4YY6A

Crystal structure of brd9 bromodomain bound to a butyryllysine peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
102
structure length
102
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Bromodomain-containing protein 9
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yy6A00
4TT6A 5FH7A 2RS9B 2RO1A 5A85A 5G4SA 5CY9A 3SVGA 5HJCA 5LKTA 4A9KA 2R0YA 4YADA 5ENIA 5C4QA 1EQFA 5CFWA 5L8TA 5D26A 3NXBA 2RNYA 2F6JA 5DFBA 3TLPA 5FG6A 5HENA 4YK0A 3DWYA 4YYIA 5IIDA 4RVRA 4HXSA 4BW3A 1ZS5A 4YYDA 4QSWA 4N4FA 4UIVA 5EM3A 3U5PA 4NS5A 4QYLA 3U5LA 4Z1QA 5C8GA 4HBVA 5FE5A 5E3DA 4YYMA 5E9VA 1E6IA 2RNXA 5HRXA 5L99A 5FE2A 2R10A 5IGKA 4UYGA 4QUTA 2OO1A 4QSTA 5EWCA 4TU4A 5LVQA 4YATA 5DKDA 3JVMA 4X2IA 5D3RA 4A9IA 5FB0A 4C66A 5EPSA 5LKUA 4XUAA 5LUUA 5HQ6A 4WHWA 5A5PA 5EPBA 5EA1A 4CUSA 5F3AA 5CGPA 3LXJA 5IGNA 5ENFA 4MEOA 4HXNA 4QSXA 5A5OA 3JVJA 5EU1A 4FLPA 5FE7A 5A5NA 3MXFA 3IU6A 4NYWA 2DVSA 4LRGA 4A9EA 5C89A 5FB1A 4NR7A 5DKHA 4NR9A 5FE3A 5L96A 2I7KA 5HRVA 5CUDA 2DATA 4HXMA 4HXOA 4CURA 4QBMA 5EI4A 3S92A 5DLZA 4N3WA 5EWWA 5D25A 3MB4A 5LJ2A 5FG5A 5E9IA 4N4GA 5IGMA 2L84A 2RI7A 3UVYA 4A9HA 2R0VA 5D3LA 4CFKA 4HXKA 5E9MA 3DAIA 2OUOA 1WUMA 4O7EA 4UYDA 5EWVA 4CLBA 1JSPB 5C87A 5FH6A 5F63A 5FDZA 5CUGA 5EVAA 4LYWA 4LR6A 5DFDA 5LJ0A 4NUCA 5D7XA 4A9OA 5FFWA 4WIVA 5CPEA 4NR6A 5DYAA 4LZRA 4N4HA 2F6NA 5CQ5A 4QC3A 4ZW1A 5F1HA 4XYAA 4UIUA 2NXBA 3UV4A 5CQ3A 5ENGA 4KV1A 4MEPA 5CUBA 5IG6A 4TQNA 2H60A 4O76A 3QZVA 4QUUA 5CRZA 5KTUA 4OGJA 3UV5A 3LQIA 4QY4A 4O7CA 4Q0NA 4O77A 4UYHA 5E73A 3P1FA 4Z93A 4O78A 2DWWA 4A9NA 5EWDA 4ALGA 4CUUA 4TZ2A 4QSVA 3U5MA 3K2JA 4QEUA 4BHWA 4HBYA 4LZSA 5EISA 5A5RA 5II1A 5FE8A 5J0DA 3JVLA 4YC9A 4HXPA 4PKLA 5HELA 5D3PA 5EK9A 5CQ8A 5D3HA 5BT5A 4LC2A 5HQ7A 5CS8A 3LQJA 4TU6A 4YY6A 4MR4A 5DY7A 4QR5A 4HBXA 5E9YA 3RCWA 4UYFA 4UITA 5A82A 4XY9A 4NRBA 2DVRA 4NXJA 5CP5A 5IGLA 5I7XA 5ENEA 4O70A 4QEWA 4QSSA 3P1EA 5KO4A 4MEQA 5C7NA 5FH8A 5FE1A 3D7CA 3P1CA 3FKMX 5BT3A 5ENHA 2YEMA 5F1LA 2KTBB 3SVFA 5FG4A 5EP7A 4PY6A 4IR4A 4A9FA 5DYCA 4A9JA 4MR3A 4QNSA 2YDWA 4CFLA 4HBWA 5D3JA 5KTWA 2YQDA 4NUDA 5AMEA 5ACYA 4MENA 5F2PA 2E7OA 4PCEA 4CL9A 4HXLA 5E7DA 5JWMA 5FBXA 4O71A 4Z6HA 4KV4A 4OGIA 4QSQA 4NR4A 4A9LA 5CUCA 5L98A 2MJVB 4UIXA 1WUGA 4NYVA 5F36A 3O34A 3HMFA 3I3JA 4QYDA 4YYJA 4J0RA 4LDFA 5LJ1A 5FE4A 5ENCA 5II2A 4A9MA 4J0SA 5EPRA 3P5OA 4QSUA 5H1TA 4N4IA 4ALHA 3MUKA 4PTBA 5KHMA 2G4AA 3QZSA 5I88A 4BW2A 4J3IA 2D82A 4YAXA 3Q2FA 3U5JA 3LQHA 4QSRA 4CUPA 5A81A 2OSSA 5HFRA 5HEMA 5DLXA 4UYEA 4CUTA 4Z6IA 3SVHA 5CUEA 4WHUA 5DX4A 5EWHA 5TB6A 5CQ7A 3P1DA 3S91A 5CQTA 2GRCA 4OUFA 4O74A 3Q2EA 4NR5A 3G0JA 4PS5A 4Y03A 2N9GA 5E9KA 4O7AA 2L5EA 4YBSA 4TZ8A 5D0CA 4NR8A 4Z1SA 5AD3A 5COIA 4NQNA 5CQ6A 4UYFB 4UIZA 2I8NA 4CUQA 2YEKA 2RNWA 4IR3A 5F61A 4J1PA 5AMFA 2WP2A 5BT4A 5ENBA 4UIWA 4NRCA 5HFQA 5D3TA 4YBMA 4QR3A 3U5NA 3ZYUA 4IOOA 5LKXA 4PCIA 5TCMA 3O37A 3UVWA 5L8UA 3G0LA 4O75A 4IOQA 5D3SA 4KCXA 5H1UA 4F3IA 4LYSA 5A7CA 4QR4A 5ETBA 4O7FA 2RFJA 5KU3A 4LYIA 4YY4A 5HQ5A 4UIYA 3O36A 5K29A 3U5OA 2YELA 4YBTA 5JI8A 5I7YA 4QSPA 4TS8A 5DBMA 5G4RA 5E3GA 3UVXA 4YYKA 2E7NA 4NUEA 5CQ4A 5E9LA 5IBNA 5F25A 5KTXA 3IU5A 5I86A 5A5SA 5ENJA 5ETDA 5C85A 5FE0A 4XY8A 4BW1A 2DVQA 4TYLA 5EGUA 5CUAA 5HLSA 4IR5A 5LVRA 4TT4A 3UVDA 5F62A 3GG3A 4ZC9A 4YYHA 4Q0OA 5A83A 4BJXA 4TTEA 4YH4A 5AD2A 5LKZA 5I89A 5L97A 5H1VA 3JVKA 2R0SA 4MR6A 3LJWA 1X0JA 3QZTA 4LZ2A 5DFCA 5D24A 4E96A 5I29A 2WP1A 3MB3A 5CQAA 3HMEA 4AKNA 4YH3A 5FE9A 5CZGA 5A5QA 3MULA 5HRWA 5DW2A 5I83A 5FFYA 4YABA 3UW9A 2YW5A 5D3NA 3AADA 5CRMA 4IR6A 2DKWA 4NRAA 1N72A 5EQ1A 4QZSA 3O33A 3ONIA 4GPJA 3O35A 2D9EA 3AQAA 2YYNA 4YYNA 5DW1A 3HMHA 4O72A 4XUBA 5CTLA 5HM0A 1F68A 5FE6A 4O7BA 1JM4B 5DYXA 4QC1A 2L85A 4ZQLA 4MR5A 4C67A 4NQMA 5I40A 3UV2A 4NYXA 5F60A 2LSPB 5I1QA 5E0RA 5E74A 5DYUA 5H85A 2FSAA 5FFVA 5HCLA 5I80A 4HXRA 5DKCA 2DVVA 4YYGA 5EV9A 5F5ZA 5EICA 4IORA 4TT2A 4BW4A 3MQMA 4DONA 4QB3A 5CU8A 2E3KA 3U5KA 4QEVA
chains in the Genus database with same CATH superfamily
1ZKRA 4TT6A 5FH7A 2RS9B 2RO1A 5A85A 5G4SA 5CY9A 3SVGA 5HJCA 5LKTA 4A9KA 2R0YA 4YADA 5ENIA 5C4QA 1EQFA 5CFWA 5L8TA 5D26A 3NXBA 2RNYA 2F6JA 5DFBA 3TLPA 5FG6A 5HENA 4YK0A 3DWYA 4YYIA 5IIDA 4RVRA 4HXSA 4BW3A 1ZS5A 4YYDA 4QSWA 4N4FA 4UIVA 5EM3A 3U5PA 4NS5A 4QYLA 3U5LA 4Z1QA 5C8GA 4HBVA 5FE5A 5E3DA 4YYMA 5E9VA 1E6IA 2RNXA 5HRXA 5L99A 5FE2A 2R10A 5IGKA 4UYGA 4QUTA 2OO1A 4QSTA 5EWCA 4TU4A 5LVQA 4YATA 5DKDA 3JVMA 4X2IA 5D3RA 4A9IA 5FB0A 4C66A 5EPSA 5LKUA 4XUAA 5LUUA 5HQ6A 4WHWA 5A5PA 5EPBA 5EA1A 4CUSA 5F3AA 5CGPA 3LXJA 5IGNA 5ENFA 4MEOA 4HXNA 4QSXA 5A5OA 3JVJA 5EU1A 4FLPA 5FE7A 5A5NA 3MXFA 3IU6A 4NYWA 2DVSA 4LRGA 4A9EA 5C89A 5FB1A 4NR7A 5DKHA 4NR9A 5FE3A 5L96A 2I7KA 5HRVA 5CUDA 2DATA 4HXMA 4HXOA 4CURA 4QBMA 5EI4A 3S92A 5DLZA 4N3WA 5EWWA 5D25A 3MB4A 5LJ2A 4AKGA 5FG5A 5E9IA 4N4GA 5IGMA 2L84A 2RI7A 3UVYA 4A9HA 2R0VA 5D3LA 4CFKA 4HXKA 5E9MA 3DAIA 2OUOA 1WUMA 4O7EA 4UYDA 5EWVA 4CLBA 1JSPB 5C87A 5FH6A 5F63A 5FDZA 5CUGA 5EVAA 4LYWA 4LR6A 5DFDA 5LJ0A 4NUCA 5D7XA 4A9OA 5FFWA 4WIVA 5CPEA 4NR6A 5DYAA 4LZRA 4N4HA 2F6NA 5CQ5A 4QC3A 4ZW1A 5F1HA 4XYAA 4UIUA 2NXBA 3UV4A 5CQ3A 5ENGA 4KV1A 4MEPA 5CUBA 5IG6A 4TQNA 2H60A 4O76A 3QZVA 4QUUA 5CRZA 5KTUA 4OGJA 3UV5A 3LQIA 4QY4A 4O7CA 4Q0NA 4O77A 4UYHA 5E73A 3P1FA 4Z93A 4O78A 2DWWA 4A9NA 5EWDA 4ALGA 4CUUA 4TZ2A 4QSVA 3U5MA 3K2JA 4QEUA 4BHWA 4HBYA 4LZSA 5EISA 5A5RA 5II1A 5FE8A 5J0DA 3JVLA 4YC9A 4HXPA 4PKLA 5HELA 4AKHA 5D3PA 5EK9A 5CQ8A 5D3HA 5BT5A 4LC2A 5HQ7A 5CS8A 3LQJA 4TU6A 4YY6A 4MR4A 5DY7A 4QR5A 4HBXA 5E9YA 3RCWA 4UYFA 4AI6A 2EJNA 4UITA 5A82A 4XY9A 4NRBA 2DVRA 4NXJA 3VKGA 5CP5A 5IGLA 5I7XA 5ENEA 4O70A 4QEWA 4QSSA 3P1EA 5KO4A 3ERRA 4MEQA 5C7NA 5FH8A 5FE1A 3D7CA 3P1CA 3FKMX 5BT3A 5ENHA 2YEMA 5F1LA 2KTBB 3SVFA 5FG4A 5EP7A 4PY6A 4IR4A 4A9FA 5DYCA 4A9JA 4MR3A 4QNSA 2YDWA 4CFLA 4HBWA 5D3JA 5KTWA 2YQDA 4NUDA 5AMEA 5ACYA 4MENA 5F2PA 2E7OA 4PCEA 4CL9A 4HXLA 5E7DA 5JWMA 5FBXA 4O71A 4Z6HA 4KV4A 4OGIA 4QSQA 4NR4A 4A9LA 5CUCA 5L98A 2MJVB 4UIXA 1WUGA 4NYVA 5F36A 3O34A 3HMFA 3I3JA 4QYDA 4YYJA 4J0RA 4LDFA 5LJ1A 5FE4A 5ENCA 5II2A 4AKIA 4A9MA 4J0SA 5EPRA 3P5OA 4QSUA 5H1TA 4N4IA 4ALHA 3MUKA 4PTBA 5KHMA 2G4AA 3QZSA 5I88A 4BW2A 4J3IA 2D82A 4YAXA 3Q2FA 3U5JA 3LQHA 4QSRA 4CUPA 5A81A 2OSSA 5HFRA 5HEMA 5DLXA 4UYEA 4CUTA 4Z6IA 3SVHA 5CUEA 4WHUA 5DX4A 5EWHA 5TB6A 5CQ7A 3P1DA 3S91A 5CQTA 2GRCA 4OUFA 4O74A 3Q2EA 4NR5A 3G0JA 4PS5A 4Y03A 2N9GA 5E9KA 4O7AA 2L5EA 4YBSA 4TZ8A 5D0CA 4NR8A 4Z1SA 5AD3A 5COIA 4NQNA 5CQ6A 4UYFB 4UIZA 2I8NA 4CUQA 2YEKA 2RNWA 4IR3A 5F61A 4J1PA 5AMFA 2WP2A 5BT4A 5ENBA 4UIWA 4NRCA 5HFQA 5D3TA 4YBMA 4QR3A 3U5NA 3ZYUA 4IOOA 5LKXA 4PCIA 5TCMA 3O37A 3UVWA 5L8UA 3G0LA 4O75A 4IOQA 5D3SA 4KCXA 5H1UA 4F3IA 4LYSA 5A7CA 4QR4A 5ETBA 4O7FA 2RFJA 5KU3A 4LYIA 4YY4A 5HQ5A 4UIYA 3O36A 5K29A 3D1DA 3U5OA 2YELA 4YBTA 5JI8A 5I7YA 4QSPA 4TS8A 5DBMA 5G4RA 5E3GA 3UVXA 4YYKA 2E7NA 4NUEA 5CQ4A 5E9LA 5IBNA 5F25A 5KTXA 3IU5A 5I86A 5A5SA 5ENJA 5ETDA 5C85A 5FE0A 4XY8A 4BW1A 2DVQA 4TYLA 5EGUA 5CUAA 5HLSA 4IR5A 5LVRA 4TT4A 3UVDA 5F62A 3GG3A 4ZC9A 4YYHA 4Q0OA 5A83A 4BJXA 4TTEA 4YH4A 5AD2A 5LKZA 5I89A 5L97A 5H1VA 3JVKA 2R0SA 4MR6A 3LJWA 1X0JA 3QZTA 4LZ2A 5DFCA 5D24A 4E96A 5I29A 2WP1A 3MB3A 5CQAA 3HMEA 4AKNA 4YH3A 5FE9A 5CZGA 5A5QA 3MULA 5HRWA 5DW2A 5I83A 5FFYA 4YABA 3UW9A 2YW5A 5D3NA 3AADA 3D1BA 5CRMA 4IR6A 2DKWA 4NRAA 1N72A 5EQ1A 4QZSA 3O33A 3ONIA 4GPJA 3O35A 2D9EA 1PUOA 3AQAA 2YYNA 4YYNA 5DW1A 3HMHA 4O72A 4XUBA 5CTLA 5HM0A 1F68A 5FE6A 4O7BA 1JM4B 5DYXA 4QC1A 2L85A 4ZQLA 4MR5A 4C67A 4NQMA 5I40A 3UV2A 4NYXA 5F60A 2LSPB 5I1QA 5E0RA 3VKHA 5E74A 5DYUA 5H85A 2FSAA 5FFVA 5HCLA 5I80A 4HXRA 5DKCA 2DVVA 4YYGA 5EV9A 5F5ZA 5EICA 4IORA 4TT2A 4BW4A 3MQMA 4DONA 4QB3A 5CU8A 2E3KA 3U5KA 4QEVA
chains in the Genus database with same CATH topology
4TT6A 5FH7A 2RS9B 2RO1A 5A85A 5G4SA 5CY9A 3SVGA 5HJCA 5LKTA 4A9KA 2R0YA 4YADA 5ENIA 5C4QA 1EQFA 5CFWA 5L8TA 5D26A 3NXBA 2RNYA 2F6JA 5DFBA 3TLPA 5FG6A 5HENA 4YK0A 3DWYA 4YYIA 5IIDA 4RVRA 4HXSA 4BW3A 1ZS5A 4YYDA 4QSWA 4N4FA 4UIVA 5EM3A 3U5PA 4NS5A 4QYLA 3U5LA 4Z1QA 5C8GA 4HBVA 5FE5A 5E3DA 4YYMA 5E9VA 1E6IA 2RNXA 5HRXA 5L99A 5FE2A 2R10A 5IGKA 4UYGA 4QUTA 2OO1A 4QSTA 5EWCA 4TU4A 5LVQA 4YATA 5DKDA 3JVMA 4X2IA 5D3RA 4A9IA 5FB0A 4C66A 5EPSA 5LKUA 4XUAA 5LUUA 5HQ6A 4WHWA 5A5PA 5EPBA 5EA1A 4CUSA 5F3AA 5CGPA 3LXJA 5IGNA 5ENFA 4MEOA 4HXNA 4QSXA 5A5OA 3JVJA 5EU1A 4FLPA 5FE7A 5A5NA 3MXFA 3IU6A 4NYWA 2DVSA 4LRGA 4A9EA 5C89A 5FB1A 4NR7A 5DKHA 4NR9A 5FE3A 5L96A 2I7KA 5HRVA 5CUDA 2DATA 4HXMA 4HXOA 4CURA 4QBMA 5EI4A 3S92A 5DLZA 4N3WA 5EWWA 5D25A 3MB4A 5LJ2A 5FG5A 5E9IA 4N4GA 5IGMA 2L84A 2RI7A 3UVYA 4A9HA 2R0VA 5D3LA 4CFKA 4HXKA 5E9MA 3DAIA 2OUOA 1WUMA 4O7EA 4UYDA 5EWVA 4CLBA 1JSPB 5C87A 5FH6A 5F63A 5FDZA 5CUGA 5EVAA 4LYWA 4LR6A 5DFDA 5LJ0A 4NUCA 5D7XA 4A9OA 5FFWA 4WIVA 5CPEA 4NR6A 5DYAA 4LZRA 4N4HA 2F6NA 5CQ5A 4QC3A 4ZW1A 5F1HA 4XYAA 4UIUA 2NXBA 3UV4A 5CQ3A 5ENGA 4KV1A 4MEPA 5CUBA 5IG6A 4TQNA 2H60A 4O76A 3QZVA 4QUUA 5CRZA 5KTUA 4OGJA 3UV5A 3LQIA 4QY4A 4O7CA 4Q0NA 4O77A 4UYHA 5E73A 3P1FA 4Z93A 4O78A 2DWWA 4A9NA 5EWDA 4ALGA 4CUUA 4TZ2A 4QSVA 3U5MA 3K2JA 4QEUA 4BHWA 4HBYA 4LZSA 5EISA 5A5RA 5II1A 5FE8A 5J0DA 3JVLA 4YC9A 4HXPA 4PKLA 5HELA 5D3PA 5EK9A 5CQ8A 5D3HA 5BT5A 4LC2A 5HQ7A 5CS8A 3LQJA 4TU6A 4YY6A 4MR4A 5DY7A 4QR5A 4HBXA 5E9YA 3RCWA 4UYFA 4UITA 5A82A 4XY9A 4NRBA 2DVRA 4NXJA 5CP5A 5IGLA 5I7XA 5ENEA 4O70A 4QEWA 4QSSA 3P1EA 5KO4A 4MEQA 5C7NA 5FH8A 5FE1A 3D7CA 3P1CA 3FKMX 5BT3A 5ENHA 2YEMA 5F1LA 2KTBB 3SVFA 5FG4A 5EP7A 4PY6A 4IR4A 4A9FA 5DYCA 4A9JA 4MR3A 4QNSA 2YDWA 4CFLA 4HBWA 5D3JA 5KTWA 2YQDA 4NUDA 5AMEA 5ACYA 4MENA 5F2PA 2E7OA 4PCEA 4CL9A 4HXLA 5E7DA 5JWMA 5FBXA 4O71A 4Z6HA 4KV4A 4OGIA 4QSQA 4NR4A 4A9LA 5CUCA 5L98A 2MJVB 4UIXA 1WUGA 4NYVA 5F36A 3O34A 3HMFA 3I3JA 4QYDA 4YYJA 4J0RA 4LDFA 5LJ1A 5FE4A 5ENCA 5II2A 4A9MA 4J0SA 5EPRA 3P5OA 4QSUA 5H1TA 4N4IA 4ALHA 3MUKA 4PTBA 5KHMA 2G4AA 3QZSA 5I88A 4BW2A 4J3IA 2D82A 4YAXA 3Q2FA 3U5JA 3LQHA 4QSRA 4CUPA 5A81A 2OSSA 5HFRA 5HEMA 5DLXA 4UYEA 4CUTA 4Z6IA 3SVHA 5CUEA 4WHUA 5DX4A 5EWHA 5TB6A 5CQ7A 3P1DA 3S91A 5CQTA 2GRCA 4OUFA 4O74A 3Q2EA 4NR5A 3G0JA 4PS5A 4Y03A 2N9GA 5E9KA 4O7AA 2L5EA 4YBSA 4TZ8A 5D0CA 4NR8A 4Z1SA 5AD3A 5COIA 4NQNA 5CQ6A 4UYFB 4UIZA 2I8NA 4CUQA 2YEKA 2RNWA 4IR3A 5F61A 4J1PA 5AMFA 2WP2A 5BT4A 5ENBA 4UIWA 4NRCA 5HFQA 5D3TA 4YBMA 4QR3A 3U5NA 3ZYUA 4IOOA 5LKXA 4PCIA 5TCMA 3O37A 3UVWA 5L8UA 3G0LA 4O75A 4IOQA 5D3SA 4KCXA 5H1UA 4F3IA 4LYSA 5A7CA 4QR4A 5ETBA 4O7FA 2RFJA 5KU3A 4LYIA 4YY4A 5HQ5A 4UIYA 3O36A 5K29A 3U5OA 2YELA 4YBTA 5JI8A 5I7YA 4QSPA 4TS8A 5DBMA 5G4RA 5E3GA 3UVXA 4YYKA 2E7NA 4NUEA 5CQ4A 5E9LA 5IBNA 5F25A 5KTXA 3IU5A 5I86A 5A5SA 5ENJA 5ETDA 5C85A 5FE0A 4XY8A 4BW1A 2DVQA 4TYLA 5EGUA 5CUAA 5HLSA 4IR5A 5LVRA 4TT4A 3UVDA 5F62A 3GG3A 4ZC9A 4YYHA 4Q0OA 5A83A 4BJXA 4TTEA 4YH4A 5AD2A 5LKZA 5I89A 5L97A 5H1VA 3JVKA 2R0SA 4MR6A 3LJWA 1X0JA 3QZTA 4LZ2A 5DFCA 5D24A 4E96A 5I29A 2WP1A 3MB3A 5CQAA 3HMEA 4AKNA 4YH3A 5FE9A 5CZGA 5A5QA 3MULA 5HRWA 5DW2A 5I83A 5FFYA 4YABA 3UW9A 2YW5A 5D3NA 3AADA 5CRMA 4IR6A 2DKWA 4NRAA 1N72A 5EQ1A 4QZSA 3O33A 3ONIA 4GPJA 3O35A 2D9EA 3AQAA 2YYNA 4YYNA 5DW1A 3HMHA 4O72A 4XUBA 5CTLA 5HM0A 1F68A 5FE6A 4O7BA 1JM4B 5DYXA 4QC1A 2L85A 4ZQLA 4MR5A 4C67A 4NQMA 5I40A 3UV2A 4NYXA 5F60A 2LSPB 5I1QA 5E0RA 5E74A 5DYUA 5H85A 2FSAA 5FFVA 5HCLA 5I80A 4HXRA 5DKCA 2DVVA 4YYGA 5EV9A 5F5ZA 5EICA 4IORA 4TT2A 4BW4A 3MQMA 4DONA 4QB3A 5CU8A 2E3KA 3U5KA 4QEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TT6 A;  5FH7 A;  2RS9 B;  2RO1 A;  5A85 A;  5G4S A;  5CY9 A;  3SVG A;  5HJC A;  5LKT A;  4A9K A;  2R0Y A;  4YAD A;  5ENI A;  5C4Q A;  1EQF A;  5CFW A;  5L8T A;  5D26 A;  3NXB A;  2RNY A;  2F6J A;  5DFB A;  3TLP A;  5FG6 A;  5HEN A;  4YK0 A;  3DWY A;  4YYI A;  5IID A;  4RVR A;  4HXS A;  4BW3 A;  1ZS5 A;  4YYD A;  4QSW A;  4N4F A;  4UIV A;  5EM3 A;  3U5P A;  4NS5 A;  4QYL A;  3U5L A;  4Z1Q A;  5C8G A;  4HBV A;  5FE5 A;  5E3D A;  4YYM A;  5E9V A;  1E6I A;  2RNX A;  5HRX A;  5L99 A;  5FE2 A;  2R10 A;  5IGK A;  4UYG A;  4QUT A;  2OO1 A;  4QST A;  5EWC A;  4TU4 A;  5LVQ A;  4YAT A;  5DKD A;  3JVM A;  4X2I A;  5D3R A;  4A9I A;  5FB0 A;  4C66 A;  5EPS A;  5LKU A;  4XUA A;  5LUU A;  5HQ6 A;  4WHW A;  5A5P A;  5EPB A;  5EA1 A;  4CUS A;  5F3A A;  5CGP A;  3LXJ A;  5IGN A;  5ENF A;  4MEO A;  4HXN A;  4QSX A;  5A5O A;  3JVJ A;  5EU1 A;  4FLP A;  5FE7 A;  5A5N A;  3MXF A;  3IU6 A;  4NYW A;  2DVS A;  4LRG A;  4A9E A;  5C89 A;  5FB1 A;  4NR7 A;  5DKH A;  4NR9 A;  5FE3 A;  5L96 A;  2I7K A;  5HRV A;  5CUD A;  2DAT A;  4HXM A;  4HXO A;  4CUR A;  4QBM A;  5EI4 A;  3S92 A;  5DLZ A;  4N3W A;  5EWW A;  5D25 A;  3MB4 A;  5LJ2 A;  5FG5 A;  5E9I A;  4N4G A;  5IGM A;  2L84 A;  2RI7 A;  3UVY A;  4A9H A;  2R0V A;  5D3L A;  4CFK A;  4HXK A;  5E9M A;  3DAI A;  2OUO A;  1WUM A;  4O7E A;  4UYD A;  5EWV A;  4CLB A;  1JSP B;  5C87 A;  5FH6 A;  5F63 A;  5FDZ A;  5CUG A;  5EVA A;  4LYW A;  4LR6 A;  5DFD A;  5LJ0 A;  4NUC A;  5D7X A;  4A9O A;  5FFW A;  4WIV A;  5CPE A;  4NR6 A;  5DYA A;  4LZR A;  4N4H A;  2F6N A;  5CQ5 A;  4QC3 A;  4ZW1 A;  5F1H A;  4XYA A;  4UIU A;  2NXB A;  3UV4 A;  5CQ3 A;  5ENG A;  4KV1 A;  4MEP A;  5CUB A;  5IG6 A;  4TQN A;  2H60 A;  4O76 A;  3QZV A;  4QUU A;  5CRZ A;  5KTU A;  4OGJ A;  3UV5 A;  3LQI A;  4QY4 A;  4O7C A;  4Q0N A;  4O77 A;  4UYH A;  5E73 A;  3P1F A;  4Z93 A;  4O78 A;  2DWW A;  4A9N A;  5EWD A;  4ALG A;  4CUU A;  4TZ2 A;  4QSV A;  3U5M A;  3K2J A;  4QEU A;  4BHW A;  4HBY A;  4LZS A;  5EIS A;  5A5R A;  5II1 A;  5FE8 A;  5J0D A;  3JVL A;  4YC9 A;  4HXP A;  4PKL A;  5HEL A;  5D3P A;  5EK9 A;  5CQ8 A;  5D3H A;  5BT5 A;  4LC2 A;  5HQ7 A;  5CS8 A;  3LQJ A;  4TU6 A;  4YY6 A;  4MR4 A;  5DY7 A;  4QR5 A;  4HBX A;  5E9Y A;  3RCW A;  4UYF A;  4UIT A;  5A82 A;  4XY9 A;  4NRB A;  2DVR A;  4NXJ A;  5CP5 A;  5IGL A;  5I7X A;  5ENE A;  4O70 A;  4QEW A;  4QSS A;  3P1E A;  5KO4 A;  4MEQ A;  5C7N A;  5FH8 A;  5FE1 A;  3D7C A;  3P1C A;  3FKM X;  5BT3 A;  5ENH A;  2YEM A;  5F1L A;  2KTB B;  3SVF A;  5FG4 A;  5EP7 A;  4PY6 A;  4IR4 A;  4A9F A;  5DYC A;  4A9J A;  4MR3 A;  4QNS A;  2YDW A;  4CFL A;  4HBW A;  5D3J A;  5KTW A;  2YQD A;  4NUD A;  5AME A;  5ACY A;  4MEN A;  5F2P A;  2E7O A;  4PCE A;  4CL9 A;  4HXL A;  5E7D A;  5JWM A;  5FBX A;  4O71 A;  4Z6H A;  4KV4 A;  4OGI A;  4QSQ A;  4NR4 A;  4A9L A;  5CUC A;  5L98 A;  2MJV B;  4UIX A;  1WUG A;  4NYV A;  5F36 A;  3O34 A;  3HMF A;  3I3J A;  4QYD A;  4YYJ A;  4J0R A;  4LDF A;  5LJ1 A;  5FE4 A;  5ENC A;  5II2 A;  4A9M A;  4J0S A;  5EPR A;  3P5O A;  4QSU A;  5H1T A;  4N4I A;  4ALH A;  3MUK A;  4PTB A;  5KHM A;  2G4A A;  3QZS A;  5I88 A;  4BW2 A;  4J3I A;  2D82 A;  4YAX A;  3Q2F A;  3U5J A;  3LQH A;  4QSR A;  4CUP A;  5A81 A;  2OSS A;  5HFR A;  5HEM A;  5DLX A;  4UYE A;  4CUT A;  4Z6I A;  3SVH A;  5CUE A;  4WHU A;  5DX4 A;  5EWH A;  5TB6 A;  5CQ7 A;  3P1D A;  3S91 A;  5CQT A;  2GRC A;  4OUF A;  4O74 A;  3Q2E A;  4NR5 A;  3G0J A;  4PS5 A;  4Y03 A;  2N9G A;  5E9K A;  4O7A A;  2L5E A;  4YBS A;  4TZ8 A;  5D0C A;  4NR8 A;  4Z1S A;  5AD3 A;  5COI A;  4NQN A;  5CQ6 A;  4UYF B;  4UIZ A;  2I8N A;  4CUQ A;  2YEK A;  2RNW A;  4IR3 A;  5F61 A;  4J1P A;  5AMF A;  2WP2 A;  5BT4 A;  5ENB A;  4UIW A;  4NRC A;  5HFQ A;  5D3T A;  4YBM A;  4QR3 A;  3U5N A;  3ZYU A;  4IOO A;  5LKX A;  4PCI A;  5TCM A;  3O37 A;  3UVW A;  5L8U A;  3G0L A;  4O75 A;  4IOQ A;  5D3S A;  4KCX A;  5H1U A;  4F3I A;  4LYS A;  5A7C A;  4QR4 A;  5ETB A;  4O7F A;  2RFJ A;  5KU3 A;  4LYI A;  4YY4 A;  5HQ5 A;  4UIY A;  3O36 A;  5K29 A;  3U5O A;  2YEL A;  4YBT A;  5JI8 A;  5I7Y A;  4QSP A;  4TS8 A;  5DBM A;  5G4R A;  5E3G A;  3UVX A;  4YYK A;  2E7N A;  4NUE A;  5CQ4 A;  5E9L A;  5IBN A;  5F25 A;  5KTX A;  3IU5 A;  5I86 A;  5A5S A;  5ENJ A;  5ETD A;  5C85 A;  5FE0 A;  4XY8 A;  4BW1 A;  2DVQ A;  4TYL A;  5EGU A;  5CUA A;  5HLS A;  4IR5 A;  5LVR A;  4TT4 A;  3UVD A;  5F62 A;  3GG3 A;  4ZC9 A;  4YYH A;  4Q0O A;  5A83 A;  4BJX A;  4TTE A;  4YH4 A;  5AD2 A;  5LKZ A;  5I89 A;  5L97 A;  5H1V A;  3JVK A;  2R0S A;  4MR6 A;  3LJW A;  1X0J A;  3QZT A;  4LZ2 A;  5DFC A;  5D24 A;  4E96 A;  5I29 A;  2WP1 A;  3MB3 A;  5CQA A;  3HME A;  4AKN A;  4YH3 A;  5FE9 A;  5CZG A;  5A5Q A;  3MUL A;  5HRW A;  5DW2 A;  5I83 A;  5FFY A;  4YAB A;  3UW9 A;  2YW5 A;  5D3N A;  3AAD A;  5CRM A;  4IR6 A;  2DKW A;  4NRA A;  1N72 A;  5EQ1 A;  4QZS A;  3O33 A;  3ONI A;  4GPJ A;  3O35 A;  2D9E A;  3AQA A;  2YYN A;  4YYN A;  5DW1 A;  3HMH A;  4O72 A;  4XUB A;  5CTL A;  5HM0 A;  1F68 A;  5FE6 A;  4O7B A;  1JM4 B;  5DYX A;  4QC1 A;  2L85 A;  4ZQL A;  4MR5 A;  4C67 A;  4NQM A;  5I40 A;  3UV2 A;  4NYX A;  5F60 A;  2LSP B;  5I1Q A;  5E0R A;  5E74 A;  5DYU A;  5H85 A;  2FSA A;  5FFV A;  5HCL A;  5I80 A;  4HXR A;  5DKC A;  2DVV A;  4YYG A;  5EV9 A;  5F5Z A;  5EIC A;  4IOR A;  4TT2 A;  4BW4 A;  3MQM A;  4DON A;  4QB3 A;  5CU8 A;  2E3K A;  3U5K A;  4QEV A; 
#chains in the Genus database with same CATH topology
 1ZKR A;  4TT6 A;  5FH7 A;  2RS9 B;  2RO1 A;  5A85 A;  5G4S A;  5CY9 A;  3SVG A;  5HJC A;  5LKT A;  4A9K A;  2R0Y A;  4YAD A;  5ENI A;  5C4Q A;  1EQF A;  5CFW A;  5L8T A;  5D26 A;  3NXB A;  2RNY A;  2F6J A;  5DFB A;  3TLP A;  5FG6 A;  5HEN A;  4YK0 A;  3DWY A;  4YYI A;  5IID A;  4RVR A;  4HXS A;  4BW3 A;  1ZS5 A;  4YYD A;  4QSW A;  4N4F A;  4UIV A;  5EM3 A;  3U5P A;  4NS5 A;  4QYL A;  3U5L A;  4Z1Q A;  5C8G A;  4HBV A;  5FE5 A;  5E3D A;  4YYM A;  5E9V A;  1E6I A;  2RNX A;  5HRX A;  5L99 A;  5FE2 A;  2R10 A;  5IGK A;  4UYG A;  4QUT A;  2OO1 A;  4QST A;  5EWC A;  4TU4 A;  5LVQ A;  4YAT A;  5DKD A;  3JVM A;  4X2I A;  5D3R A;  4A9I A;  5FB0 A;  4C66 A;  5EPS A;  5LKU A;  4XUA A;  5LUU A;  5HQ6 A;  4WHW A;  5A5P A;  5EPB A;  5EA1 A;  4CUS A;  5F3A A;  5CGP A;  3LXJ A;  5IGN A;  5ENF A;  4MEO A;  4HXN A;  4QSX A;  5A5O A;  3JVJ A;  5EU1 A;  4FLP A;  5FE7 A;  5A5N A;  3MXF A;  3IU6 A;  4NYW A;  2DVS A;  4LRG A;  4A9E A;  5C89 A;  5FB1 A;  4NR7 A;  5DKH A;  4NR9 A;  5FE3 A;  5L96 A;  2I7K A;  5HRV A;  5CUD A;  2DAT A;  4HXM A;  4HXO A;  4CUR A;  4QBM A;  5EI4 A;  3S92 A;  5DLZ A;  4N3W A;  5EWW A;  5D25 A;  3MB4 A;  5LJ2 A;  4AKG A;  5FG5 A;  5E9I A;  4N4G A;  5IGM A;  2L84 A;  2RI7 A;  3UVY A;  4A9H A;  2R0V A;  5D3L A;  4CFK A;  4HXK A;  5E9M A;  3DAI A;  2OUO A;  1WUM A;  4O7E A;  4UYD A;  5EWV A;  4CLB A;  1JSP B;  5C87 A;  5FH6 A;  5F63 A;  5FDZ A;  5CUG A;  5EVA A;  4LYW A;  4LR6 A;  5DFD A;  5LJ0 A;  4NUC A;  5D7X A;  4A9O A;  5FFW A;  4WIV A;  5CPE A;  4NR6 A;  5DYA A;  4LZR A;  4N4H A;  2F6N A;  5CQ5 A;  4QC3 A;  4ZW1 A;  5F1H A;  4XYA A;  4UIU A;  2NXB A;  3UV4 A;  5CQ3 A;  5ENG A;  4KV1 A;  4MEP A;  5CUB A;  5IG6 A;  4TQN A;  2H60 A;  4O76 A;  3QZV A;  4QUU A;  5CRZ A;  5KTU A;  4OGJ A;  3UV5 A;  3LQI A;  4QY4 A;  4O7C A;  4Q0N A;  4O77 A;  4UYH A;  5E73 A;  3P1F A;  4Z93 A;  4O78 A;  2DWW A;  4A9N A;  5EWD A;  4ALG A;  4CUU A;  4TZ2 A;  4QSV A;  3U5M A;  3K2J A;  4QEU A;  4BHW A;  4HBY A;  4LZS A;  5EIS A;  5A5R A;  5II1 A;  5FE8 A;  5J0D A;  3JVL A;  4YC9 A;  4HXP A;  4PKL A;  5HEL A;  4AKH A;  5D3P A;  5EK9 A;  5CQ8 A;  5D3H A;  5BT5 A;  4LC2 A;  5HQ7 A;  5CS8 A;  3LQJ A;  4TU6 A;  4YY6 A;  4MR4 A;  5DY7 A;  4QR5 A;  4HBX A;  5E9Y A;  3RCW A;  4UYF A;  4AI6 A;  2EJN A;  4UIT A;  5A82 A;  4XY9 A;  4NRB A;  2DVR A;  4NXJ A;  3VKG A;  5CP5 A;  5IGL A;  5I7X A;  5ENE A;  4O70 A;  4QEW A;  4QSS A;  3P1E A;  5KO4 A;  3ERR A;  4MEQ A;  5C7N A;  5FH8 A;  5FE1 A;  3D7C A;  3P1C A;  3FKM X;  5BT3 A;  5ENH A;  2YEM A;  5F1L A;  2KTB B;  3SVF A;  5FG4 A;  5EP7 A;  4PY6 A;  4IR4 A;  4A9F A;  5DYC A;  4A9J A;  4MR3 A;  4QNS A;  2YDW A;  4CFL A;  4HBW A;  5D3J A;  5KTW A;  2YQD A;  4NUD A;  5AME A;  5ACY A;  4MEN A;  5F2P A;  2E7O A;  4PCE A;  4CL9 A;  4HXL A;  5E7D A;  5JWM A;  5FBX A;  4O71 A;  4Z6H A;  4KV4 A;  4OGI A;  4QSQ A;  4NR4 A;  4A9L A;  5CUC A;  5L98 A;  2MJV B;  4UIX A;  1WUG A;  4NYV A;  5F36 A;  3O34 A;  3HMF A;  3I3J A;  4QYD A;  4YYJ A;  4J0R A;  4LDF A;  5LJ1 A;  5FE4 A;  5ENC A;  5II2 A;  4AKI A;  4A9M A;  4J0S A;  5EPR A;  3P5O A;  4QSU A;  5H1T A;  4N4I A;  4ALH A;  3MUK A;  4PTB A;  5KHM A;  2G4A A;  3QZS A;  5I88 A;  4BW2 A;  4J3I A;  2D82 A;  4YAX A;  3Q2F A;  3U5J A;  3LQH A;  4QSR A;  4CUP A;  5A81 A;  2OSS A;  5HFR A;  5HEM A;  5DLX A;  4UYE A;  4CUT A;  4Z6I A;  3SVH A;  5CUE A;  4WHU A;  5DX4 A;  5EWH A;  5TB6 A;  5CQ7 A;  3P1D A;  3S91 A;  5CQT A;  2GRC A;  4OUF A;  4O74 A;  3Q2E A;  4NR5 A;  3G0J A;  4PS5 A;  4Y03 A;  2N9G A;  5E9K A;  4O7A A;  2L5E A;  4YBS A;  4TZ8 A;  5D0C A;  4NR8 A;  4Z1S A;  5AD3 A;  5COI A;  4NQN A;  5CQ6 A;  4UYF B;  4UIZ A;  2I8N A;  4CUQ A;  2YEK A;  2RNW A;  4IR3 A;  5F61 A;  4J1P A;  5AMF A;  2WP2 A;  5BT4 A;  5ENB A;  4UIW A;  4NRC A;  5HFQ A;  5D3T A;  4YBM A;  4QR3 A;  3U5N A;  3ZYU A;  4IOO A;  5LKX A;  4PCI A;  5TCM A;  3O37 A;  3UVW A;  5L8U A;  3G0L A;  4O75 A;  4IOQ A;  5D3S A;  4KCX A;  5H1U A;  4F3I A;  4LYS A;  5A7C A;  4QR4 A;  5ETB A;  4O7F A;  2RFJ A;  5KU3 A;  4LYI A;  4YY4 A;  5HQ5 A;  4UIY A;  3O36 A;  5K29 A;  3D1D A;  3U5O A;  2YEL A;  4YBT A;  5JI8 A;  5I7Y A;  4QSP A;  4TS8 A;  5DBM A;  5G4R A;  5E3G A;  3UVX A;  4YYK A;  2E7N A;  4NUE A;  5CQ4 A;  5E9L A;  5IBN A;  5F25 A;  5KTX A;  3IU5 A;  5I86 A;  5A5S A;  5ENJ A;  5ETD A;  5C85 A;  5FE0 A;  4XY8 A;  4BW1 A;  2DVQ A;  4TYL A;  5EGU A;  5CUA A;  5HLS A;  4IR5 A;  5LVR A;  4TT4 A;  3UVD A;  5F62 A;  3GG3 A;  4ZC9 A;  4YYH A;  4Q0O A;  5A83 A;  4BJX A;  4TTE A;  4YH4 A;  5AD2 A;  5LKZ A;  5I89 A;  5L97 A;  5H1V A;  3JVK A;  2R0S A;  4MR6 A;  3LJW A;  1X0J A;  3QZT A;  4LZ2 A;  5DFC A;  5D24 A;  4E96 A;  5I29 A;  2WP1 A;  3MB3 A;  5CQA A;  3HME A;  4AKN A;  4YH3 A;  5FE9 A;  5CZG A;  5A5Q A;  3MUL A;  5HRW A;  5DW2 A;  5I83 A;  5FFY A;  4YAB A;  3UW9 A;  2YW5 A;  5D3N A;  3AAD A;  3D1B A;  5CRM A;  4IR6 A;  2DKW A;  4NRA A;  1N72 A;  5EQ1 A;  4QZS A;  3O33 A;  3ONI A;  4GPJ A;  3O35 A;  2D9E A;  1PUO A;  3AQA A;  2YYN A;  4YYN A;  5DW1 A;  3HMH A;  4O72 A;  4XUB A;  5CTL A;  5HM0 A;  1F68 A;  5FE6 A;  4O7B A;  1JM4 B;  5DYX A;  4QC1 A;  2L85 A;  4ZQL A;  4MR5 A;  4C67 A;  4NQM A;  5I40 A;  3UV2 A;  4NYX A;  5F60 A;  2LSP B;  5I1Q A;  5E0R A;  3VKH A;  5E74 A;  5DYU A;  5H85 A;  2FSA A;  5FFV A;  5HCL A;  5I80 A;  4HXR A;  5DKC A;  2DVV A;  4YYG A;  5EV9 A;  5F5Z A;  5EIC A;  4IOR A;  4TT2 A;  4BW4 A;  3MQM A;  4DON A;  4QB3 A;  5CU8 A;  2E3K A;  3U5K A;  4QEV A; 
#chains in the Genus database with same CATH homology
 4TT6 A;  5FH7 A;  2RS9 B;  2RO1 A;  5A85 A;  5G4S A;  5CY9 A;  3SVG A;  5HJC A;  5LKT A;  4A9K A;  2R0Y A;  4YAD A;  5ENI A;  5C4Q A;  1EQF A;  5CFW A;  5L8T A;  5D26 A;  3NXB A;  2RNY A;  2F6J A;  5DFB A;  3TLP A;  5FG6 A;  5HEN A;  4YK0 A;  3DWY A;  4YYI A;  5IID A;  4RVR A;  4HXS A;  4BW3 A;  1ZS5 A;  4YYD A;  4QSW A;  4N4F A;  4UIV A;  5EM3 A;  3U5P A;  4NS5 A;  4QYL A;  3U5L A;  4Z1Q A;  5C8G A;  4HBV A;  5FE5 A;  5E3D A;  4YYM A;  5E9V A;  1E6I A;  2RNX A;  5HRX A;  5L99 A;  5FE2 A;  2R10 A;  5IGK A;  4UYG A;  4QUT A;  2OO1 A;  4QST A;  5EWC A;  4TU4 A;  5LVQ A;  4YAT A;  5DKD A;  3JVM A;  4X2I A;  5D3R A;  4A9I A;  5FB0 A;  4C66 A;  5EPS A;  5LKU A;  4XUA A;  5LUU A;  5HQ6 A;  4WHW A;  5A5P A;  5EPB A;  5EA1 A;  4CUS A;  5F3A A;  5CGP A;  3LXJ A;  5IGN A;  5ENF A;  4MEO A;  4HXN A;  4QSX A;  5A5O A;  3JVJ A;  5EU1 A;  4FLP A;  5FE7 A;  5A5N A;  3MXF A;  3IU6 A;  4NYW A;  2DVS A;  4LRG A;  4A9E A;  5C89 A;  5FB1 A;  4NR7 A;  5DKH A;  4NR9 A;  5FE3 A;  5L96 A;  2I7K A;  5HRV A;  5CUD A;  2DAT A;  4HXM A;  4HXO A;  4CUR A;  4QBM A;  5EI4 A;  3S92 A;  5DLZ A;  4N3W A;  5EWW A;  5D25 A;  3MB4 A;  5LJ2 A;  5FG5 A;  5E9I A;  4N4G A;  5IGM A;  2L84 A;  2RI7 A;  3UVY A;  4A9H A;  2R0V A;  5D3L A;  4CFK A;  4HXK A;  5E9M A;  3DAI A;  2OUO A;  1WUM A;  4O7E A;  4UYD A;  5EWV A;  4CLB A;  1JSP B;  5C87 A;  5FH6 A;  5F63 A;  5FDZ A;  5CUG A;  5EVA A;  4LYW A;  4LR6 A;  5DFD A;  5LJ0 A;  4NUC A;  5D7X A;  4A9O A;  5FFW A;  4WIV A;  5CPE A;  4NR6 A;  5DYA A;  4LZR A;  4N4H A;  2F6N A;  5CQ5 A;  4QC3 A;  4ZW1 A;  5F1H A;  4XYA A;  4UIU A;  2NXB A;  3UV4 A;  5CQ3 A;  5ENG A;  4KV1 A;  4MEP A;  5CUB A;  5IG6 A;  4TQN A;  2H60 A;  4O76 A;  3QZV A;  4QUU A;  5CRZ A;  5KTU A;  4OGJ A;  3UV5 A;  3LQI A;  4QY4 A;  4O7C A;  4Q0N A;  4O77 A;  4UYH A;  5E73 A;  3P1F A;  4Z93 A;  4O78 A;  2DWW A;  4A9N A;  5EWD A;  4ALG A;  4CUU A;  4TZ2 A;  4QSV A;  3U5M A;  3K2J A;  4QEU A;  4BHW A;  4HBY A;  4LZS A;  5EIS A;  5A5R A;  5II1 A;  5FE8 A;  5J0D A;  3JVL A;  4YC9 A;  4HXP A;  4PKL A;  5HEL A;  5D3P A;  5EK9 A;  5CQ8 A;  5D3H A;  5BT5 A;  4LC2 A;  5HQ7 A;  5CS8 A;  3LQJ A;  4TU6 A;  4YY6 A;  4MR4 A;  5DY7 A;  4QR5 A;  4HBX A;  5E9Y A;  3RCW A;  4UYF A;  4UIT A;  5A82 A;  4XY9 A;  4NRB A;  2DVR A;  4NXJ A;  5CP5 A;  5IGL A;  5I7X A;  5ENE A;  4O70 A;  4QEW A;  4QSS A;  3P1E A;  5KO4 A;  4MEQ A;  5C7N A;  5FH8 A;  5FE1 A;  3D7C A;  3P1C A;  3FKM X;  5BT3 A;  5ENH A;  2YEM A;  5F1L A;  2KTB B;  3SVF A;  5FG4 A;  5EP7 A;  4PY6 A;  4IR4 A;  4A9F A;  5DYC A;  4A9J A;  4MR3 A;  4QNS A;  2YDW A;  4CFL A;  4HBW A;  5D3J A;  5KTW A;  2YQD A;  4NUD A;  5AME A;  5ACY A;  4MEN A;  5F2P A;  2E7O A;  4PCE A;  4CL9 A;  4HXL A;  5E7D A;  5JWM A;  5FBX A;  4O71 A;  4Z6H A;  4KV4 A;  4OGI A;  4QSQ A;  4NR4 A;  4A9L A;  5CUC A;  5L98 A;  2MJV B;  4UIX A;  1WUG A;  4NYV A;  5F36 A;  3O34 A;  3HMF A;  3I3J A;  4QYD A;  4YYJ A;  4J0R A;  4LDF A;  5LJ1 A;  5FE4 A;  5ENC A;  5II2 A;  4A9M A;  4J0S A;  5EPR A;  3P5O A;  4QSU A;  5H1T A;  4N4I A;  4ALH A;  3MUK A;  4PTB A;  5KHM A;  2G4A A;  3QZS A;  5I88 A;  4BW2 A;  4J3I A;  2D82 A;  4YAX A;  3Q2F A;  3U5J A;  3LQH A;  4QSR A;  4CUP A;  5A81 A;  2OSS A;  5HFR A;  5HEM A;  5DLX A;  4UYE A;  4CUT A;  4Z6I A;  3SVH A;  5CUE A;  4WHU A;  5DX4 A;  5EWH A;  5TB6 A;  5CQ7 A;  3P1D A;  3S91 A;  5CQT A;  2GRC A;  4OUF A;  4O74 A;  3Q2E A;  4NR5 A;  3G0J A;  4PS5 A;  4Y03 A;  2N9G A;  5E9K A;  4O7A A;  2L5E A;  4YBS A;  4TZ8 A;  5D0C A;  4NR8 A;  4Z1S A;  5AD3 A;  5COI A;  4NQN A;  5CQ6 A;  4UYF B;  4UIZ A;  2I8N A;  4CUQ A;  2YEK A;  2RNW A;  4IR3 A;  5F61 A;  4J1P A;  5AMF A;  2WP2 A;  5BT4 A;  5ENB A;  4UIW A;  4NRC A;  5HFQ A;  5D3T A;  4YBM A;  4QR3 A;  3U5N A;  3ZYU A;  4IOO A;  5LKX A;  4PCI A;  5TCM A;  3O37 A;  3UVW A;  5L8U A;  3G0L A;  4O75 A;  4IOQ A;  5D3S A;  4KCX A;  5H1U A;  4F3I A;  4LYS A;  5A7C A;  4QR4 A;  5ETB A;  4O7F A;  2RFJ A;  5KU3 A;  4LYI A;  4YY4 A;  5HQ5 A;  4UIY A;  3O36 A;  5K29 A;  3U5O A;  2YEL A;  4YBT A;  5JI8 A;  5I7Y A;  4QSP A;  4TS8 A;  5DBM A;  5G4R A;  5E3G A;  3UVX A;  4YYK A;  2E7N A;  4NUE A;  5CQ4 A;  5E9L A;  5IBN A;  5F25 A;  5KTX A;  3IU5 A;  5I86 A;  5A5S A;  5ENJ A;  5ETD A;  5C85 A;  5FE0 A;  4XY8 A;  4BW1 A;  2DVQ A;  4TYL A;  5EGU A;  5CUA A;  5HLS A;  4IR5 A;  5LVR A;  4TT4 A;  3UVD A;  5F62 A;  3GG3 A;  4ZC9 A;  4YYH A;  4Q0O A;  5A83 A;  4BJX A;  4TTE A;  4YH4 A;  5AD2 A;  5LKZ A;  5I89 A;  5L97 A;  5H1V A;  3JVK A;  2R0S A;  4MR6 A;  3LJW A;  1X0J A;  3QZT A;  4LZ2 A;  5DFC A;  5D24 A;  4E96 A;  5I29 A;  2WP1 A;  3MB3 A;  5CQA A;  3HME A;  4AKN A;  4YH3 A;  5FE9 A;  5CZG A;  5A5Q A;  3MUL A;  5HRW A;  5DW2 A;  5I83 A;  5FFY A;  4YAB A;  3UW9 A;  2YW5 A;  5D3N A;  3AAD A;  5CRM A;  4IR6 A;  2DKW A;  4NRA A;  1N72 A;  5EQ1 A;  4QZS A;  3O33 A;  3ONI A;  4GPJ A;  3O35 A;  2D9E A;  3AQA A;  2YYN A;  4YYN A;  5DW1 A;  3HMH A;  4O72 A;  4XUB A;  5CTL A;  5HM0 A;  1F68 A;  5FE6 A;  4O7B A;  1JM4 B;  5DYX A;  4QC1 A;  2L85 A;  4ZQL A;  4MR5 A;  4C67 A;  4NQM A;  5I40 A;  3UV2 A;  4NYX A;  5F60 A;  2LSP B;  5I1Q A;  5E0R A;  5E74 A;  5DYU A;  5H85 A;  2FSA A;  5FFV A;  5HCL A;  5I80 A;  4HXR A;  5DKC A;  2DVV A;  4YYG A;  5EV9 A;  5F5Z A;  5EIC A;  4IOR A;  4TT2 A;  4BW4 A;  3MQM A;  4DON A;  4QB3 A;  5CU8 A;  2E3K A;  3U5K A;  4QEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...