E7NA 5CQTA 4Q0NA 2R0VA 4HXNA 5DX4A 5FE8A 4BW1A 2I8NA 3P1EA 4QEVA 1WUMA 4HBWA 4XY8A 5FG5A 4YBSA 5C89A 2RNXA 1E6IA 3JVKA 5EPRA 5EWWA 4YY4A 5FDZA 4IORA 3AQAA 5IBNA 5C85A 4UYHA 4YAXA 4N4GA 5DYAA 4BW4A 4QEUA 4LRGA 4QSSA 4PTBA 3K2JA 2L84A 4PKLA 4PY6A 5DFCA 5D3LA 5E9VA 4TZ2A 5FE5A 3IU5A 4ZQLA 4LC2A 5EPSA 5I7XA 3RCWA 3JVMA 4LR6A 5LKXA 5L99A 5FG4A 5CUDA 3P5OA 5E9IA 4YH3A 4CL9A 4O74A 5EP7A 3MB4A 2RI7A 5F2PA 2DVVA 2F6JA 4N4HA 4ZC9A 4CUUA 5CUCA 4MEQA 4BW3A 5FH7A 4YBTA 1JM4B 3UVWA 4O70A 5H1VA 5DLXA 3O33A 5I86A 5EGUA 5E0RA 3SVFA 4A9KA 4LZRA 2KTBB 4PCEA 5LKTA 5D3HA 5A5SA 4HXOA 2DATA 4LZSA 5CRMA 4UIYA 4NR5A 5DFBA 1ZS5A 4KV4A 5FE3A 4MR3A 5CQAA 4LYSA 5IGMA 4NRBA 4NR6A 5FB0A 5HFRA 5E9YA 4YYNA 4A9HA 4HXKA 4XY9A 2RS9B 5BT5A 4KV1A 4O72A 5CUAA 4J1PA 4UYFA 4CUPA 2I7KA 3MB3A 4LYWA 5EPBA 5I29A 4NQNA 5I88A 5BT3A 4QR3A 5HRXA 5KO4A 4TYLA 4A9IA 4NYVA 4OGIA 5AMFA 4AKNA 5A83A 4CUQA 5F61A 5EWVA 4XUBA 4TZ8A 4QR5A 4CUTA 4IOOA 5DFDA 5FE7A 2L85A 3JVLA 5E3DA 4QSUA 5G4RA 4YYGA 5I1QA 2LSPB 5IIDA 3Q2FA 4PS5A 3HMHA 5LUUA 2WP2A 4HXLA 2D82A 3U5KA 5D7XA 5ACYA 4NR8A 4YABA 5ENIA 2YDWA 4A9OA 3SVHA 5H85A 4UYDA 2DVRA 5E3GA 4IR3A 5HQ5A 5I40A 5FE1A 5D0CA 5CUBA 5A82A 3G0JA 5H1TA 5JWMA 5II2A 5CQ8A 4MR4A 5CPEA 4C67A 5D3TA 4TTEA 4YC9A 5CS8A 5I89A 5I83A 5CQ7A 2YYNA 4RVRA 2R0SA 4UITA 5EA1A 4QUTA 3S92A 5FG6A 5AD2A 5HQ7A 4YYKA 4TT4A 5LJ2A 5ENJA 5CY9A 2G4AA 5HELA 5C7NA 4YK0A 5EWDA 4O76A 4QSTA 3MXFA 4C66A 4HBYA 5ENCA 4J0RA 3U5OA 3O34A 3U5LA 4J3IA 3UVYA 2OO1A 1EQFA 4Y03A 1X0JA 4O7CA 3I3JA 4MR5A 5D26A 4ALGA 5L98A 3QZVA 5DKDA 2F6NA 4NUCA 4A9JA 4XUAA 4HBXA 4TU4A 4Z93A 5ENBA 4YBMA 4A9MA 3S91A 5ETBA 2L5EA 3AADA 5H1UA 2D9EA 5HLSA 5EISA 3JVJA 3MULA 5K29A 5CUGA 5F60A 5HQ6A 3O36A 5F62A 5E9LA 5CZGA 4IR5A 4NQMA 3UVXA 5CTLA 5FFVA 4YYHA 4WIVA 5CQ6A 1JSPB 4UYEA 4NR4A 2RNWA 4NYXA 5CP5A 4QR4A 4Z1QA 5IGLA 3HMFA 5LKZA 4CUSA 5A7CA 4BW2A 4HXRA 5HENA 5FE9A 3DWYA 4NS5A 4O7FA 5ENHA 5A85A 5DLZA 3P1DA 5G4SA 4X2IA 4Q0OA 4NRCA 5EQ1A 4QB3A 3UV5A 4NRAA 3MUKA 4O7BA 5DY7A 4O7AA 5F36A 5E9KA 2YQDA 5EV9A 5LJ0A 5A5QA 4OUFA 5FE4A 5FH8A 5CQ5A 4QSRA 4CLBA 5I7YA 5CRZA 5FFYA 1N72A 5EWHA 5IGKA 5TB6A 4LYIA 2OSSA 4QC1A 5D24A 3P1FA 5EI4A 5FB1A 5A5OA 5D3NA 4QSQA 4QC3A 2R0YA 3HMEA 4MR6A 4N4FA 5BT4A 2DKWA 2YEMA 2NXBA 5FE2A 4NR9A 5CU8A 5ENFA 4WHUA 4YY6A 2RO1A 5HM0A 4UYGA 4A9FA 4WHWA 5F1HA 5EVAA 4NUEA 3QZSA 3UV2A 3FKMX 4YH4A 5D3JA 5C87A 2N9GA 5J0DA 4NUDA 5F63A 4O71A 5EM3A 5AMEA 4HXSA 4CFKA 5FE0A 4YYJA 5A5NA 5COIA 3IU6A 3P1CA 5F3AA 5HCLA 5JI8A 4YATA 5L97A 3ONIA 5D3RA 5L8UA 4YYMA 5E74A 3U5PA 3MQMA 4CURA 5AD3A 4UIXA 5D3PA 5IG6A 4NXJA 3Q2EA 2RFJA 4A9NA 5HJCA 2MJVB 5DBMA 4MENA 2E3KA 4Z1SA 4QY4A 5HRVA 5L8TA 4J0SA 5F5ZA 3U5JA 3LQJA 4N3WA 5CUEA 5HRWA 1F68A 4O78A 3LJWA 5DW1A 5F25A 4GPJA 3UVDA 5CQ3A 2YW5A 5KU3A 4TQNA 4NR7A 2OUOA 4MEOA 5E73A 5FFWA 5EWCA 5FBXA 4QSXA 2H60A 5ETDA 3O37A 5A81A 5L96A 4QBMA 3U5NA 2WP1A 5ENEA 5DYUA 5DKHA 4UIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DW2 A;  2YEL A;  3LQH A;  1WUG A;  3TLP A;  3SVG A;  4XYA A;  4QNS A;  5A5P A;  4HXM A;  4FLP A;  5FH6 A;  2FSA A;  4UIU A;  4UIW A;  5LVQ A;  5LJ1 A;  3LQI A;  4O7E A;  2DWW A;  5KTW A;  5CQ4 A;  5A5R A;  4MEP A;  5LKU A;  3ZYU A;  4O77 A;  4PCI A;  4QSW A;  4IR6 A;  4E96 A;  4IR4 A;  4LZ2 A;  2DVS A;  4YYI A;  5E7D A;  4ALH A;  4YAD A;  4QYD A;  4ZW1 A;  5EK9 A;  2E7O A;  3O35 A;  5CFW A;  4QZS A;  3UW9 A;  4TT2 A;  4OGJ A;  4TS8 A;  3DAI A;  5DKC A;  4N4I A;  4BJX A;  4QEW A;  5EIC A;  3QZT A;  3NXB A;  4LDF A;  5KTU A;  2DVQ A;  2R10 A;  4TU6 A;  5II1 A;  3G0L A;  2GRC A;  5IGN A;  5KHM A;  4A9L A;  4O75 A;  4QSV A;  5CGP A;  5KTX A;  4TT6 A;  5F1L A;  3U5M A;  4QYL A;  4Z6I A;  5C8G A;  4KCX A;  5HEM A;  4QSP A;  4HBV A;  4QUU A;  5D3S A;  4UYF B;  5DYX A;  4BHW A;  4NYW A;  2RNY A;  3UV4 A;  5D25 A;  5DYC A;  5I80 A;  4CFL A;  4UIV A;  4YYD A;  4HXP A;  5EU1 A;  5TCM A;  4IOQ A;  5ENG A;  5HFQ A;  3LXJ A;  5E9M A;  5C4Q A;  4DON A;  3GG3 A;  5LVR A;  2YEK A;  4F3I A;  3D7C A;  4A9E A;  5FE6 A;  4Z6H A;  2E7N A;  5CQT A;  4Q0N A;  2R0V A;  4HXN A;  5DX4 A;  5FE8 A;  4BW1 A;  2I8N A;  3P1E A;  4QEV A;  1WUM A;  4HBW A;  4XY8 A;  5FG5 A;  4YBS A;  5C89 A;  2RNX A;  1E6I A;  3JVK A;  5EPR A;  5EWW A;  4YY4 A;  5FDZ A;  4IOR A;  3AQA A;  5IBN A;  5C85 A;  4UYH A;  4YAX A;  4N4G A;  5DYA A;  4BW4 A;  4QEU A;  4LRG A;  4QSS A;  4PTB A;  3K2J A;  2L84 A;  4PKL A;  4PY6 A;  5DFC A;  5D3L A;  5E9V A;  4TZ2 A;  5FE5 A;  3IU5 A;  4ZQL A;  4LC2 A;  5EPS A;  5I7X A;  3RCW A;  3JVM A;  4LR6 A;  5LKX A;  5L99 A;  5FG4 A;  5CUD A;  3P5O A;  5E9I A;  4YH3 A;  4CL9 A;  4O74 A;  5EP7 A;  3MB4 A;  2RI7 A;  5F2P A;  2DVV A;  2F6J A;  4N4H A;  4ZC9 A;  4CUU A;  5CUC A;  4MEQ A;  4BW3 A;  5FH7 A;  4YBT A;  1JM4 B;  3UVW A;  4O70 A;  5H1V A;  5DLX A;  3O33 A;  5I86 A;  5EGU A;  5E0R A;  3SVF A;  4A9K A;  4LZR A;  2KTB B;  4PCE A;  5LKT A;  5D3H A;  5A5S A;  4HXO A;  2DAT A;  4LZS A;  5CRM A;  4UIY A;  4NR5 A;  5DFB A;  1ZS5 A;  4KV4 A;  5FE3 A;  4MR3 A;  5CQA A;  4LYS A;  5IGM A;  4NRB A;  4NR6 A;  5FB0 A;  5HFR A;  5E9Y A;  4YYN A;  4A9H A;  4HXK A;  4XY9 A;  2RS9 B;  5BT5 A;  4KV1 A;  4O72 A;  5CUA A;  4J1P A;  4UYF A;  4CUP A;  2I7K A;  3MB3 A;  4LYW A;  5EPB A;  5I29 A;  4NQN A;  5I88 A;  5BT3 A;  4QR3 A;  5HRX A;  5KO4 A;  4TYL A;  4A9I A;  4NYV A;  4OGI A;  5AMF A;  4AKN A;  5A83 A;  4CUQ A;  5F61 A;  5EWV A;  4XUB A;  4TZ8 A;  4QR5 A;  4CUT A;  4IOO A;  5DFD A;  5FE7 A;  2L85 A;  3JVL A;  5E3D A;  4QSU A;  5G4R A;  4YYG A;  5I1Q A;  2LSP B;  5IID A;  3Q2F A;  4PS5 A;  3HMH A;  5LUU A;  2WP2 A;  4HXL A;  2D82 A;  3U5K A;  5D7X A;  5ACY A;  4NR8 A;  4YAB A;  5ENI A;  2YDW A;  4A9O A;  3SVH A;  5H85 A;  4UYD A;  2DVR A;  5E3G A;  4IR3 A;  5HQ5 A;  5I40 A;  5FE1 A;  5D0C A;  5CUB A;  5A82 A;  3G0J A;  5H1T A;  5JWM A;  5II2 A;  5CQ8 A;  4MR4 A;  5CPE A;  4C67 A;  5D3T A;  4TTE A;  4YC9 A;  5CS8 A;  5I89 A;  5I83 A;  5CQ7 A;  2YYN A;  4RVR A;  2R0S A;  4UIT A;  5EA1 A;  4QUT A;  3S92 A;  5FG6 A;  5AD2 A;  5HQ7 A;  4YYK A;  4TT4 A;  5LJ2 A;  5ENJ A;  5CY9 A;  2G4A A;  5HEL A;  5C7N A;  4YK0 A;  5EWD A;  4O76 A;  4QST A;  3MXF A;  4C66 A;  4HBY A;  5ENC A;  4J0R A;  3U5O A;  3O34 A;  3U5L A;  4J3I A;  3UVY A;  2OO1 A;  1EQF A;  4Y03 A;  1X0J A;  4O7C A;  3I3J A;  4MR5 A;  5D26 A;  4ALG A;  5L98 A;  3QZV A;  5DKD A;  2F6N A;  4NUC A;  4A9J A;  4XUA A;  4HBX A;  4TU4 A;  4Z93 A;  5ENB A;  4YBM A;  4A9M A;  3S91 A;  5ETB A;  2L5E A;  3AAD A;  5H1U A;  2D9E A;  5HLS A;  5EIS A;  3JVJ A;  3MUL A;  5K29 A;  5CUG A;  5F60 A;  5HQ6 A;  3O36 A;  5F62 A;  5E9L A;  5CZG A;  4IR5 A;  4NQM A;  3UVX A;  5CTL A;  5FFV A;  4YYH A;  4WIV A;  5CQ6 A;  1JSP B;  4UYE A;  4NR4 A;  2RNW A;  4NYX A;  5CP5 A;  4QR4 A;  4Z1Q A;  5IGL A;  3HMF A;  5LKZ A;  4CUS A;  5A7C A;  4BW2 A;  4HXR A;  5HEN A;  5FE9 A;  3DWY A;  4NS5 A;  4O7F A;  5ENH A;  5A85 A;  5DLZ A;  3P1D A;  5G4S A;  4X2I A;  4Q0O A;  4NRC A;  5EQ1 A;  4QB3 A;  3UV5 A;  4NRA A;  3MUK A;  4O7B A;  5DY7 A;  4O7A A;  5F36 A;  5E9K A;  2YQD A;  5EV9 A;  5LJ0 A;  5A5Q A;  4OUF A;  5FE4 A;  5FH8 A;  5CQ5 A;  4QSR A;  4CLB A;  5I7Y A;  5CRZ A;  5FFY A;  1N72 A;  5EWH A;  5IGK A;  5TB6 A;  4LYI A;  2OSS A;  4QC1 A;  5D24 A;  3P1F A;  5EI4 A;  5FB1 A;  5A5O A;  5D3N A;  4QSQ A;  4QC3 A;  2R0Y A;  3HME A;  4MR6 A;  4N4F A;  5BT4 A;  2DKW A;  2YEM A;  2NXB A;  5FE2 A;  4NR9 A;  5CU8 A;  5ENF A;  4WHU A;  4YY6 A;  2RO1 A;  5HM0 A;  4UYG A;  4A9F A;  4WHW A;  5F1H A;  5EVA A;  4NUE A;  3QZS A;  3UV2 A;  3FKM X;  4YH4 A;  5D3J A;  5C87 A;  2N9G A;  5J0D A;  4NUD A;  5F63 A;  4O71 A;  5EM3 A;  5AME A;  4HXS A;  4CFK A;  5FE0 A;  4YYJ A;  5A5N A;  5COI A;  3IU6 A;  3P1C A;  5F3A A;  5HCL A;  5JI8 A;  4YAT A;  5L97 A;  3ONI A;  5D3R A;  5L8U A;  4YYM A;  5E74 A;  3U5P A;  3MQM A;  4CUR A;  5AD3 A;  4UIX A;  5D3P A;  5IG6 A;  4NXJ A;  3Q2E A;  2RFJ A;  4A9N A;  5HJC A;  2MJV B;  5DBM A;  4MEN A;  2E3K A;  4Z1S A;  4QY4 A;  5HRV A;  5L8T A;  4J0S A;  5F5Z A;  3U5J A;  3LQJ A;  4N3W A;  5CUE A;  5HRW A;  1F68 A;  4O78 A;  3LJW A;  5DW1 A;  5F25 A;  4GPJ A;  3UVD A;  5CQ3 A;  2YW5 A;  5KU3 A;  4TQN A;  4NR7 A;  2OUO A;  4MEO A;  5E73 A;  5FFW A;  5EWC A;  5FBX A;  4QSX A;  2H60 A;  5ETD A;  3O37 A;  5A81 A;  5L96 A;  4QBM A;  3U5N A;  2WP1 A;  5ENE A;  5DYU A;  5DKH A;  4UIZ A; 
#chains in the Genus database with same CATH topology
 5DW2 A;  2YEL A;  3LQH A;  1WUG A;  3TLP A;  3SVG A;  4XYA A;  4QNS A;  5A5P A;  4HXM A;  4FLP A;  5FH6 A;  2FSA A;  4UIU A;  4UIW A;  5LVQ A;  5LJ1 A;  3LQI A;  4O7E A;  1ZKR A;  2DWW A;  5KTW A;  5CQ4 A;  5A5R A;  4MEP A;  5LKU A;  3ZYU A;  4O77 A;  4PCI A;  4QSW A;  4IR6 A;  4E96 A;  4IR4 A;  4LZ2 A;  2DVS A;  4YYI A;  5E7D A;  4ALH A;  4YAD A;  4QYD A;  4ZW1 A;  5EK9 A;  2E7O A;  3O35 A;  5CFW A;  4QZS A;  3UW9 A;  4TT2 A;  4OGJ A;  4TS8 A;  3DAI A;  5DKC A;  4N4I A;  4BJX A;  4QEW A;  5EIC A;  3QZT A;  3NXB A;  4AKG A;  4LDF A;  5KTU A;  2DVQ A;  2R10 A;  4TU6 A;  5II1 A;  3G0L A;  2GRC A;  5IGN A;  5KHM A;  4A9L A;  4O75 A;  4QSV A;  5CGP A;  5KTX A;  4TT6 A;  5F1L A;  3U5M A;  4QYL A;  4Z6I A;  5C8G A;  4KCX A;  5HEM A;  4QSP A;  4HBV A;  4QUU A;  5D3S A;  4UYF B;  5DYX A;  4BHW A;  4NYW A;  2RNY A;  4AKH A;  3UV4 A;  5D25 A;  5DYC A;  5I80 A;  4CFL A;  4UIV A;  4YYD A;  4HXP A;  5EU1 A;  5TCM A;  4IOQ A;  5ENG A;  5HFQ A;  3LXJ A;  4AKI A;  5E9M A;  5C4Q A;  4DON A;  3GG3 A;  1PUO A;  2YEK A;  4F3I A;  3D7C A;  5LVR A;  4A9E A;  5FE6 A;  4Z6H A;  2E7N A;  5CQT A;  4Q0N A;  2R0V A;  4HXN A;  5DX4 A;  5FE8 A;  4BW1 A;  2I8N A;  3P1E A;  4QEV A;  1WUM A;  4HBW A;  4XY8 A;  5FG5 A;  4YBS A;  5C89 A;  2RNX A;  1E6I A;  3JVK A;  5EPR A;  5EWW A;  4YY4 A;  5FDZ A;  4IOR A;  3AQA A;  5IBN A;  5C85 A;  4UYH A;  4YAX A;  4N4G A;  5DYA A;  4BW4 A;  4QEU A;  4LRG A;  4QSS A;  4PTB A;  3K2J A;  3ERR A;  2L84 A;  4PKL A;  4PY6 A;  5DFC A;  5D3L A;  5E9V A;  4TZ2 A;  5FE5 A;  3IU5 A;  4ZQL A;  4LC2 A;  5EPS A;  5I7X A;  3RCW A;  3D1B A;  3JVM A;  4LR6 A;  5LKX A;  5L99 A;  5FG4 A;  5CUD A;  3P5O A;  5E9I A;  4YH3 A;  4CL9 A;  4O74 A;  5EP7 A;  3MB4 A;  2RI7 A;  5F2P A;  2EJN A;  2DVV A;  2F6J A;  4N4H A;  4ZC9 A;  4CUU A;  5CUC A;  4MEQ A;  4BW3 A;  5FH7 A;  4YBT A;  1JM4 B;  3UVW A;  4O70 A;  5H1V A;  5DLX A;  3O33 A;  5I86 A;  5EGU A;  5E0R A;  3VKH A;  3SVF A;  4A9K A;  4LZR A;  2KTB B;  4PCE A;  5LKT A;  5D3H A;  5A5S A;  4HXO A;  2DAT A;  4LZS A;  5CRM A;  4UIY A;  4NR5 A;  5DFB A;  1ZS5 A;  4KV4 A;  5FE3 A;  4MR3 A;  5CQA A;  4LYS A;  5IGM A;  4NRB A;  4NR6 A;  5FB0 A;  5HFR A;  5E9Y A;  4YYN A;  4A9H A;  4HXK A;  4XY9 A;  2RS9 B;  5BT5 A;  4KV1 A;  4O72 A;  5CUA A;  4J1P A;  4UYF A;  4CUP A;  2I7K A;  3MB3 A;  4LYW A;  5EPB A;  5I29 A;  4NQN A;  5I88 A;  5BT3 A;  4QR3 A;  5HRX A;  5KO4 A;  4TYL A;  4A9I A;  4NYV A;  4OGI A;  5AMF A;  4AKN A;  5A83 A;  4CUQ A;  5F61 A;  5EWV A;  4XUB A;  4TZ8 A;  4QR5 A;  4CUT A;  4IOO A;  5DFD A;  5FE7 A;  2L85 A;  3JVL A;  5E3D A;  4QSU A;  5G4R A;  4YYG A;  5I1Q A;  2LSP B;  5IID A;  3Q2F A;  4PS5 A;  3HMH A;  5LUU A;  2WP2 A;  4HXL A;  2D82 A;  3U5K A;  5D7X A;  5ACY A;  4NR8 A;  4YAB A;  5ENI A;  2YDW A;  4A9O A;  3SVH A;  5H85 A;  4UYD A;  4AI6 A;  2DVR A;  5E3G A;  4IR3 A;  5HQ5 A;  5I40 A;  5FE1 A;  5D0C A;  5CUB A;  5A82 A;  3G0J A;  5H1T A;  5JWM A;  5II2 A;  5CQ8 A;  4MR4 A;  5CPE A;  4C67 A;  5D3T A;  4TTE A;  4YC9 A;  5CS8 A;  5I89 A;  5I83 A;  5CQ7 A;  2YYN A;  4RVR A;  2R0S A;  4UIT A;  5EA1 A;  4QUT A;  3S92 A;  5FG6 A;  5AD2 A;  5HQ7 A;  4YYK A;  4TT4 A;  5LJ2 A;  5ENJ A;  5CY9 A;  2G4A A;  5HEL A;  5C7N A;  4YK0 A;  5EWD A;  4O76 A;  4QST A;  3MXF A;  4C66 A;  4HBY A;  5ENC A;  4J0R A;  3U5O A;  3O34 A;  3U5L A;  4J3I A;  3UVY A;  2OO1 A;  1EQF A;  4Y03 A;  1X0J A;  4O7C A;  3I3J A;  4MR5 A;  5D26 A;  4ALG A;  5L98 A;  3QZV A;  5DKD A;  2F6N A;  4NUC A;  4A9J A;  4XUA A;  4HBX A;  4TU4 A;  4Z93 A;  5ENB A;  4YBM A;  4A9M A;  3S91 A;  5ETB A;  2L5E A;  3AAD A;  5H1U A;  2D9E A;  5HLS A;  5EIS A;  3JVJ A;  3MUL A;  5K29 A;  5CUG A;  5F60 A;  5HQ6 A;  3O36 A;  5F62 A;  5E9L A;  5CZG A;  4IR5 A;  4NQM A;  3VKG A;  3UVX A;  5CTL A;  5FFV A;  4YYH A;  4WIV A;  5CQ6 A;  1JSP B;  4UYE A;  4NR4 A;  2RNW A;  4NYX A;  5CP5 A;  4QR4 A;  4Z1Q A;  5IGL A;  3HMF A;  5LKZ A;  4CUS A;  5A7C A;  4BW2 A;  4HXR A;  5HEN A;  5FE9 A;  3DWY A;  4NS5 A;  4O7F A;  5ENH A;  5A85 A;  5DLZ A;  3P1D A;  5G4S A;  4X2I A;  4Q0O A;  4NRC A;  5EQ1 A;  4QB3 A;  3UV5 A;  4NRA A;  3MUK A;  4O7B A;  5DY7 A;  4O7A A;  5F36 A;  5E9K A;  2YQD A;  5EV9 A;  5LJ0 A;  5A5Q A;  4OUF A;  5FE4 A;  5FH8 A;  5CQ5 A;  4QSR A;  4CLB A;  5I7Y A;  5CRZ A;  5FFY A;  1N72 A;  5EWH A;  5IGK A;  5TB6 A;  4LYI A;  2OSS A;  4QC1 A;  5D24 A;  3P1F A;  5EI4 A;  5FB1 A;  5A5O A;  5D3N A;  4QSQ A;  4QC3 A;  2R0Y A;  3HME A;  4MR6 A;  4N4F A;  5BT4 A;  2DKW A;  2YEM A;  2NXB A;  5FE2 A;  4NR9 A;  5CU8 A;  5ENF A;  4WHU A;  4YY6 A;  2RO1 A;  5HM0 A;  4UYG A;  4A9F A;  4WHW A;  5F1H A;  5EVA A;  4NUE A;  3QZS A;  3UV2 A;  3FKM X;  4YH4 A;  5D3J A;  5C87 A;  2N9G A;  5J0D A;  4NUD A;  5F63 A;  4O71 A;  5EM3 A;  5AME A;  4HXS A;  4CFK A;  5FE0 A;  4YYJ A;  5A5N A;  5COI A;  3IU6 A;  3P1C A;  5F3A A;  5HCL A;  5JI8 A;  4YAT A;  5L97 A;  3ONI A;  5D3R A;  5L8U A;  4YYM A;  5E74 A;  3U5P A;  3MQM A;  4CUR A;  5AD3 A;  4UIX A;  5D3P A;  5IG6 A;  4NXJ A;  3Q2E A;  2RFJ A;  4A9N A;  5HJC A;  3D1D A;  2MJV B;  5DBM A;  4MEN A;  2E3K A;  4Z1S A;  4QY4 A;  5HRV A;  5L8T A;  4J0S A;  5F5Z A;  3U5J A;  3LQJ A;  4N3W A;  5CUE A;  5HRW A;  1F68 A;  4O78 A;  3LJW A;  5DW1 A;  5F25 A;  4GPJ A;  3UVD A;  5CQ3 A;  2YW5 A;  5KU3 A;  4TQN A;  4NR7 A;  2OUO A;  4MEO A;  5E73 A;  5FFW A;  5EWC A;  5FBX A;  4QSX A;  2H60 A;  5ETD A;  3O37 A;  5A81 A;  5L96 A;  4QBM A;  3U5N A;  2WP1 A;  5ENE A;  5DYU A;  5DKH A;  4UIZ A; 
#chains in the Genus database with same CATH homology
 5DW2 A;  2YEL A;  3LQH A;  1WUG A;  3TLP A;  3SVG A;  4XYA A;  4QNS A;  5A5P A;  4HXM A;  4FLP A;  5FH6 A;  2FSA A;  4UIU A;  4UIW A;  5LVQ A;  5LJ1 A;  3LQI A;  4O7E A;  2DWW A;  5KTW A;  5CQ4 A;  5A5R A;  4MEP A;  5LKU A;  3ZYU A;  4O77 A;  4PCI A;  4QSW A;  4IR6 A;  4E96 A;  4IR4 A;  4LZ2 A;  2DVS A;  4YYI A;  5E7D A;  4ALH A;  4YAD A;  4QYD A;  4ZW1 A;  5EK9 A;  2E7O A;  3O35 A;  5CFW A;  4QZS A;  3UW9 A;  4TT2 A;  4OGJ A;  4TS8 A;  3DAI A;  5DKC A;  4N4I A;  4BJX A;  4QEW A;  5EIC A;  3QZT A;  3NXB A;  4LDF A;  5KTU A;  2DVQ A;  2R10 A;  4TU6 A;  5II1 A;  3G0L A;  2GRC A;  5IGN A;  5KHM A;  4A9L A;  4O75 A;  4QSV A;  5CGP A;  5KTX A;  4TT6 A;  5F1L A;  3U5M A;  4QYL A;  4Z6I A;  5C8G A;  4KCX A;  5HEM A;  4QSP A;  4HBV A;  4QUU A;  5D3S A;  4UYF B;  5DYX A;  4BHW A;  4NYW A;  2RNY A;  3UV4 A;  5D25 A;  5DYC A;  5I80 A;  4CFL A;  4UIV A;  4YYD A;  4HXP A;  5EU1 A;  5TCM A;  4IOQ A;  5ENG A;  5HFQ A;  3LXJ A;  5E9M A;  5C4Q A;  4DON A;  3GG3 A;  5LVR A;  2YEK A;  4F3I A;  3D7C A;  4A9E A;  5FE6 A;  4Z6H A;  2E7N A;  5CQT A;  4Q0N A;  2R0V A;  4HXN A;  5DX4 A;  5FE8 A;  4BW1 A;  2I8N A;  3P1E A;  4QEV A;  1WUM A;  4HBW A;  4XY8 A;  5FG5 A;  4YBS A;  5C89 A;  2RNX A;  1E6I A;  3JVK A;  5EPR A;  5EWW A;  4YY4 A;  5FDZ A;  4IOR A;  3AQA A;  5IBN A;  5C85 A;  4UYH A;  4YAX A;  4N4G A;  5DYA A;  4BW4 A;  4QEU A;  4LRG A;  4QSS A;  4PTB A;  3K2J A;  2L84 A;  4PKL A;  4PY6 A;  5DFC A;  5D3L A;  5E9V A;  4TZ2 A;  5FE5 A;  3IU5 A;  4ZQL A;  4LC2 A;  5EPS A;  5I7X A;  3RCW A;  3JVM A;  4LR6 A;  5LKX A;  5L99 A;  5FG4 A;  5CUD A;  3P5O A;  5E9I A;  4YH3 A;  4CL9 A;  4O74 A;  5EP7 A;  3MB4 A;  2RI7 A;  5F2P A;  2DVV A;  2F6J A;  4N4H A;  4ZC9 A;  4CUU A;  5CUC A;  4MEQ A;  4BW3 A;  5FH7 A;  4YBT A;  1JM4 B;  3UVW A;  4O70 A;  5H1V A;  5DLX A;  3O33 A;  5I86 A;  5EGU A;  5E0R A;  3SVF A;  4A9K A;  4LZR A;  2KTB B;  4PCE A;  5LKT A;  5D3H A;  5A5S A;  4HXO A;  2DAT A;  4LZS A;  5CRM A;  4UIY A;  4NR5 A;  5DFB A;  1ZS5 A;  4KV4 A;  5FE3 A;  4MR3 A;  5CQA A;  4LYS A;  5IGM A;  4NRB A;  4NR6 A;  5FB0 A;  5HFR A;  5E9Y A;  4YYN A;  4A9H A;  4HXK A;  4XY9 A;  2RS9 B;  5BT5 A;  4KV1 A;  4O72 A;  5CUA A;  4J1P A;  4UYF A;  4CUP A;  2I7K A;  3MB3 A;  4LYW A;  5EPB A;  5I29 A;  4NQN A;  5I88 A;  5BT3 A;  4QR3 A;  5HRX A;  5KO4 A;  4TYL A;  4A9I A;  4NYV A;  4OGI A;  5AMF A;  4AKN A;  5A83 A;  4CUQ A;  5F61 A;  5EWV A;  4XUB A;  4TZ8 A;  4QR5 A;  4CUT A;  4IOO A;  5DFD A;  5FE7 A;  2L85 A;  3JVL A;  5E3D A;  4QSU A;  5G4R A;  4YYG A;  5I1Q A;  2LSP B;  5IID A;  3Q2F A;  4PS5 A;  3HMH A;  5LUU A;  2WP2 A;  4HXL A;  2D82 A;  3U5K A;  5D7X A;  5ACY A;  4NR8 A;  4YAB A;  5ENI A;  2YDW A;  4A9O A;  3SVH A;  5H85 A;  4UYD A;  2DVR A;  5E3G A;  4IR3 A;  5HQ5 A;  5I40 A;  5FE1 A;  5D0C A;  5CUB A;  5A82 A;  3G0J A;  5H1T A;  5JWM A;  5II2 A;  5CQ8 A;  4MR4 A;  5CPE A;  4C67 A;  5D3T A;  4TTE A;  4YC9 A;  5CS8 A;  5I89 A;  5I83 A;  5CQ7 A;  2YYN A;  4RVR A;  2R0S A;  4UIT A;  5EA1 A;  4QUT A;  3S92 A;  5FG6 A;  5AD2 A;  5HQ7 A;  4YYK A;  4TT4 A;  5LJ2 A;  5ENJ A;  5CY9 A;  2G4A A;  5HEL A;  5C7N A;  4YK0 A;  5EWD A;  4O76 A;  4QST A;  3MXF A;  4C66 A;  4HBY A;  5ENC A;  4J0R A;  3U5O A;  3O34 A;  3U5L A;  4J3I A;  3UVY A;  2OO1 A;  1EQF A;  4Y03 A;  1X0J A;  4O7C A;  3I3J A;  4MR5 A;  5D26 A;  4ALG A;  5L98 A;  3QZV A;  5DKD A;  2F6N A;  4NUC A;  4A9J A;  4XUA A;  4HBX A;  4TU4 A;  4Z93 A;  5ENB A;  4YBM A;  4A9M A;  3S91 A;  5ETB A;  2L5E A;  3AAD A;  5H1U A;  2D9E A;  5HLS A;  5EIS A;  3JVJ A;  3MUL A;  5K29 A;  5CUG A;  5F60 A;  5HQ6 A;  3O36 A;  5F62 A;  5E9L A;  5CZG A;  4IR5 A;  4NQM A;  3UVX A;  5CTL A;  5FFV A;  4YYH A;  4WIV A;  5CQ6 A;  1JSP B;  4UYE A;  4NR4 A;  2RNW A;  4NYX A;  5CP5 A;  4QR4 A;  4Z1Q A;  5IGL A;  3HMF A;  5LKZ A;  4CUS A;  5A7C A;  4BW2 A;  4HXR A;  5HEN A;  5FE9 A;  3DWY A;  4NS5 A;  4O7F A;  5ENH A;  5A85 A;  5DLZ A;  3P1D A;  5G4S A;  4X2I A;  4Q0O A;  4NRC A;  5EQ1 A;  4QB3 A;  3UV5 A;  4NRA A;  3MUK A;  4O7B A;  5DY7 A;  4O7A A;  5F36 A;  5E9K A;  2YQD A;  5EV9 A;  5LJ0 A;  5A5Q A;  4OUF A;  5FE4 A;  5FH8 A;  5CQ5 A;  4QSR A;  4CLB A;  5I7Y A;  5CRZ A;  5FFY A;  1N72 A;  5EWH A;  5IGK A;  5TB6 A;  4LYI A;  2OSS A;  4QC1 A;  5D24 A;  3P1F A;  5EI4 A;  5FB1 A;  5A5O A;  5D3N A;  4QSQ A;  4QC3 A;  2R0Y A;  3HME A;  4MR6 A;  4N4F A;  5BT4 A;  2DKW A;  2YEM A;  2NXB A;  5FE2 A;  4NR9 A;  5CU8 A;  5ENF A;  4WHU A;  4YY6 A;  2RO1 A;  5HM0 A;  4UYG A;  4A9F A;  4WHW A;  5F1H A;  5EVA A;  4NUE A;  3QZS A;  3UV2 A;  3FKM X;  4YH4 A;  5D3J A;  5C87 A;  2N9G A;  5J0D A;  4NUD A;  5F63 A;  4O71 A;  5EM3 A;  5AME A;  4HXS A;  4CFK A;  5FE0 A;  4YYJ A;  5A5N A;  5COI A;  3IU6 A;  3P1C A;  5F3A A;  5HCL A;  5JI8 A;  4YAT A;  5L97 A;  3ONI A;  5D3R A;  5L8U A;  4YYM A;  5E74 A;  3U5P A;  3MQM A;  4CUR A;  5AD3 A;  4UIX A;  5D3P A;  5IG6 A;  4NXJ A;  3Q2E A;  2RFJ A;  4A9N A;  5HJC A;  2MJV B;  5DBM A;  4MEN A;  2E3K A;  4Z1S A;  4QY4 A;  5HRV A;  5L8T A;  4J0S A;  5F5Z A;  3U5J A;  3LQJ A;  4N3W A;  5CUE A;  5HRW A;  1F68 A;  4O78 A;  3LJW A;  5DW1 A;  5F25 A;  4GPJ A;  3UVD A;  5CQ3 A;  2YW5 A;  5KU3 A;  4TQN A;  4NR7 A;  2OUO A;  4MEO A;  5E73 A;  5FFW A;  5EWC A;  5FBX A;  4QSX A;  2H60 A;  5ETD A;  3O37 A;  5A81 A;  5L96 A;  4QBM A;  3U5N A;  2WP1 A;  5ENE A;  5DYU A;  5DKH A;  4UIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...