4YY6A

Crystal structure of brd9 bromodomain bound to a butyryllysine peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
102
structure length
102
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 9
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 36
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yy6A00
5BT4A 4A9NA 5ACYA 4HXSA 3UV2A 2N9GA 5CQ8A 4LYSA 2KTBB 2F6JA 4HBYA 5ENGA 4YBTA 4QSUA 3O35A 4UYFB 5EGUA 3I3JA 4OGJA 2RS9B 5D3PA 5IBNA 5CZGA 3QZTA 4OGIA 4NR8A 4QEWA 5LJ1A 1WUGA 4UIWA 5KU3A 4TZ2A 4TU4A 4TT6A 5HM0A 5FE6A 4HXRA 4QSTA 2YEMA 5E9IA 5A81A 3AADA 5FBXA 5IIDA 4IORA 2R0VA 4XY8A 5BT5A 2H60A 5DY7A 4NUEA 4DONA 4NQNA 5I86A 5DKCA 4NUDA 4MEQA 5ENHA 4YYKA 5H85A 4O77A 5L98A 5EWWA 2DVVA 4WHUA 4N4HA 4QUUA 4YH4A 4KV1A 3P1EA 5FE9A 4LZRA 1JM4B 3MB3A 5D3JA 5ENBA 5F63A 5FDZA 4ZC9A 4NYXA 4BW4A 3MUKA 4NR6A 3HMFA 4CUSA 5LVQA 5EA1A 5L99A 5I89A 5E9VA 3ONIA 1EQFA 5HQ7A 5FE2A 5HRWA 2FSAA 5EWHA 4TT2A 4QSVA 4QR4A 5C7NA 4QR5A 5HFQA 3Q2FA 5EPRA 3LQHA 4YAXA 5KHMA 4NYWA 5G4RA 5CU8A 5E0RA 5TB6A 3FKMX 4IOQA 3K2JA 5IG6A 5COIA 4CUTA 4YH3A 5F25A 4QSWA 5F2PA 3HMEA 3UV4A 3JVLA 5FE7A 4A9JA 5L8UA 5E9KA 5ENEA 5HELA 2RNXA 5EWCA 5CQ6A 4MEOA 5CS8A 4QSRA 4UIUA 5H1VA 4QB3A 5CQ4A 4HBVA 4N4IA 5DYAA 5I40A 4J1PA 3JVMA 4UITA 5LKUA 4YYNA 5I80A 3UVDA 5ENJA 5LJ2A 4O7CA 3G0JA 3O37A 4IOOA 4NR4A 2WP1A 4XUBA 5DYCA 4QR3A 4MENA 4YADA 2E7OA 5LKZA 3DAIA 3UVYA 3IU5A 1E6IA 2MJVB 4KCXA 5CUEA 5L97A 3MXFA 3JVKA 2F6NA 4YC9A 4O7AA 5CUCA 5I83A 4PS5A 4HXLA 5CQ5A 2YDWA 5I1QA 5HJCA 4UIZA 4UYEA 4A9IA 4CURA 3G0LA 5A7CA 5D3NA 4QSSA 5HLSA 4NXJA 5CQAA 2RNWA 4QEVA 5A5QA 4UYHA 5II1A 4HXKA 5FH6A 3MULA 5CUAA 3NXBA 4FLPA 4GPJA 5AMFA 5A5NA 2R10A 5KO4A 5EWVA 4BHWA 4UIYA 3Q2EA 2R0YA 4NRBA 5DW1A 4LZ2A 5DX4A 4O7EA 4CL9A 5A85A 3LQIA 4TS8A 4CLBA 4MR5A 4A9EA 5D7XA 4O7BA 4KV4A 4PY6A 4XYAA 5EI4A 3ZYUA 5BT3A 5C85A 5EP7A 5EPSA 5D3HA 4Q0OA 3TLPA 4A9FA 4TT4A 5ETBA 4QEUA 4YBSA 3U5MA 3UW9A 5L8TA 5HFRA 5DYXA 4PKLA 4X2IA 4YYIA 3QZVA 5C8GA 3MB4A 5K29A 5CFWA 5C4QA 5DBMA 5FG5A 3U5PA 4A9OA 4E96A 3U5OA 4YY6A 4LRGA 5CUDA 2DATA 5EISA 2YYNA 5A5PA 2E3KA 3P1CA 2L84A 3P1DA 5EU1A 5F3AA 5HEMA 4CUUA 2GRCA 4YYGA 5AMEA 5FH8A 2YELA 4QZSA 4QNSA 4O71A 5G4SA 4PCIA 5E3DA 5CRMA 5CQ7A 5FE5A 4NYVA 4LYIA 4IR4A 4AKNA 4QYDA 4A9LA 2DVQA 3LJWA 2OO1A 1ZS5A 5EM3A 3O34A 4N3WA 4A9MA 4YYDA 5LJ0A 3SVFA 5FE8A 4HXMA 4QYLA 5HRXA 4TTEA 5F36A 3P5OA 5H1UA 3S92A 4J3IA 5LKTA 3U5JA 4UYFA 5D3SA 1X0JA 4UYDA 5FB0A 5CTLA 2LSPB 4ZQLA 3UVXA 5JWMA 4NRAA 5IGMA 2OSSA 4BW1A 5LKXA 1JSPB 4BJXA 4QC3A 5I7XA 4Z6HA 4HBWA 4N4GA 4CUQA 4J0SA 4Z93A 3LXJA 4MEPA 3S91A 5KTWA 3U5LA 4WIVA 5HCLA 5CUGA 4IR5A 2I7KA 4NR9A 3O33A 2RFJA 5II2A 4OUFA 5KTXA 4HXPA 5CGPA 4WHWA 3MQMA 4O72A 5F60A 4MR4A 4O7FA 4HXNA 5D3TA 4YYHA 5KTUA 4MR6A 5HQ6A 3IU6A 4XY9A 5DFCA 4A9HA 4UIVA 5E9YA 5LUUA 3O36A 5ENFA 5D26A 5ETDA 4Z6IA 5HENA 4TU6A 3UVWA 5FE1A 5E7DA 2RO1A 4QC1A 5CP5A 5CPEA 4YATA 4UIXA 4YK0A 4LR6A 5I7YA 5LVRA 5ENIA 1WUMA 4BW2A 2RI7A 5C89A 4QSPA 4C67A 5AD3A 4ALGA 5EQ1A 5IGNA 4HBXA 2D9EA 4PCEA 5FG4A 5I88A 2NXBA 3SVGA 3AQAA 4ALHA 5CY9A 5DLZA 5EICA 5DLXA 4LZSA 4C66A 4YABA 4PTBA 4TQNA 5CQTA 5L96A 5F61A 5ENCA 2YW5A 3JVJA 4YY4A 5E3GA 4Y03A 5D25A 5IGKA 2DVRA 3QZSA 5A5RA 5F62A 5D24A 4UYGA 5E9LA 4A9KA 3GG3A 4TYLA 4O70A 3U5KA 5C87A 4QY4A 4NR7A 5FB1A 4YYMA 4YBMA 5DYUA 5EV9A 4IR6A 4NR5A 5HQ5A 5F1HA 4Z1SA 3UV5A 3DWYA 4N4FA 2E7NA 5E74A 4NUCA 3SVHA 2WP2A 2RNYA 5EVAA 2R0SA 5D0CA 4Z1QA 5FE0A 5CQ3A 3P1FA 4LC2A 4NS5A 5FG6A 3HMHA 3U5NA 4LDFA 4CUPA 5A83A 5A5SA 4O75A 5H1TA 4MR3A 4NQMA 2I8NA 4IR3A 5CRZA 2L85A 4BW3A 4HXOA 5E9MA 3RCWA 5F1LA 4XUAA 5FFWA 5CUBA 2OUOA 2DVSA 5E73A 5EWDA 5HRVA 4ZW1A 4QSXA 5DKDA 5J0DA 5AD2A 4NRCA 5FH7A 5D3RA 5DKHA 5I29A 2DWWA 2L5EA 4QSQA 5EPBA 2DKWA 2G4AA 5DFBA 4O74A 5IGLA 5EK9A 4QBMA 5D3LA 4F3IA 5FE4A 4CFKA 4RVRA 1N72A 4J0RA 4O76A 2D82A 5A5OA 4CFLA 4Q0NA 5TCMA 5A82A 3D7CA 5DFDA 2YQDA 2YEKA 3LQJA 4QUTA 4O78A 5DW2A 5F5ZA 5FFYA 4LYWA 5FFVA 4YYJA 5FE3A 5JI8A 1F68A 4TZ8A
chains in the Genus database with same CATH superfamily
5BT4A 4A9NA 5ACYA 4HXSA 3UV2A 2N9GA 5CQ8A 4LYSA 2KTBB 2F6JA 4HBYA 5ENGA 4YBTA 4QSUA 3O35A 4UYFB 5EGUA 3I3JA 4OGJA 2RS9B 5D3PA 5IBNA 5CZGA 3QZTA 4OGIA 4NR8A 4QEWA 5LJ1A 1WUGA 4UIWA 5KU3A 4TZ2A 4TU4A 4TT6A 5HM0A 5FE6A 4HXRA 4QSTA 2YEMA 5E9IA 5A81A 3AADA 5FBXA 5IIDA 4IORA 2R0VA 4XY8A 5BT5A 2H60A 5DY7A 4NUEA 4DONA 4NQNA 5I86A 5DKCA 4NUDA 4MEQA 5ENHA 4YYKA 5H85A 4O77A 5L98A 5EWWA 2DVVA 4WHUA 4N4HA 4QUUA 4YH4A 4KV1A 3P1EA 5FE9A 4LZRA 1JM4B 3MB3A 5D3JA 5ENBA 5F63A 5FDZA 4ZC9A 4NYXA 4BW4A 3MUKA 4NR6A 3HMFA 4CUSA 5LVQA 5EA1A 5L99A 5I89A 5E9VA 3ONIA 1EQFA 5HQ7A 5FE2A 5HRWA 2FSAA 5EWHA 4TT2A 4QSVA 4QR4A 5C7NA 4QR5A 5HFQA 3Q2FA 5EPRA 3LQHA 4YAXA 5KHMA 4NYWA 5G4RA 5CU8A 5E0RA 5TB6A 3FKMX 4IOQA 3K2JA 5IG6A 5COIA 4CUTA 4YH3A 5F25A 4QSWA 5F2PA 3HMEA 3UV4A 3JVLA 5FE7A 4A9JA 5L8UA 5E9KA 5ENEA 5HELA 2RNXA 5EWCA 5CQ6A 4MEOA 5CS8A 4QSRA 4UIUA 5H1VA 4QB3A 5CQ4A 4HBVA 4N4IA 5DYAA 5I40A 4J1PA 3D1DA 3JVMA 4UITA 5LKUA 4YYNA 5I80A 3UVDA 5ENJA 5LJ2A 4O7CA 3G0JA 3O37A 4IOOA 4NR4A 2WP1A 4XUBA 5DYCA 4QR3A 4MENA 4YADA 2E7OA 5LKZA 3DAIA 3UVYA 3IU5A 1E6IA 2MJVB 4KCXA 5CUEA 5L97A 3MXFA 3JVKA 2F6NA 4YC9A 4O7AA 5CUCA 5I83A 4PS5A 4HXLA 5CQ5A 2YDWA 5I1QA 5HJCA 4UIZA 4UYEA 4A9IA 4CURA 3G0LA 5A7CA 5D3NA 3VKGA 4QSSA 5HLSA 4NXJA 5CQAA 2RNWA 4QEVA 5A5QA 4UYHA 5II1A 4HXKA 5FH6A 3MULA 5CUAA 3NXBA 4FLPA 4GPJA 5AMFA 5A5NA 2R10A 5KO4A 5EWVA 4BHWA 4UIYA 3Q2EA 2R0YA 4NRBA 5DW1A 4LZ2A 5DX4A 4O7EA 4CL9A 5A85A 3LQIA 4TS8A 4CLBA 4MR5A 4A9EA 5D7XA 3ERRA 4O7BA 4KV4A 4PY6A 4XYAA 5EI4A 3ZYUA 5BT3A 5C85A 5EP7A 5EPSA 5D3HA 4Q0OA 3TLPA 4A9FA 4TT4A 5ETBA 4QEUA 4YBSA 3U5MA 3UW9A 5L8TA 5HFRA 5DYXA 4PKLA 4X2IA 4YYIA 3QZVA 5C8GA 3MB4A 5K29A 5CFWA 5C4QA 5DBMA 5FG5A 3U5PA 4A9OA 4E96A 3U5OA 4YY6A 4LRGA 5CUDA 2DATA 5EISA 2YYNA 5A5PA 2E3KA 3P1CA 2L84A 3P1DA 5EU1A 5F3AA 5HEMA 4CUUA 2GRCA 4YYGA 5AMEA 5FH8A 2YELA 4QZSA 4QNSA 4O71A 5G4SA 4PCIA 5E3DA 5CRMA 5CQ7A 5FE5A 4NYVA 4LYIA 4IR4A 4AKNA 4QYDA 4A9LA 2DVQA 3LJWA 2OO1A 1ZS5A 5EM3A 3VKHA 3O34A 4N3WA 4A9MA 4YYDA 5LJ0A 3SVFA 5FE8A 4HXMA 4QYLA 4AKHA 5HRXA 4TTEA 5F36A 3P5OA 5H1UA 3S92A 4J3IA 1ZKRA 5LKTA 3U5JA 4UYFA 5D3SA 1X0JA 4UYDA 5FB0A 5CTLA 2LSPB 4ZQLA 3UVXA 5JWMA 4NRAA 5IGMA 2OSSA 4BW1A 5LKXA 1JSPB 4BJXA 4QC3A 5I7XA 4Z6HA 4HBWA 4N4GA 4CUQA 4J0SA 4Z93A 3LXJA 4MEPA 3S91A 5KTWA 3U5LA 4WIVA 5HCLA 5CUGA 4IR5A 2I7KA 4NR9A 3O33A 2RFJA 5II2A 4OUFA 5KTXA 4HXPA 5CGPA 4WHWA 3MQMA 4O72A 5F60A 4MR4A 4O7FA 4HXNA 5D3TA 4YYHA 5KTUA 4MR6A 5HQ6A 3IU6A 4XY9A 5DFCA 4A9HA 4UIVA 5E9YA 5LUUA 3O36A 5ENFA 5D26A 5ETDA 4Z6IA 5HENA 4TU6A 3UVWA 5FE1A 5E7DA 2RO1A 4QC1A 5CP5A 5CPEA 4YATA 4UIXA 4YK0A 4LR6A 5I7YA 5LVRA 5ENIA 1WUMA 4BW2A 2RI7A 5C89A 4QSPA 4C67A 5AD3A 4ALGA 4AKIA 5EQ1A 5IGNA 4HBXA 2D9EA 4PCEA 5FG4A 5I88A 2NXBA 3SVGA 3AQAA 4ALHA 5CY9A 5DLZA 5EICA 5DLXA 4LZSA 4C66A 4YABA 4PTBA 4TQNA 5CQTA 5L96A 5F61A 5ENCA 2YW5A 3JVJA 4YY4A 5E3GA 4Y03A 5D25A 5IGKA 2DVRA 3QZSA 5A5RA 5F62A 5D24A 4UYGA 5E9LA 4A9KA 3GG3A 4TYLA 4O70A 3U5KA 5C87A 4QY4A 4NR7A 5FB1A 4YYMA 4YBMA 5DYUA 5EV9A 4IR6A 4NR5A 5HQ5A 5F1HA 4Z1SA 3UV5A 3DWYA 4N4FA 2E7NA 5E74A 4NUCA 3SVHA 2WP2A 2RNYA 5EVAA 2R0SA 5D0CA 4Z1QA 5FE0A 5CQ3A 3P1FA 4LC2A 4NS5A 5FG6A 3HMHA 3U5NA 4LDFA 2EJNA 4CUPA 5A83A 5A5SA 4O75A 5H1TA 4MR3A 4AKGA 4NQMA 2I8NA 4IR3A 5CRZA 2L85A 4BW3A 4HXOA 5E9MA 3RCWA 5F1LA 4XUAA 5FFWA 5CUBA 2OUOA 2DVSA 5E73A 5EWDA 5HRVA 4ZW1A 4QSXA 5DKDA 5J0DA 5AD2A 4AI6A 4NRCA 5FH7A 5D3RA 5DKHA 5I29A 2DWWA 2L5EA 4QSQA 5EPBA 2DKWA 2G4AA 3D1BA 5DFBA 4O74A 5IGLA 5EK9A 4QBMA 5D3LA 4F3IA 5FE4A 4CFKA 4RVRA 1N72A 4J0RA 4O76A 2D82A 5A5OA 4CFLA 4Q0NA 5TCMA 5A82A 3D7CA 5DFDA 2YQDA 2YEKA 3LQJA 4QUTA 4O78A 5DW2A 5F5ZA 5FFYA 4LYWA 5FFVA 4YYJA 5FE3A 5JI8A 1PUOA 1F68A 4TZ8A
chains in the Genus database with same CATH topology
5BT4A 4A9NA 5ACYA 4HXSA 3UV2A 2N9GA 5CQ8A 4LYSA 2KTBB 2F6JA 4HBYA 5ENGA 4YBTA 4QSUA 3O35A 4UYFB 5EGUA 3I3JA 4OGJA 2RS9B 5D3PA 5IBNA 5CZGA 3QZTA 4OGIA 4NR8A 4QEWA 5LJ1A 1WUGA 4UIWA 5KU3A 4TZ2A 4TU4A 4TT6A 5HM0A 5FE6A 4HXRA 4QSTA 2YEMA 5E9IA 5A81A 3AADA 5FBXA 5IIDA 4IORA 2R0VA 4XY8A 5BT5A 2H60A 5DY7A 4NUEA 4DONA 4NQNA 5I86A 5DKCA 4NUDA 4MEQA 5ENHA 4YYKA 5H85A 4O77A 5L98A 5EWWA 2DVVA 4WHUA 4N4HA 4QUUA 4YH4A 4KV1A 3P1EA 5FE9A 4LZRA 1JM4B 3MB3A 5D3JA 5ENBA 5F63A 5FDZA 4ZC9A 4NYXA 4BW4A 3MUKA 4NR6A 3HMFA 4CUSA 5LVQA 5EA1A 5L99A 5I89A 5E9VA 3ONIA 1EQFA 5HQ7A 5FE2A 5HRWA 2FSAA 5EWHA 4TT2A 4QSVA 4QR4A 5C7NA 4QR5A 5HFQA 3Q2FA 5EPRA 3LQHA 4YAXA 5KHMA 4NYWA 5G4RA 5CU8A 5E0RA 5TB6A 3FKMX 4IOQA 3K2JA 5IG6A 5COIA 4CUTA 4YH3A 5F25A 4QSWA 5F2PA 3HMEA 3UV4A 3JVLA 5FE7A 4A9JA 5L8UA 5E9KA 5ENEA 5HELA 2RNXA 5EWCA 5CQ6A 4MEOA 5CS8A 4QSRA 4UIUA 5H1VA 4QB3A 5CQ4A 4HBVA 4N4IA 5DYAA 5I40A 4J1PA 3JVMA 4UITA 5LKUA 4YYNA 5I80A 3UVDA 5ENJA 5LJ2A 4O7CA 3G0JA 3O37A 4IOOA 4NR4A 2WP1A 4XUBA 5DYCA 4QR3A 4MENA 4YADA 2E7OA 5LKZA 3DAIA 3UVYA 3IU5A 1E6IA 2MJVB 4KCXA 5CUEA 5L97A 3MXFA 3JVKA 2F6NA 4YC9A 4O7AA 5CUCA 5I83A 4PS5A 4HXLA 5CQ5A 2YDWA 5I1QA 5HJCA 4UIZA 4UYEA 4A9IA 4CURA 3G0LA 5A7CA 5D3NA 4QSSA 5HLSA 4NXJA 5CQAA 2RNWA 4QEVA 5A5QA 4UYHA 5II1A 4HXKA 5FH6A 3MULA 5CUAA 3NXBA 4FLPA 4GPJA 5AMFA 5A5NA 2R10A 5KO4A 5EWVA 4BHWA 4UIYA 3Q2EA 2R0YA 4NRBA 5DW1A 4LZ2A 5DX4A 4O7EA 4CL9A 5A85A 3LQIA 4TS8A 4CLBA 4MR5A 4A9EA 5D7XA 4O7BA 4KV4A 4PY6A 4XYAA 5EI4A 3ZYUA 5BT3A 5C85A 5EP7A 5EPSA 5D3HA 4Q0OA 3TLPA 4A9FA 4TT4A 5ETBA 4QEUA 4YBSA 3U5MA 3UW9A 5L8TA 5HFRA 5DYXA 4PKLA 4X2IA 4YYIA 3QZVA 5C8GA 3MB4A 5K29A 5CFWA 5C4QA 5DBMA 5FG5A 3U5PA 4A9OA 4E96A 3U5OA 4YY6A 4LRGA 5CUDA 2DATA 5EISA 2YYNA 5A5PA 2E3KA 3P1CA 2L84A 3P1DA 5EU1A 5F3AA 5HEMA 4CUUA 2GRCA 4YYGA 5AMEA 5FH8A 2YELA 4QZSA 4QNSA 4O71A 5G4SA 4PCIA 5E3DA 5CRMA 5CQ7A 5FE5A 4NYVA 4LYIA 4IR4A 4AKNA 4QYDA 4A9LA 2DVQA 3LJWA 2OO1A 1ZS5A 5EM3A 3O34A 4N3WA 4A9MA 4YYDA 5LJ0A 3SVFA 5FE8A 4HXMA 4QYLA 5HRXA 4TTEA 5F36A 3P5OA 5H1UA 3S92A 4J3IA 5LKTA 3U5JA 4UYFA 5D3SA 1X0JA 4UYDA 5FB0A 5CTLA 2LSPB 4ZQLA 3UVXA 5JWMA 4NRAA 5IGMA 2OSSA 4BW1A 5LKXA 1JSPB 4BJXA 4QC3A 5I7XA 4Z6HA 4HBWA 4N4GA 4CUQA 4J0SA 4Z93A 3LXJA 4MEPA 3S91A 5KTWA 3U5LA 4WIVA 5HCLA 5CUGA 4IR5A 2I7KA 4NR9A 3O33A 2RFJA 5II2A 4OUFA 5KTXA 4HXPA 5CGPA 4WHWA 3MQMA 4O72A 5F60A 4MR4A 4O7FA 4HXNA 5D3TA 4YYHA 5KTUA 4MR6A 5HQ6A 3IU6A 4XY9A 5DFCA 4A9HA 4UIVA 5E9YA 5LUUA 3O36A 5ENFA 5D26A 5ETDA 4Z6IA 5HENA 4TU6A 3UVWA 5FE1A 5E7DA 2RO1A 4QC1A 5CP5A 5CPEA 4YATA 4UIXA 4YK0A 4LR6A 5I7YA 5LVRA 5ENIA 1WUMA 4BW2A 2RI7A 5C89A 4QSPA 4C67A 5AD3A 4ALGA 5EQ1A 5IGNA 4HBXA 2D9EA 4PCEA 5FG4A 5I88A 2NXBA 3SVGA 3AQAA 4ALHA 5CY9A 5DLZA 5EICA 5DLXA 4LZSA 4C66A 4YABA 4PTBA 4TQNA 5CQTA 5L96A 5F61A 5ENCA 2YW5A 3JVJA 4YY4A 5E3GA 4Y03A 5D25A 5IGKA 2DVRA 3QZSA 5A5RA 5F62A 5D24A 4UYGA 5E9LA 4A9KA 3GG3A 4TYLA 4O70A 3U5KA 5C87A 4QY4A 4NR7A 5FB1A 4YYMA 4YBMA 5DYUA 5EV9A 4IR6A 4NR5A 5HQ5A 5F1HA 4Z1SA 3UV5A 3DWYA 4N4FA 2E7NA 5E74A 4NUCA 3SVHA 2WP2A 2RNYA 5EVAA 2R0SA 5D0CA 4Z1QA 5FE0A 5CQ3A 3P1FA 4LC2A 4NS5A 5FG6A 3HMHA 3U5NA 4LDFA 4CUPA 5A83A 5A5SA 4O75A 5H1TA 4MR3A 4NQMA 2I8NA 4IR3A 5CRZA 2L85A 4BW3A 4HXOA 5E9MA 3RCWA 5F1LA 4XUAA 5FFWA 5CUBA 2OUOA 2DVSA 5E73A 5EWDA 5HRVA 4ZW1A 4QSXA 5DKDA 5J0DA 5AD2A 4NRCA 5FH7A 5D3RA 5DKHA 5I29A 2DWWA 2L5EA 4QSQA 5EPBA 2DKWA 2G4AA 5DFBA 4O74A 5IGLA 5EK9A 4QBMA 5D3LA 4F3IA 5FE4A 4CFKA 4RVRA 1N72A 4J0RA 4O76A 2D82A 5A5OA 4CFLA 4Q0NA 5TCMA 5A82A 3D7CA 5DFDA 2YQDA 2YEKA 3LQJA 4QUTA 4O78A 5DW2A 5F5ZA 5FFYA 4LYWA 5FFVA 4YYJA 5FE3A 5JI8A 1F68A 4TZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BT4 A;  4A9N A;  5ACY A;  4HXS A;  3UV2 A;  2N9G A;  5CQ8 A;  4LYS A;  2KTB B;  2F6J A;  4HBY A;  5ENG A;  4YBT A;  4QSU A;  3O35 A;  4UYF B;  5EGU A;  3I3J A;  4OGJ A;  2RS9 B;  5D3P A;  5IBN A;  5CZG A;  3QZT A;  4OGI A;  4NR8 A;  4QEW A;  5LJ1 A;  1WUG A;  4UIW A;  5KU3 A;  4TZ2 A;  4TU4 A;  4TT6 A;  5HM0 A;  5FE6 A;  4HXR A;  4QST A;  2YEM A;  5E9I A;  5A81 A;  3AAD A;  5FBX A;  5IID A;  4IOR A;  2R0V A;  4XY8 A;  5BT5 A;  2H60 A;  5DY7 A;  4NUE A;  4DON A;  4NQN A;  5I86 A;  5DKC A;  4NUD A;  4MEQ A;  5ENH A;  4YYK A;  5H85 A;  4O77 A;  5L98 A;  5EWW A;  2DVV A;  4WHU A;  4N4H A;  4QUU A;  4YH4 A;  4KV1 A;  3P1E A;  5FE9 A;  4LZR A;  1JM4 B;  3MB3 A;  5D3J A;  5ENB A;  5F63 A;  5FDZ A;  4ZC9 A;  4NYX A;  4BW4 A;  3MUK A;  4NR6 A;  3HMF A;  4CUS A;  5LVQ A;  5EA1 A;  5L99 A;  5I89 A;  5E9V A;  3ONI A;  1EQF A;  5HQ7 A;  5FE2 A;  5HRW A;  2FSA A;  5EWH A;  4TT2 A;  4QSV A;  4QR4 A;  5C7N A;  4QR5 A;  5HFQ A;  3Q2F A;  5EPR A;  3LQH A;  4YAX A;  5KHM A;  4NYW A;  5G4R A;  5CU8 A;  5E0R A;  5TB6 A;  3FKM X;  4IOQ A;  3K2J A;  5IG6 A;  5COI A;  4CUT A;  4YH3 A;  5F25 A;  4QSW A;  5F2P A;  3HME A;  3UV4 A;  3JVL A;  5FE7 A;  4A9J A;  5L8U A;  5E9K A;  5ENE A;  5HEL A;  2RNX A;  5EWC A;  5CQ6 A;  4MEO A;  5CS8 A;  4QSR A;  4UIU A;  5H1V A;  4QB3 A;  5CQ4 A;  4HBV A;  4N4I A;  5DYA A;  5I40 A;  4J1P A;  3JVM A;  4UIT A;  5LKU A;  4YYN A;  5I80 A;  3UVD A;  5ENJ A;  5LJ2 A;  4O7C A;  3G0J A;  3O37 A;  4IOO A;  4NR4 A;  2WP1 A;  4XUB A;  5DYC A;  4QR3 A;  4MEN A;  4YAD A;  2E7O A;  5LKZ A;  3DAI A;  3UVY A;  3IU5 A;  1E6I A;  2MJV B;  4KCX A;  5CUE A;  5L97 A;  3MXF A;  3JVK A;  2F6N A;  4YC9 A;  4O7A A;  5CUC A;  5I83 A;  4PS5 A;  4HXL A;  5CQ5 A;  2YDW A;  5I1Q A;  5HJC A;  4UIZ A;  4UYE A;  4A9I A;  4CUR A;  3G0L A;  5A7C A;  5D3N A;  4QSS A;  5HLS A;  4NXJ A;  5CQA A;  2RNW A;  4QEV A;  5A5Q A;  4UYH A;  5II1 A;  4HXK A;  5FH6 A;  3MUL A;  5CUA A;  3NXB A;  4FLP A;  4GPJ A;  5AMF A;  5A5N A;  2R10 A;  5KO4 A;  5EWV A;  4BHW A;  4UIY A;  3Q2E A;  2R0Y A;  4NRB A;  5DW1 A;  4LZ2 A;  5DX4 A;  4O7E A;  4CL9 A;  5A85 A;  3LQI A;  4TS8 A;  4CLB A;  4MR5 A;  4A9E A;  5D7X A;  4O7B A;  4KV4 A;  4PY6 A;  4XYA A;  5EI4 A;  3ZYU A;  5BT3 A;  5C85 A;  5EP7 A;  5EPS A;  5D3H A;  4Q0O A;  3TLP A;  4A9F A;  4TT4 A;  5ETB A;  4QEU A;  4YBS A;  3U5M A;  3UW9 A;  5L8T A;  5HFR A;  5DYX A;  4PKL A;  4X2I A;  4YYI A;  3QZV A;  5C8G A;  3MB4 A;  5K29 A;  5CFW A;  5C4Q A;  5DBM A;  5FG5 A;  3U5P A;  4A9O A;  4E96 A;  3U5O A;  4YY6 A;  4LRG A;  5CUD A;  2DAT A;  5EIS A;  2YYN A;  5A5P A;  2E3K A;  3P1C A;  2L84 A;  3P1D A;  5EU1 A;  5F3A A;  5HEM A;  4CUU A;  2GRC A;  4YYG A;  5AME A;  5FH8 A;  2YEL A;  4QZS A;  4QNS A;  4O71 A;  5G4S A;  4PCI A;  5E3D A;  5CRM A;  5CQ7 A;  5FE5 A;  4NYV A;  4LYI A;  4IR4 A;  4AKN A;  4QYD A;  4A9L A;  2DVQ A;  3LJW A;  2OO1 A;  1ZS5 A;  5EM3 A;  3O34 A;  4N3W A;  4A9M A;  4YYD A;  5LJ0 A;  3SVF A;  5FE8 A;  4HXM A;  4QYL A;  5HRX A;  4TTE A;  5F36 A;  3P5O A;  5H1U A;  3S92 A;  4J3I A;  5LKT A;  3U5J A;  4UYF A;  5D3S A;  1X0J A;  4UYD A;  5FB0 A;  5CTL A;  2LSP B;  4ZQL A;  3UVX A;  5JWM A;  4NRA A;  5IGM A;  2OSS A;  4BW1 A;  5LKX A;  1JSP B;  4BJX A;  4QC3 A;  5I7X A;  4Z6H A;  4HBW A;  4N4G A;  4CUQ A;  4J0S A;  4Z93 A;  3LXJ A;  4MEP A;  3S91 A;  5KTW A;  3U5L A;  4WIV A;  5HCL A;  5CUG A;  4IR5 A;  2I7K A;  4NR9 A;  3O33 A;  2RFJ A;  5II2 A;  4OUF A;  5KTX A;  4HXP A;  5CGP A;  4WHW A;  3MQM A;  4O72 A;  5F60 A;  4MR4 A;  4O7F A;  4HXN A;  5D3T A;  4YYH A;  5KTU A;  4MR6 A;  5HQ6 A;  3IU6 A;  4XY9 A;  5DFC A;  4A9H A;  4UIV A;  5E9Y A;  5LUU A;  3O36 A;  5ENF A;  5D26 A;  5ETD A;  4Z6I A;  5HEN A;  4TU6 A;  3UVW A;  5FE1 A;  5E7D A;  2RO1 A;  4QC1 A;  5CP5 A;  5CPE A;  4YAT A;  4UIX A;  4YK0 A;  4LR6 A;  5I7Y A;  5LVR A;  5ENI A;  1WUM A;  4BW2 A;  2RI7 A;  5C89 A;  4QSP A;  4C67 A;  5AD3 A;  4ALG A;  5EQ1 A;  5IGN A;  4HBX A;  2D9E A;  4PCE A;  5FG4 A;  5I88 A;  2NXB A;  3SVG A;  3AQA A;  4ALH A;  5CY9 A;  5DLZ A;  5EIC A;  5DLX A;  4LZS A;  4C66 A;  4YAB A;  4PTB A;  4TQN A;  5CQT A;  5L96 A;  5F61 A;  5ENC A;  2YW5 A;  3JVJ A;  4YY4 A;  5E3G A;  4Y03 A;  5D25 A;  5IGK A;  2DVR A;  3QZS A;  5A5R A;  5F62 A;  5D24 A;  4UYG A;  5E9L A;  4A9K A;  3GG3 A;  4TYL A;  4O70 A;  3U5K A;  5C87 A;  4QY4 A;  4NR7 A;  5FB1 A;  4YYM A;  4YBM A;  5DYU A;  5EV9 A;  4IR6 A;  4NR5 A;  5HQ5 A;  5F1H A;  4Z1S A;  3UV5 A;  3DWY A;  4N4F A;  2E7N A;  5E74 A;  4NUC A;  3SVH A;  2WP2 A;  2RNY A;  5EVA A;  2R0S A;  5D0C A;  4Z1Q A;  5FE0 A;  5CQ3 A;  3P1F A;  4LC2 A;  4NS5 A;  5FG6 A;  3HMH A;  3U5N A;  4LDF A;  4CUP A;  5A83 A;  5A5S A;  4O75 A;  5H1T A;  4MR3 A;  4NQM A;  2I8N A;  4IR3 A;  5CRZ A;  2L85 A;  4BW3 A;  4HXO A;  5E9M A;  3RCW A;  5F1L A;  4XUA A;  5FFW A;  5CUB A;  2OUO A;  2DVS A;  5E73 A;  5EWD A;  5HRV A;  4ZW1 A;  4QSX A;  5DKD A;  5J0D A;  5AD2 A;  4NRC A;  5FH7 A;  5D3R A;  5DKH A;  5I29 A;  2DWW A;  2L5E A;  4QSQ A;  5EPB A;  2DKW A;  2G4A A;  5DFB A;  4O74 A;  5IGL A;  5EK9 A;  4QBM A;  5D3L A;  4F3I A;  5FE4 A;  4CFK A;  4RVR A;  1N72 A;  4J0R A;  4O76 A;  2D82 A;  5A5O A;  4CFL A;  4Q0N A;  5TCM A;  5A82 A;  3D7C A;  5DFD A;  2YQD A;  2YEK A;  3LQJ A;  4QUT A;  4O78 A;  5DW2 A;  5F5Z A;  5FFY A;  4LYW A;  5FFV A;  4YYJ A;  5FE3 A;  5JI8 A;  1F68 A;  4TZ8 A; 
#chains in the Genus database with same CATH topology
 5BT4 A;  4A9N A;  5ACY A;  4HXS A;  3UV2 A;  2N9G A;  5CQ8 A;  4LYS A;  2KTB B;  2F6J A;  4HBY A;  5ENG A;  4YBT A;  4QSU A;  3O35 A;  4UYF B;  5EGU A;  3I3J A;  4OGJ A;  2RS9 B;  5D3P A;  5IBN A;  5CZG A;  3QZT A;  4OGI A;  4NR8 A;  4QEW A;  5LJ1 A;  1WUG A;  4UIW A;  5KU3 A;  4TZ2 A;  4TU4 A;  4TT6 A;  5HM0 A;  5FE6 A;  4HXR A;  4QST A;  2YEM A;  5E9I A;  5A81 A;  3AAD A;  5FBX A;  5IID A;  4IOR A;  2R0V A;  4XY8 A;  5BT5 A;  2H60 A;  5DY7 A;  4NUE A;  4DON A;  4NQN A;  5I86 A;  5DKC A;  4NUD A;  4MEQ A;  5ENH A;  4YYK A;  5H85 A;  4O77 A;  5L98 A;  5EWW A;  2DVV A;  4WHU A;  4N4H A;  4QUU A;  4YH4 A;  4KV1 A;  3P1E A;  5FE9 A;  4LZR A;  1JM4 B;  3MB3 A;  5D3J A;  5ENB A;  5F63 A;  5FDZ A;  4ZC9 A;  4NYX A;  4BW4 A;  3MUK A;  4NR6 A;  3HMF A;  4CUS A;  5LVQ A;  5EA1 A;  5L99 A;  5I89 A;  5E9V A;  3ONI A;  1EQF A;  5HQ7 A;  5FE2 A;  5HRW A;  2FSA A;  5EWH A;  4TT2 A;  4QSV A;  4QR4 A;  5C7N A;  4QR5 A;  5HFQ A;  3Q2F A;  5EPR A;  3LQH A;  4YAX A;  5KHM A;  4NYW A;  5G4R A;  5CU8 A;  5E0R A;  5TB6 A;  3FKM X;  4IOQ A;  3K2J A;  5IG6 A;  5COI A;  4CUT A;  4YH3 A;  5F25 A;  4QSW A;  5F2P A;  3HME A;  3UV4 A;  3JVL A;  5FE7 A;  4A9J A;  5L8U A;  5E9K A;  5ENE A;  5HEL A;  2RNX A;  5EWC A;  5CQ6 A;  4MEO A;  5CS8 A;  4QSR A;  4UIU A;  5H1V A;  4QB3 A;  5CQ4 A;  4HBV A;  4N4I A;  5DYA A;  5I40 A;  4J1P A;  3D1D A;  3JVM A;  4UIT A;  5LKU A;  4YYN A;  5I80 A;  3UVD A;  5ENJ A;  5LJ2 A;  4O7C A;  3G0J A;  3O37 A;  4IOO A;  4NR4 A;  2WP1 A;  4XUB A;  5DYC A;  4QR3 A;  4MEN A;  4YAD A;  2E7O A;  5LKZ A;  3DAI A;  3UVY A;  3IU5 A;  1E6I A;  2MJV B;  4KCX A;  5CUE A;  5L97 A;  3MXF A;  3JVK A;  2F6N A;  4YC9 A;  4O7A A;  5CUC A;  5I83 A;  4PS5 A;  4HXL A;  5CQ5 A;  2YDW A;  5I1Q A;  5HJC A;  4UIZ A;  4UYE A;  4A9I A;  4CUR A;  3G0L A;  5A7C A;  5D3N A;  3VKG A;  4QSS A;  5HLS A;  4NXJ A;  5CQA A;  2RNW A;  4QEV A;  5A5Q A;  4UYH A;  5II1 A;  4HXK A;  5FH6 A;  3MUL A;  5CUA A;  3NXB A;  4FLP A;  4GPJ A;  5AMF A;  5A5N A;  2R10 A;  5KO4 A;  5EWV A;  4BHW A;  4UIY A;  3Q2E A;  2R0Y A;  4NRB A;  5DW1 A;  4LZ2 A;  5DX4 A;  4O7E A;  4CL9 A;  5A85 A;  3LQI A;  4TS8 A;  4CLB A;  4MR5 A;  4A9E A;  5D7X A;  3ERR A;  4O7B A;  4KV4 A;  4PY6 A;  4XYA A;  5EI4 A;  3ZYU A;  5BT3 A;  5C85 A;  5EP7 A;  5EPS A;  5D3H A;  4Q0O A;  3TLP A;  4A9F A;  4TT4 A;  5ETB A;  4QEU A;  4YBS A;  3U5M A;  3UW9 A;  5L8T A;  5HFR A;  5DYX A;  4PKL A;  4X2I A;  4YYI A;  3QZV A;  5C8G A;  3MB4 A;  5K29 A;  5CFW A;  5C4Q A;  5DBM A;  5FG5 A;  3U5P A;  4A9O A;  4E96 A;  3U5O A;  4YY6 A;  4LRG A;  5CUD A;  2DAT A;  5EIS A;  2YYN A;  5A5P A;  2E3K A;  3P1C A;  2L84 A;  3P1D A;  5EU1 A;  5F3A A;  5HEM A;  4CUU A;  2GRC A;  4YYG A;  5AME A;  5FH8 A;  2YEL A;  4QZS A;  4QNS A;  4O71 A;  5G4S A;  4PCI A;  5E3D A;  5CRM A;  5CQ7 A;  5FE5 A;  4NYV A;  4LYI A;  4IR4 A;  4AKN A;  4QYD A;  4A9L A;  2DVQ A;  3LJW A;  2OO1 A;  1ZS5 A;  5EM3 A;  3VKH A;  3O34 A;  4N3W A;  4A9M A;  4YYD A;  5LJ0 A;  3SVF A;  5FE8 A;  4HXM A;  4QYL A;  4AKH A;  5HRX A;  4TTE A;  5F36 A;  3P5O A;  5H1U A;  3S92 A;  4J3I A;  1ZKR A;  5LKT A;  3U5J A;  4UYF A;  5D3S A;  1X0J A;  4UYD A;  5FB0 A;  5CTL A;  2LSP B;  4ZQL A;  3UVX A;  5JWM A;  4NRA A;  5IGM A;  2OSS A;  4BW1 A;  5LKX A;  1JSP B;  4BJX A;  4QC3 A;  5I7X A;  4Z6H A;  4HBW A;  4N4G A;  4CUQ A;  4J0S A;  4Z93 A;  3LXJ A;  4MEP A;  3S91 A;  5KTW A;  3U5L A;  4WIV A;  5HCL A;  5CUG A;  4IR5 A;  2I7K A;  4NR9 A;  3O33 A;  2RFJ A;  5II2 A;  4OUF A;  5KTX A;  4HXP A;  5CGP A;  4WHW A;  3MQM A;  4O72 A;  5F60 A;  4MR4 A;  4O7F A;  4HXN A;  5D3T A;  4YYH A;  5KTU A;  4MR6 A;  5HQ6 A;  3IU6 A;  4XY9 A;  5DFC A;  4A9H A;  4UIV A;  5E9Y A;  5LUU A;  3O36 A;  5ENF A;  5D26 A;  5ETD A;  4Z6I A;  5HEN A;  4TU6 A;  3UVW A;  5FE1 A;  5E7D A;  2RO1 A;  4QC1 A;  5CP5 A;  5CPE A;  4YAT A;  4UIX A;  4YK0 A;  4LR6 A;  5I7Y A;  5LVR A;  5ENI A;  1WUM A;  4BW2 A;  2RI7 A;  5C89 A;  4QSP A;  4C67 A;  5AD3 A;  4ALG A;  4AKI A;  5EQ1 A;  5IGN A;  4HBX A;  2D9E A;  4PCE A;  5FG4 A;  5I88 A;  2NXB A;  3SVG A;  3AQA A;  4ALH A;  5CY9 A;  5DLZ A;  5EIC A;  5DLX A;  4LZS A;  4C66 A;  4YAB A;  4PTB A;  4TQN A;  5CQT A;  5L96 A;  5F61 A;  5ENC A;  2YW5 A;  3JVJ A;  4YY4 A;  5E3G A;  4Y03 A;  5D25 A;  5IGK A;  2DVR A;  3QZS A;  5A5R A;  5F62 A;  5D24 A;  4UYG A;  5E9L A;  4A9K A;  3GG3 A;  4TYL A;  4O70 A;  3U5K A;  5C87 A;  4QY4 A;  4NR7 A;  5FB1 A;  4YYM A;  4YBM A;  5DYU A;  5EV9 A;  4IR6 A;  4NR5 A;  5HQ5 A;  5F1H A;  4Z1S A;  3UV5 A;  3DWY A;  4N4F A;  2E7N A;  5E74 A;  4NUC A;  3SVH A;  2WP2 A;  2RNY A;  5EVA A;  2R0S A;  5D0C A;  4Z1Q A;  5FE0 A;  5CQ3 A;  3P1F A;  4LC2 A;  4NS5 A;  5FG6 A;  3HMH A;  3U5N A;  4LDF A;  2EJN A;  4CUP A;  5A83 A;  5A5S A;  4O75 A;  5H1T A;  4MR3 A;  4AKG A;  4NQM A;  2I8N A;  4IR3 A;  5CRZ A;  2L85 A;  4BW3 A;  4HXO A;  5E9M A;  3RCW A;  5F1L A;  4XUA A;  5FFW A;  5CUB A;  2OUO A;  2DVS A;  5E73 A;  5EWD A;  5HRV A;  4ZW1 A;  4QSX A;  5DKD A;  5J0D A;  5AD2 A;  4AI6 A;  4NRC A;  5FH7 A;  5D3R A;  5DKH A;  5I29 A;  2DWW A;  2L5E A;  4QSQ A;  5EPB A;  2DKW A;  2G4A A;  3D1B A;  5DFB A;  4O74 A;  5IGL A;  5EK9 A;  4QBM A;  5D3L A;  4F3I A;  5FE4 A;  4CFK A;  4RVR A;  1N72 A;  4J0R A;  4O76 A;  2D82 A;  5A5O A;  4CFL A;  4Q0N A;  5TCM A;  5A82 A;  3D7C A;  5DFD A;  2YQD A;  2YEK A;  3LQJ A;  4QUT A;  4O78 A;  5DW2 A;  5F5Z A;  5FFY A;  4LYW A;  5FFV A;  4YYJ A;  5FE3 A;  5JI8 A;  1PUO A;  1F68 A;  4TZ8 A; 
#chains in the Genus database with same CATH homology
 5BT4 A;  4A9N A;  5ACY A;  4HXS A;  3UV2 A;  2N9G A;  5CQ8 A;  4LYS A;  2KTB B;  2F6J A;  4HBY A;  5ENG A;  4YBT A;  4QSU A;  3O35 A;  4UYF B;  5EGU A;  3I3J A;  4OGJ A;  2RS9 B;  5D3P A;  5IBN A;  5CZG A;  3QZT A;  4OGI A;  4NR8 A;  4QEW A;  5LJ1 A;  1WUG A;  4UIW A;  5KU3 A;  4TZ2 A;  4TU4 A;  4TT6 A;  5HM0 A;  5FE6 A;  4HXR A;  4QST A;  2YEM A;  5E9I A;  5A81 A;  3AAD A;  5FBX A;  5IID A;  4IOR A;  2R0V A;  4XY8 A;  5BT5 A;  2H60 A;  5DY7 A;  4NUE A;  4DON A;  4NQN A;  5I86 A;  5DKC A;  4NUD A;  4MEQ A;  5ENH A;  4YYK A;  5H85 A;  4O77 A;  5L98 A;  5EWW A;  2DVV A;  4WHU A;  4N4H A;  4QUU A;  4YH4 A;  4KV1 A;  3P1E A;  5FE9 A;  4LZR A;  1JM4 B;  3MB3 A;  5D3J A;  5ENB A;  5F63 A;  5FDZ A;  4ZC9 A;  4NYX A;  4BW4 A;  3MUK A;  4NR6 A;  3HMF A;  4CUS A;  5LVQ A;  5EA1 A;  5L99 A;  5I89 A;  5E9V A;  3ONI A;  1EQF A;  5HQ7 A;  5FE2 A;  5HRW A;  2FSA A;  5EWH A;  4TT2 A;  4QSV A;  4QR4 A;  5C7N A;  4QR5 A;  5HFQ A;  3Q2F A;  5EPR A;  3LQH A;  4YAX A;  5KHM A;  4NYW A;  5G4R A;  5CU8 A;  5E0R A;  5TB6 A;  3FKM X;  4IOQ A;  3K2J A;  5IG6 A;  5COI A;  4CUT A;  4YH3 A;  5F25 A;  4QSW A;  5F2P A;  3HME A;  3UV4 A;  3JVL A;  5FE7 A;  4A9J A;  5L8U A;  5E9K A;  5ENE A;  5HEL A;  2RNX A;  5EWC A;  5CQ6 A;  4MEO A;  5CS8 A;  4QSR A;  4UIU A;  5H1V A;  4QB3 A;  5CQ4 A;  4HBV A;  4N4I A;  5DYA A;  5I40 A;  4J1P A;  3JVM A;  4UIT A;  5LKU A;  4YYN A;  5I80 A;  3UVD A;  5ENJ A;  5LJ2 A;  4O7C A;  3G0J A;  3O37 A;  4IOO A;  4NR4 A;  2WP1 A;  4XUB A;  5DYC A;  4QR3 A;  4MEN A;  4YAD A;  2E7O A;  5LKZ A;  3DAI A;  3UVY A;  3IU5 A;  1E6I A;  2MJV B;  4KCX A;  5CUE A;  5L97 A;  3MXF A;  3JVK A;  2F6N A;  4YC9 A;  4O7A A;  5CUC A;  5I83 A;  4PS5 A;  4HXL A;  5CQ5 A;  2YDW A;  5I1Q A;  5HJC A;  4UIZ A;  4UYE A;  4A9I A;  4CUR A;  3G0L A;  5A7C A;  5D3N A;  4QSS A;  5HLS A;  4NXJ A;  5CQA A;  2RNW A;  4QEV A;  5A5Q A;  4UYH A;  5II1 A;  4HXK A;  5FH6 A;  3MUL A;  5CUA A;  3NXB A;  4FLP A;  4GPJ A;  5AMF A;  5A5N A;  2R10 A;  5KO4 A;  5EWV A;  4BHW A;  4UIY A;  3Q2E A;  2R0Y A;  4NRB A;  5DW1 A;  4LZ2 A;  5DX4 A;  4O7E A;  4CL9 A;  5A85 A;  3LQI A;  4TS8 A;  4CLB A;  4MR5 A;  4A9E A;  5D7X A;  4O7B A;  4KV4 A;  4PY6 A;  4XYA A;  5EI4 A;  3ZYU A;  5BT3 A;  5C85 A;  5EP7 A;  5EPS A;  5D3H A;  4Q0O A;  3TLP A;  4A9F A;  4TT4 A;  5ETB A;  4QEU A;  4YBS A;  3U5M A;  3UW9 A;  5L8T A;  5HFR A;  5DYX A;  4PKL A;  4X2I A;  4YYI A;  3QZV A;  5C8G A;  3MB4 A;  5K29 A;  5CFW A;  5C4Q A;  5DBM A;  5FG5 A;  3U5P A;  4A9O A;  4E96 A;  3U5O A;  4YY6 A;  4LRG A;  5CUD A;  2DAT A;  5EIS A;  2YYN A;  5A5P A;  2E3K A;  3P1C A;  2L84 A;  3P1D A;  5EU1 A;  5F3A A;  5HEM A;  4CUU A;  2GRC A;  4YYG A;  5AME A;  5FH8 A;  2YEL A;  4QZS A;  4QNS A;  4O71 A;  5G4S A;  4PCI A;  5E3D A;  5CRM A;  5CQ7 A;  5FE5 A;  4NYV A;  4LYI A;  4IR4 A;  4AKN A;  4QYD A;  4A9L A;  2DVQ A;  3LJW A;  2OO1 A;  1ZS5 A;  5EM3 A;  3O34 A;  4N3W A;  4A9M A;  4YYD A;  5LJ0 A;  3SVF A;  5FE8 A;  4HXM A;  4QYL A;  5HRX A;  4TTE A;  5F36 A;  3P5O A;  5H1U A;  3S92 A;  4J3I A;  5LKT A;  3U5J A;  4UYF A;  5D3S A;  1X0J A;  4UYD A;  5FB0 A;  5CTL A;  2LSP B;  4ZQL A;  3UVX A;  5JWM A;  4NRA A;  5IGM A;  2OSS A;  4BW1 A;  5LKX A;  1JSP B;  4BJX A;  4QC3 A;  5I7X A;  4Z6H A;  4HBW A;  4N4G A;  4CUQ A;  4J0S A;  4Z93 A;  3LXJ A;  4MEP A;  3S91 A;  5KTW A;  3U5L A;  4WIV A;  5HCL A;  5CUG A;  4IR5 A;  2I7K A;  4NR9 A;  3O33 A;  2RFJ A;  5II2 A;  4OUF A;  5KTX A;  4HXP A;  5CGP A;  4WHW A;  3MQM A;  4O72 A;  5F60 A;  4MR4 A;  4O7F A;  4HXN A;  5D3T A;  4YYH A;  5KTU A;  4MR6 A;  5HQ6 A;  3IU6 A;  4XY9 A;  5DFC A;  4A9H A;  4UIV A;  5E9Y A;  5LUU A;  3O36 A;  5ENF A;  5D26 A;  5ETD A;  4Z6I A;  5HEN A;  4TU6 A;  3UVW A;  5FE1 A;  5E7D A;  2RO1 A;  4QC1 A;  5CP5 A;  5CPE A;  4YAT A;  4UIX A;  4YK0 A;  4LR6 A;  5I7Y A;  5LVR A;  5ENI A;  1WUM A;  4BW2 A;  2RI7 A;  5C89 A;  4QSP A;  4C67 A;  5AD3 A;  4ALG A;  5EQ1 A;  5IGN A;  4HBX A;  2D9E A;  4PCE A;  5FG4 A;  5I88 A;  2NXB A;  3SVG A;  3AQA A;  4ALH A;  5CY9 A;  5DLZ A;  5EIC A;  5DLX A;  4LZS A;  4C66 A;  4YAB A;  4PTB A;  4TQN A;  5CQT A;  5L96 A;  5F61 A;  5ENC A;  2YW5 A;  3JVJ A;  4YY4 A;  5E3G A;  4Y03 A;  5D25 A;  5IGK A;  2DVR A;  3QZS A;  5A5R A;  5F62 A;  5D24 A;  4UYG A;  5E9L A;  4A9K A;  3GG3 A;  4TYL A;  4O70 A;  3U5K A;  5C87 A;  4QY4 A;  4NR7 A;  5FB1 A;  4YYM A;  4YBM A;  5DYU A;  5EV9 A;  4IR6 A;  4NR5 A;  5HQ5 A;  5F1H A;  4Z1S A;  3UV5 A;  3DWY A;  4N4F A;  2E7N A;  5E74 A;  4NUC A;  3SVH A;  2WP2 A;  2RNY A;  5EVA A;  2R0S A;  5D0C A;  4Z1Q A;  5FE0 A;  5CQ3 A;  3P1F A;  4LC2 A;  4NS5 A;  5FG6 A;  3HMH A;  3U5N A;  4LDF A;  4CUP A;  5A83 A;  5A5S A;  4O75 A;  5H1T A;  4MR3 A;  4NQM A;  2I8N A;  4IR3 A;  5CRZ A;  2L85 A;  4BW3 A;  4HXO A;  5E9M A;  3RCW A;  5F1L A;  4XUA A;  5FFW A;  5CUB A;  2OUO A;  2DVS A;  5E73 A;  5EWD A;  5HRV A;  4ZW1 A;  4QSX A;  5DKD A;  5J0D A;  5AD2 A;  4NRC A;  5FH7 A;  5D3R A;  5DKH A;  5I29 A;  2DWW A;  2L5E A;  4QSQ A;  5EPB A;  2DKW A;  2G4A A;  5DFB A;  4O74 A;  5IGL A;  5EK9 A;  4QBM A;  5D3L A;  4F3I A;  5FE4 A;  4CFK A;  4RVR A;  1N72 A;  4J0R A;  4O76 A;  2D82 A;  5A5O A;  4CFL A;  4Q0N A;  5TCM A;  5A82 A;  3D7C A;  5DFD A;  2YQD A;  2YEK A;  3LQJ A;  4QUT A;  4O78 A;  5DW2 A;  5F5Z A;  5FFY A;  4LYW A;  5FFV A;  4YYJ A;  5FE3 A;  5JI8 A;  1F68 A;  4TZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...