2KTBB

Solution structure of the second bromodomain of human polybromo in complex with an acetylated peptide from histone 3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
121
structure length
121
Chain Sequence
STEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHAMAKDIDLLAKNAKTYNEPGSQVFKDANSIKKIFYMKKAEIEHHEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords H3_Peptide
publication title Structural insights into selective histone H3 recognition by the human Polybromo bromodomain 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2ktbB00
4NQMA 5CGPA 4Q0NA 5DFCA 4QY4A 4CUUA 3JVLA 5CUAA 4TYLA 5CQ6A 4HXSA 4O75A 4LYIA 2WP1A 3SVFA 3GG3A 2MJVB 5CUEA 4QEVA 4YH4A 4XUBA 4NUDA 5A5QA 4HBVA 4YK0A 5HENA 4YY4A 4LC2A 4BW2A 4LR6A 4QYDA 5ETBA 4XY9A 3U5MA 4YBTA 5CUBA 4LDFA 1E6IA 4YYHA 3SVHA 5D3SA 5FE5A 2E3KA 4MEQA 5AMFA 2DVSA 4PS5A 5A85A 4E96A 5JI8A 4QEWA 4N3WA 4IR3A 4NRAA 3SVGA 4IOOA 4BW3A 4IR6A 4TQNA 5E74A 5HFRA 3K2JA 5LVQA 5D3NA 4N4IA 3P1CA 5KU3A 2RNXA 4QSRA 4LYWA 4MR5A 5EVAA 3ONIA 2N9GA 2RNWA 5BT5A 4XUAA 4N4HA 5E3DA 2E7NA 5D24A 4CLBA 5FB1A 5L96A 4UIYA 5LKXA 5CQ4A 4HXPA 5LKUA 5F1HA 3QZVA 5H1VA 5E3GA 5ACYA 4QR5A 4Z6HA 5F2PA 4LZRA 1N72A 5FG6A 3UVWA 5HQ5A 5E7DA 4O72A 2I8NA 2L84A 5IGMA 5EPBA 5D3JA 5A5NA 4N4GA 2H60A 4O7BA 5IGKA 5J0DA 3O33A 5CY9A 5LKTA 2R0VA 5DKCA 5EWCA 5K29A 5CUCA 4KCXA 2DVRA 5DKDA 5C4QA 2NXBA 4LZSA 4HBWA 4O77A 4YATA 3Q2FA 5CQ3A 5CU8A 3P5OA 4IR4A 4QC1A 3Q2EA 4ZC9A 5DFDA 5DKHA 3JVKA 3LQHA 3O37A 5CQ7A 5A5SA 4Q0OA 4O7CA 5HFQA 4YAXA 2G4AA 4YYDA 4XY8A 5A83A 4MR3A 5F63A 3LQJA 5EPSA 4O7EA 3I3JA 5CUGA 5I29A 5FE6A 5ENBA 4MENA 5ENGA 4FLPA 4HXNA 5FH7A 4XYAA 4HBYA 5CZGA 5EWWA 5E73A 5D3TA 4NR9A 5L8UA 4HXMA 4NUEA 3P1EA 5CQ5A 1X0JA 4QR4A 3LQIA 5H85A 4QNSA 2LSPB 4QB3A 4O7AA 2GRCA 5FBXA 4MEPA 5H1TA 2R10A 4YC9A 4ALGA 2YYNA 4O76A 4TT2A 3O35A 5CPEA 5I80A 5E9LA 5C87A 5D26A 4YADA 3LJWA 4TU6A 5A7CA 4C66A 3HMEA 4A9NA 4YBMA 5HQ6A 4UYGA 1WUGA 4NS5A 5DLXA 5DW1A 4QUUA 2E7OA 5I7YA 2RI7A 5E9IA 2YEKA 5DYAA 5G4RA 5A82A 3IU5A 5G4SA 2YW5A 5TB6A 3UV5A 2I7KA 4C67A 5E9KA 5HLSA 3MULA 5F36A 4PCIA 5AD2A 3G0LA 5FE1A 4J0SA 3O34A 2FSAA 4A9JA 3U5NA 2KTBB 5ENCA 4QEUA 4HXLA 4TU4A 2RO1A 4OUFA 4QSPA 4QYLA 5F5ZA 4A9FA 5EK9A 3S92A 4J1PA 3G0JA 4O70A 5E9YA 4UYHA 4AKNA 4NR4A 5A5PA 3U5JA 4TT6A 5F25A 5FDZA 3QZTA 1JSPB 4NR7A 3U5PA 4Z93A 4CUQA 5EPRA 1JM4B 3DAIA 4ALHA 5I88A 5L99A 4CL9A 2L5EA 4NRBA 4CFKA 3D7CA 5ENFA 4OGIA 5CS8A 5C7NA 4TZ2A 4NYVA 3MQMA 4GPJA 3U5LA 5I1QA 4A9EA 4O71A 2DVVA 5LJ2A 4Z6IA 4QSWA 5FE3A 5AMEA 5FE2A 4N4FA 3UVYA 5HRXA 3FKMX 3P1FA 4QSVA 5IIDA 5EQ1A 2DWWA 2R0SA 5C8GA 4TT4A 1WUMA 5HRVA 4A9MA 4UYDA 5EWHA 5IGNA 4HXOA 4PTBA 5FE0A 5IBNA 5FB0A 5FFWA 4NQNA 4NR5A 5L8TA 4YBSA 4YYJA 2DVQA 3MB3A 5EWDA 3S91A 4NUCA 5DLZA 4PKLA 5L97A 4F3IA 4CUTA 4ZW1A 2WP2A 4QSXA 2YELA 4O74A 5FG5A 4A9IA 4NRCA 5F61A 3UVDA 5CP5A 4IR5A 5FFYA 5LKZA 4YH3A 4QSQA 3RCWA 5LJ1A 5CQAA 4MEOA 4OGJA 5II2A 5ENHA 5EA1A 4A9HA 2YEMA 4DONA 4UYEA 4YABA 4A9OA 4NR6A 5FG4A 4UYFA 5FH8A 2YDWA 4CUPA 4J0RA 5HQ7A 3P1DA 5EP7A 2DKWA 4QUTA 5ENIA 5D3RA 5F60A 5CUDA 5E9MA 4BJXA 5DBMA 5KO4A 5BT4A 4PCEA 2RFJA 5LVRA 5IGLA 2OUOA 2OO1A 3MXFA 1EQFA 3JVMA 2L85A 5ETDA 5EU1A 4UYFB 2R0YA 4UIVA 5HELA 4Z1QA 4TS8A 4HXRA 4CFLA 5I89A 4J3IA 5HJCA 4UIXA 4LRGA 4BW1A 4X2IA 5D25A 4QR3A 5E9VA 5E0RA 4CURA 5I83A 5D3PA 5DYXA 3U5KA 4UITA 5KTWA 5HM0A 4ZQLA 4WIVA 5EV9A 5FFVA 3ZYUA 4Z1SA 4KV1A 4QC3A 5H1UA 4HXKA 2RNYA 5F62A 4YYIA 4QBMA 3AQAA 5CQ8A 5F3AA 5HEMA 4WHUA 5DYCA 5DY7A 5FE9A 3U5OA 2D82A 5AD3A 2D9EA 2F6JA 3DWYA 4O78A 3QZSA 2YQDA 4A9KA 5LJ0A 4NYXA 4UIWA 3UVXA 5HRWA 5DW2A 5D3LA 5KTUA 5I40A 3HMFA 3AADA 5COIA 3IU6A 5EI4A 4BHWA 4NYWA 5EWVA 5KHMA 5CFWA 1ZS5A 5D7XA 5BT3A 5CTLA 4YYMA 4CUSA 5EGUA 5D0CA 4TZ8A 5DX4A 4BW4A 4O7FA 4IOQA 5A5RA 5DYUA 5I7XA 5FE4A 5LUUA 5II1A 4Y03A 5JWMA 4YYGA 2F6NA 2OSSA 4A9LA 5ENJA 5FH6A 5A81A 4MR6A 5TCMA 5CRMA 4RVRA 5L98A 4NXJA 4QSSA 3JVJA 4HBXA 5I86A 5EM3A 3UW9A 5F1LA 4TTEA 4YYKA 5C89A 3LXJA 5IG6A 4QZSA 2RS9B 4LZ2A 5A5OA 5EICA 3MB4A 3NXBA 4WHWA 3O36A 5FE8A 4YY6A 4IORA 5HCLA 5ENEA 4LYSA 3MUKA 5C85A 5KTXA 4QSTA 4QSUA 3UV4A 5FE7A 3TLPA 5EISA 4KV4A 5D3HA 5CRZA 4YYNA 4UIUA 3HMHA 4NR8A 4PY6A 4MR4A 2DATA 3UV2A 4UIZA 5CQTA 5DFBA 1F68A
chains in the Genus database with same CATH superfamily
4NQMA 5CGPA 4Q0NA 5DFCA 4QY4A 4CUUA 3JVLA 5CUAA 4TYLA 5CQ6A 4HXSA 4O75A 4LYIA 2WP1A 3SVFA 3GG3A 2MJVB 5CUEA 4QEVA 4YH4A 4XUBA 4NUDA 5A5QA 4HBVA 4YK0A 5HENA 4YY4A 4LC2A 4BW2A 4LR6A 3ERRA 4QYDA 5ETBA 4XY9A 3U5MA 4YBTA 5CUBA 4LDFA 1E6IA 4YYHA 3SVHA 5D3SA 5FE5A 2E3KA 4MEQA 5AMFA 2DVSA 4PS5A 5A85A 4E96A 5JI8A 4QEWA 4N3WA 4IR3A 4NRAA 3SVGA 4IOOA 4BW3A 4IR6A 4TQNA 5E74A 5HFRA 3K2JA 5LVQA 5D3NA 4N4IA 3P1CA 5KU3A 2RNXA 4QSRA 4LYWA 4MR5A 5EVAA 3ONIA 2N9GA 2RNWA 5BT5A 4XUAA 4N4HA 5E3DA 2E7NA 5D24A 4CLBA 5FB1A 5L96A 4UIYA 5LKXA 5CQ4A 4HXPA 5LKUA 5F1HA 3QZVA 5H1VA 5E3GA 5ACYA 4QR5A 4Z6HA 5F2PA 4LZRA 1N72A 5FG6A 3UVWA 5HQ5A 5E7DA 4O72A 2I8NA 2L84A 5IGMA 5EPBA 5D3JA 5A5NA 4N4GA 2H60A 4O7BA 5IGKA 5J0DA 3O33A 5CY9A 5LKTA 2R0VA 5DKCA 5EWCA 5K29A 5CUCA 4KCXA 2DVRA 5DKDA 5C4QA 2NXBA 4LZSA 4HBWA 4O77A 4YATA 3Q2FA 5CQ3A 5CU8A 3P5OA 4IR4A 4QC1A 3Q2EA 4ZC9A 5DFDA 5DKHA 3JVKA 3LQHA 3O37A 5CQ7A 5A5SA 4Q0OA 4O7CA 5HFQA 4YAXA 2G4AA 4YYDA 4XY8A 5A83A 4MR3A 5F63A 3LQJA 5EPSA 4O7EA 3I3JA 5CUGA 5I29A 5FE6A 5ENBA 4MENA 5ENGA 4FLPA 4HXNA 5FH7A 4XYAA 4HBYA 5CZGA 5EWWA 5E73A 5D3TA 4NR9A 5L8UA 4HXMA 4NUEA 3P1EA 5CQ5A 1X0JA 4QR4A 3LQIA 5H85A 4QNSA 4AI6A 2LSPB 4QB3A 4O7AA 2GRCA 5FBXA 4MEPA 5H1TA 2R10A 4AKIA 4YC9A 4ALGA 2YYNA 4O76A 4TT2A 3O35A 5CPEA 5I80A 5E9LA 5C87A 5D26A 4YADA 3LJWA 4TU6A 5A7CA 4C66A 3HMEA 4A9NA 4YBMA 5HQ6A 4UYGA 1WUGA 4NS5A 5DLXA 5DW1A 4QUUA 2E7OA 5I7YA 2RI7A 5E9IA 2YEKA 5DYAA 5G4RA 5A82A 1PUOA 3IU5A 5G4SA 2YW5A 5TB6A 3UV5A 2I7KA 4C67A 5E9KA 5HLSA 3MULA 5F36A 4PCIA 5AD2A 3G0LA 5FE1A 4J0SA 3O34A 2FSAA 4A9JA 3U5NA 2KTBB 5ENCA 4QEUA 4HXLA 4TU4A 2RO1A 4OUFA 4QSPA 3D1BA 4QYLA 5F5ZA 4A9FA 5EK9A 3S92A 4J1PA 3G0JA 4O70A 5E9YA 4UYHA 4AKNA 4NR4A 5A5PA 3U5JA 4TT6A 5F25A 5FDZA 3QZTA 1JSPB 4NR7A 3U5PA 4Z93A 4CUQA 5EPRA 1JM4B 3DAIA 4ALHA 5I88A 5L99A 4CL9A 2L5EA 4NRBA 4CFKA 3D7CA 5ENFA 4OGIA 5CS8A 5C7NA 4TZ2A 4NYVA 3MQMA 4GPJA 3U5LA 5I1QA 4A9EA 4O71A 2DVVA 5LJ2A 4Z6IA 4QSWA 5FE3A 5AMEA 5FE2A 4N4FA 3UVYA 5HRXA 3FKMX 3D1DA 3P1FA 4QSVA 5IIDA 5EQ1A 2DWWA 2R0SA 5C8GA 4TT4A 1WUMA 3VKHA 1ZKRA 5HRVA 4UYDA 4A9MA 5EWHA 5IGNA 4HXOA 4PTBA 5FE0A 5IBNA 5FB0A 5FFWA 4NQNA 4NR5A 5L8TA 4YBSA 4YYJA 2DVQA 3MB3A 5EWDA 3S91A 4NUCA 5DLZA 4PKLA 5L97A 4F3IA 4CUTA 4ZW1A 2WP2A 4QSXA 2YELA 4O74A 5FG5A 4A9IA 4NRCA 5F61A 3UVDA 5CP5A 4IR5A 5FFYA 5LKZA 4YH3A 4QSQA 3RCWA 5LJ1A 5CQAA 4MEOA 4OGJA 5II2A 5ENHA 5EA1A 4A9HA 2YEMA 4DONA 4UYEA 4YABA 4A9OA 4NR6A 5FG4A 4UYFA 5FH8A 2YDWA 4CUPA 4J0RA 5HQ7A 3P1DA 5EP7A 2DKWA 4QUTA 5ENIA 5D3RA 5F60A 5CUDA 5E9MA 4BJXA 5DBMA 5KO4A 5BT4A 4PCEA 2RFJA 5LVRA 5IGLA 2OUOA 2OO1A 3MXFA 1EQFA 3JVMA 3VKGA 2L85A 5ETDA 5EU1A 4UYFB 4AKHA 2R0YA 4UIVA 4AKGA 5HELA 4Z1QA 4TS8A 4HXRA 4CFLA 5I89A 4J3IA 5HJCA 4UIXA 4LRGA 4BW1A 4X2IA 5D25A 4QR3A 5E9VA 5E0RA 4CURA 5I83A 5D3PA 5DYXA 3U5KA 4UITA 5KTWA 5HM0A 4ZQLA 4WIVA 5EV9A 5FFVA 3ZYUA 4Z1SA 4KV1A 4QC3A 5H1UA 4HXKA 2RNYA 5F62A 4YYIA 4QBMA 3AQAA 5CQ8A 5F3AA 5HEMA 4WHUA 5DYCA 5DY7A 5FE9A 3U5OA 2D82A 5AD3A 2D9EA 2F6JA 3DWYA 4O78A 3QZSA 2YQDA 4A9KA 5LJ0A 4NYXA 4UIWA 3UVXA 5HRWA 5DW2A 5D3LA 5KTUA 5I40A 3HMFA 3AADA 5COIA 3IU6A 5EI4A 4BHWA 4NYWA 5EWVA 5KHMA 5CFWA 1ZS5A 5D7XA 5BT3A 5CTLA 4YYMA 4CUSA 5EGUA 5D0CA 4TZ8A 5DX4A 4BW4A 4O7FA 4IOQA 5A5RA 5DYUA 5I7XA 5FE4A 5LUUA 5II1A 4Y03A 5JWMA 4YYGA 2F6NA 2OSSA 4A9LA 5ENJA 5FH6A 5A81A 4MR6A 5TCMA 5CRMA 4RVRA 5L98A 4NXJA 4QSSA 3JVJA 4HBXA 5I86A 5EM3A 3UW9A 5F1LA 4TTEA 4YYKA 5C89A 3LXJA 2EJNA 5IG6A 4QZSA 2RS9B 4LZ2A 5A5OA 5EICA 3MB4A 3NXBA 4WHWA 3O36A 5FE8A 4YY6A 4IORA 5HCLA 5ENEA 4LYSA 3MUKA 5C85A 5KTXA 4QSTA 4QSUA 3UV4A 5FE7A 3TLPA 5EISA 4KV4A 5D3HA 5CRZA 4YYNA 4UIUA 3HMHA 4NR8A 4PY6A 4MR4A 2DATA 3UV2A 4UIZA 5CQTA 5DFBA 1F68A
chains in the Genus database with same CATH topology
4NQMA 5CGPA 4Q0NA 5DFCA 4QY4A 4CUUA 3JVLA 5CUAA 4TYLA 5CQ6A 4HXSA 4O75A 4LYIA 2WP1A 3SVFA 3GG3A 2MJVB 5CUEA 4QEVA 4YH4A 4XUBA 4NUDA 5A5QA 4HBVA 4YK0A 5HENA 4YY4A 4LC2A 4BW2A 4LR6A 4QYDA 5ETBA 4XY9A 3U5MA 4YBTA 5CUBA 4LDFA 1E6IA 4YYHA 3SVHA 5D3SA 5FE5A 2E3KA 4MEQA 5AMFA 2DVSA 4PS5A 5A85A 4E96A 5JI8A 4QEWA 4N3WA 4IR3A 4NRAA 3SVGA 4IOOA 4BW3A 4IR6A 4TQNA 5E74A 5HFRA 3K2JA 5LVQA 5D3NA 4N4IA 3P1CA 5KU3A 2RNXA 4QSRA 4LYWA 4MR5A 5EVAA 3ONIA 2N9GA 2RNWA 5BT5A 4XUAA 4N4HA 5E3DA 2E7NA 5D24A 4CLBA 5FB1A 5L96A 4UIYA 5LKXA 5CQ4A 4HXPA 5LKUA 5F1HA 3QZVA 5H1VA 5E3GA 5ACYA 4QR5A 4Z6HA 5F2PA 4LZRA 1N72A 5FG6A 3UVWA 5HQ5A 5E7DA 4O72A 2I8NA 2L84A 5IGMA 5EPBA 5D3JA 5A5NA 4N4GA 2H60A 4O7BA 5IGKA 5J0DA 3O33A 5CY9A 5LKTA 2R0VA 5DKCA 5EWCA 5K29A 5CUCA 4KCXA 2DVRA 5DKDA 5C4QA 2NXBA 4LZSA 4HBWA 4O77A 4YATA 3Q2FA 5CQ3A 5CU8A 3P5OA 4IR4A 4QC1A 3Q2EA 4ZC9A 5DFDA 5DKHA 3JVKA 3LQHA 3O37A 5CQ7A 5A5SA 4Q0OA 4O7CA 5HFQA 4YAXA 2G4AA 4YYDA 4XY8A 5A83A 4MR3A 5F63A 3LQJA 5EPSA 4O7EA 3I3JA 5CUGA 5I29A 5FE6A 5ENBA 4MENA 5ENGA 4FLPA 4HXNA 5FH7A 4XYAA 4HBYA 5CZGA 5EWWA 5E73A 5D3TA 4NR9A 5L8UA 4HXMA 4NUEA 3P1EA 5CQ5A 1X0JA 4QR4A 3LQIA 5H85A 4QNSA 2LSPB 4QB3A 4O7AA 2GRCA 5FBXA 4MEPA 5H1TA 2R10A 4YC9A 4ALGA 2YYNA 4O76A 4TT2A 3O35A 5CPEA 5I80A 5E9LA 5C87A 5D26A 4YADA 3LJWA 4TU6A 5A7CA 4C66A 3HMEA 4A9NA 4YBMA 5HQ6A 4UYGA 1WUGA 4NS5A 5DLXA 5DW1A 4QUUA 2E7OA 5I7YA 2RI7A 5E9IA 2YEKA 5DYAA 5G4RA 5A82A 3IU5A 5G4SA 2YW5A 5TB6A 3UV5A 2I7KA 4C67A 5E9KA 5HLSA 3MULA 5F36A 4PCIA 5AD2A 3G0LA 5FE1A 4J0SA 3O34A 2FSAA 4A9JA 3U5NA 2KTBB 5ENCA 4QEUA 4HXLA 4TU4A 2RO1A 4OUFA 4QSPA 4QYLA 5F5ZA 4A9FA 5EK9A 3S92A 4J1PA 3G0JA 4O70A 5E9YA 4UYHA 4AKNA 4NR4A 5A5PA 3U5JA 4TT6A 5F25A 5FDZA 3QZTA 1JSPB 4NR7A 3U5PA 4Z93A 4CUQA 5EPRA 1JM4B 3DAIA 4ALHA 5I88A 5L99A 4CL9A 2L5EA 4NRBA 4CFKA 3D7CA 5ENFA 4OGIA 5CS8A 5C7NA 4TZ2A 4NYVA 3MQMA 4GPJA 3U5LA 5I1QA 4A9EA 4O71A 2DVVA 5LJ2A 4Z6IA 4QSWA 5FE3A 5AMEA 5FE2A 4N4FA 3UVYA 5HRXA 3FKMX 3P1FA 4QSVA 5IIDA 5EQ1A 2DWWA 2R0SA 5C8GA 4TT4A 1WUMA 5HRVA 4A9MA 4UYDA 5EWHA 5IGNA 4HXOA 4PTBA 5FE0A 5IBNA 5FB0A 5FFWA 4NQNA 4NR5A 5L8TA 4YBSA 4YYJA 2DVQA 3MB3A 5EWDA 3S91A 4NUCA 5DLZA 4PKLA 5L97A 4F3IA 4CUTA 4ZW1A 2WP2A 4QSXA 2YELA 4O74A 5FG5A 4A9IA 4NRCA 5F61A 3UVDA 5CP5A 4IR5A 5FFYA 5LKZA 4YH3A 4QSQA 3RCWA 5LJ1A 5CQAA 4MEOA 4OGJA 5II2A 5ENHA 5EA1A 4A9HA 2YEMA 4DONA 4UYEA 4YABA 4A9OA 4NR6A 5FG4A 4UYFA 5FH8A 2YDWA 4CUPA 4J0RA 5HQ7A 3P1DA 5EP7A 2DKWA 4QUTA 5ENIA 5D3RA 5F60A 5CUDA 5E9MA 4BJXA 5DBMA 5KO4A 5BT4A 4PCEA 2RFJA 5LVRA 5IGLA 2OUOA 2OO1A 3MXFA 1EQFA 3JVMA 2L85A 5ETDA 5EU1A 4UYFB 2R0YA 4UIVA 5HELA 4Z1QA 4TS8A 4HXRA 4CFLA 5I89A 4J3IA 5HJCA 4UIXA 4LRGA 4BW1A 4X2IA 5D25A 4QR3A 5E9VA 5E0RA 4CURA 5I83A 5D3PA 5DYXA 3U5KA 4UITA 5KTWA 5HM0A 4ZQLA 4WIVA 5EV9A 5FFVA 3ZYUA 4Z1SA 4KV1A 4QC3A 5H1UA 4HXKA 2RNYA 5F62A 4YYIA 4QBMA 3AQAA 5CQ8A 5F3AA 5HEMA 4WHUA 5DYCA 5DY7A 5FE9A 3U5OA 2D82A 5AD3A 2D9EA 2F6JA 3DWYA 4O78A 3QZSA 2YQDA 4A9KA 5LJ0A 4NYXA 4UIWA 3UVXA 5HRWA 5DW2A 5D3LA 5KTUA 5I40A 3HMFA 3AADA 5COIA 3IU6A 5EI4A 4BHWA 4NYWA 5EWVA 5KHMA 5CFWA 1ZS5A 5D7XA 5BT3A 5CTLA 4YYMA 4CUSA 5EGUA 5D0CA 4TZ8A 5DX4A 4BW4A 4O7FA 4IOQA 5A5RA 5DYUA 5I7XA 5FE4A 5LUUA 5II1A 4Y03A 5JWMA 4YYGA 2F6NA 2OSSA 4A9LA 5ENJA 5FH6A 5A81A 4MR6A 5TCMA 5CRMA 4RVRA 5L98A 4NXJA 4QSSA 3JVJA 4HBXA 5I86A 5EM3A 3UW9A 5F1LA 4TTEA 4YYKA 5C89A 3LXJA 5IG6A 4QZSA 2RS9B 4LZ2A 5A5OA 5EICA 3MB4A 3NXBA 4WHWA 3O36A 5FE8A 4YY6A 4IORA 5HCLA 5ENEA 4LYSA 3MUKA 5C85A 5KTXA 4QSTA 4QSUA 3UV4A 5FE7A 3TLPA 5EISA 4KV4A 5D3HA 5CRZA 4YYNA 4UIUA 3HMHA 4NR8A 4PY6A 4MR4A 2DATA 3UV2A 4UIZA 5CQTA 5DFBA 1F68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQM A;  5CGP A;  4Q0N A;  5DFC A;  4QY4 A;  4CUU A;  3JVL A;  5CUA A;  4TYL A;  5CQ6 A;  4HXS A;  4O75 A;  4LYI A;  2WP1 A;  3SVF A;  3GG3 A;  2MJV B;  5CUE A;  4QEV A;  4YH4 A;  4XUB A;  4NUD A;  5A5Q A;  4HBV A;  4YK0 A;  5HEN A;  4YY4 A;  4LC2 A;  4BW2 A;  4LR6 A;  4QYD A;  5ETB A;  4XY9 A;  3U5M A;  4YBT A;  5CUB A;  4LDF A;  1E6I A;  4YYH A;  3SVH A;  5D3S A;  5FE5 A;  2E3K A;  4MEQ A;  5AMF A;  2DVS A;  4PS5 A;  5A85 A;  4E96 A;  5JI8 A;  4QEW A;  4N3W A;  4IR3 A;  4NRA A;  3SVG A;  4IOO A;  4BW3 A;  4IR6 A;  4TQN A;  5E74 A;  5HFR A;  3K2J A;  5LVQ A;  5D3N A;  4N4I A;  3P1C A;  5KU3 A;  2RNX A;  4QSR A;  4LYW A;  4MR5 A;  5EVA A;  3ONI A;  2N9G A;  2RNW A;  5BT5 A;  4XUA A;  4N4H A;  5E3D A;  2E7N A;  5D24 A;  4CLB A;  5FB1 A;  5L96 A;  4UIY A;  5LKX A;  5CQ4 A;  4HXP A;  5LKU A;  5F1H A;  3QZV A;  5H1V A;  5E3G A;  5ACY A;  4QR5 A;  4Z6H A;  5F2P A;  4LZR A;  1N72 A;  5FG6 A;  3UVW A;  5HQ5 A;  5E7D A;  4O72 A;  2I8N A;  2L84 A;  5IGM A;  5EPB A;  5D3J A;  5A5N A;  4N4G A;  2H60 A;  4O7B A;  5IGK A;  5J0D A;  3O33 A;  5CY9 A;  5LKT A;  2R0V A;  5DKC A;  5EWC A;  5K29 A;  5CUC A;  4KCX A;  2DVR A;  5DKD A;  5C4Q A;  2NXB A;  4LZS A;  4HBW A;  4O77 A;  4YAT A;  3Q2F A;  5CQ3 A;  5CU8 A;  3P5O A;  4IR4 A;  4QC1 A;  3Q2E A;  4ZC9 A;  5DFD A;  5DKH A;  3JVK A;  3LQH A;  3O37 A;  5CQ7 A;  5A5S A;  4Q0O A;  4O7C A;  5HFQ A;  4YAX A;  2G4A A;  4YYD A;  4XY8 A;  5A83 A;  4MR3 A;  5F63 A;  3LQJ A;  5EPS A;  4O7E A;  3I3J A;  5CUG A;  5I29 A;  5FE6 A;  5ENB A;  4MEN A;  5ENG A;  4FLP A;  4HXN A;  5FH7 A;  4XYA A;  4HBY A;  5CZG A;  5EWW A;  5E73 A;  5D3T A;  4NR9 A;  5L8U A;  4HXM A;  4NUE A;  3P1E A;  5CQ5 A;  1X0J A;  4QR4 A;  3LQI A;  5H85 A;  4QNS A;  2LSP B;  4QB3 A;  4O7A A;  2GRC A;  5FBX A;  4MEP A;  5H1T A;  2R10 A;  4YC9 A;  4ALG A;  2YYN A;  4O76 A;  4TT2 A;  3O35 A;  5CPE A;  5I80 A;  5E9L A;  5C87 A;  5D26 A;  4YAD A;  3LJW A;  4TU6 A;  5A7C A;  4C66 A;  3HME A;  4A9N A;  4YBM A;  5HQ6 A;  4UYG A;  1WUG A;  4NS5 A;  5DLX A;  5DW1 A;  4QUU A;  2E7O A;  5I7Y A;  2RI7 A;  5E9I A;  2YEK A;  5DYA A;  5G4R A;  5A82 A;  3IU5 A;  5G4S A;  2YW5 A;  5TB6 A;  3UV5 A;  2I7K A;  4C67 A;  5E9K A;  5HLS A;  3MUL A;  5F36 A;  4PCI A;  5AD2 A;  3G0L A;  5FE1 A;  4J0S A;  3O34 A;  2FSA A;  4A9J A;  3U5N A;  2KTB B;  5ENC A;  4QEU A;  4HXL A;  4TU4 A;  2RO1 A;  4OUF A;  4QSP A;  4QYL A;  5F5Z A;  4A9F A;  5EK9 A;  3S92 A;  4J1P A;  3G0J A;  4O70 A;  5E9Y A;  4UYH A;  4AKN A;  4NR4 A;  5A5P A;  3U5J A;  4TT6 A;  5F25 A;  5FDZ A;  3QZT A;  1JSP B;  4NR7 A;  3U5P A;  4Z93 A;  4CUQ A;  5EPR A;  1JM4 B;  3DAI A;  4ALH A;  5I88 A;  5L99 A;  4CL9 A;  2L5E A;  4NRB A;  4CFK A;  3D7C A;  5ENF A;  4OGI A;  5CS8 A;  5C7N A;  4TZ2 A;  4NYV A;  3MQM A;  4GPJ A;  3U5L A;  5I1Q A;  4A9E A;  4O71 A;  2DVV A;  5LJ2 A;  4Z6I A;  4QSW A;  5FE3 A;  5AME A;  5FE2 A;  4N4F A;  3UVY A;  5HRX A;  3FKM X;  3P1F A;  4QSV A;  5IID A;  5EQ1 A;  2DWW A;  2R0S A;  5C8G A;  4TT4 A;  1WUM A;  5HRV A;  4A9M A;  4UYD A;  5EWH A;  5IGN A;  4HXO A;  4PTB A;  5FE0 A;  5IBN A;  5FB0 A;  5FFW A;  4NQN A;  4NR5 A;  5L8T A;  4YBS A;  4YYJ A;  2DVQ A;  3MB3 A;  5EWD A;  3S91 A;  4NUC A;  5DLZ A;  4PKL A;  5L97 A;  4F3I A;  4CUT A;  4ZW1 A;  2WP2 A;  4QSX A;  2YEL A;  4O74 A;  5FG5 A;  4A9I A;  4NRC A;  5F61 A;  3UVD A;  5CP5 A;  4IR5 A;  5FFY A;  5LKZ A;  4YH3 A;  4QSQ A;  3RCW A;  5LJ1 A;  5CQA A;  4MEO A;  4OGJ A;  5II2 A;  5ENH A;  5EA1 A;  4A9H A;  2YEM A;  4DON A;  4UYE A;  4YAB A;  4A9O A;  4NR6 A;  5FG4 A;  4UYF A;  5FH8 A;  2YDW A;  4CUP A;  4J0R A;  5HQ7 A;  3P1D A;  5EP7 A;  2DKW A;  4QUT A;  5ENI A;  5D3R A;  5F60 A;  5CUD A;  5E9M A;  4BJX A;  5DBM A;  5KO4 A;  5BT4 A;  4PCE A;  2RFJ A;  5LVR A;  5IGL A;  2OUO A;  2OO1 A;  3MXF A;  1EQF A;  3JVM A;  2L85 A;  5ETD A;  5EU1 A;  4UYF B;  2R0Y A;  4UIV A;  5HEL A;  4Z1Q A;  4TS8 A;  4HXR A;  4CFL A;  5I89 A;  4J3I A;  5HJC A;  4UIX A;  4LRG A;  4BW1 A;  4X2I A;  5D25 A;  4QR3 A;  5E9V A;  5E0R A;  4CUR A;  5I83 A;  5D3P A;  5DYX A;  3U5K A;  4UIT A;  5KTW A;  5HM0 A;  4ZQL A;  4WIV A;  5EV9 A;  5FFV A;  3ZYU A;  4Z1S A;  4KV1 A;  4QC3 A;  5H1U A;  4HXK A;  2RNY A;  5F62 A;  4YYI A;  4QBM A;  3AQA A;  5CQ8 A;  5F3A A;  5HEM A;  4WHU A;  5DYC A;  5DY7 A;  5FE9 A;  3U5O A;  2D82 A;  5AD3 A;  2D9E A;  2F6J A;  3DWY A;  4O78 A;  3QZS A;  2YQD A;  4A9K A;  5LJ0 A;  4NYX A;  4UIW A;  3UVX A;  5HRW A;  5DW2 A;  5D3L A;  5KTU A;  5I40 A;  3HMF A;  3AAD A;  5COI A;  3IU6 A;  5EI4 A;  4BHW A;  4NYW A;  5EWV A;  5KHM A;  5CFW A;  1ZS5 A;  5D7X A;  5BT3 A;  5CTL A;  4YYM A;  4CUS A;  5EGU A;  5D0C A;  4TZ8 A;  5DX4 A;  4BW4 A;  4O7F A;  4IOQ A;  5A5R A;  5DYU A;  5I7X A;  5FE4 A;  5LUU A;  5II1 A;  4Y03 A;  5JWM A;  4YYG A;  2F6N A;  2OSS A;  4A9L A;  5ENJ A;  5FH6 A;  5A81 A;  4MR6 A;  5TCM A;  5CRM A;  4RVR A;  5L98 A;  4NXJ A;  4QSS A;  3JVJ A;  4HBX A;  5I86 A;  5EM3 A;  3UW9 A;  5F1L A;  4TTE A;  4YYK A;  5C89 A;  3LXJ A;  5IG6 A;  4QZS A;  2RS9 B;  4LZ2 A;  5A5O A;  5EIC A;  3MB4 A;  3NXB A;  4WHW A;  3O36 A;  5FE8 A;  4YY6 A;  4IOR A;  5HCL A;  5ENE A;  4LYS A;  3MUK A;  5C85 A;  5KTX A;  4QST A;  4QSU A;  3UV4 A;  5FE7 A;  3TLP A;  5EIS A;  4KV4 A;  5D3H A;  5CRZ A;  4YYN A;  4UIU A;  3HMH A;  4NR8 A;  4PY6 A;  4MR4 A;  2DAT A;  3UV2 A;  4UIZ A;  5CQT A;  5DFB A;  1F68 A; 
#chains in the Genus database with same CATH topology
 4NQM A;  5CGP A;  4Q0N A;  5DFC A;  4QY4 A;  4CUU A;  3JVL A;  5CUA A;  4TYL A;  5CQ6 A;  4HXS A;  4O75 A;  4LYI A;  2WP1 A;  3SVF A;  3GG3 A;  2MJV B;  5CUE A;  4QEV A;  4YH4 A;  4XUB A;  4NUD A;  5A5Q A;  4HBV A;  4YK0 A;  5HEN A;  4YY4 A;  4LC2 A;  4BW2 A;  4LR6 A;  3ERR A;  4QYD A;  5ETB A;  4XY9 A;  3U5M A;  4YBT A;  5CUB A;  4LDF A;  1E6I A;  4YYH A;  3SVH A;  5D3S A;  5FE5 A;  2E3K A;  4MEQ A;  5AMF A;  2DVS A;  4PS5 A;  5A85 A;  4E96 A;  5JI8 A;  4QEW A;  4N3W A;  4IR3 A;  4NRA A;  3SVG A;  4IOO A;  4BW3 A;  4IR6 A;  4TQN A;  5E74 A;  5HFR A;  3K2J A;  5LVQ A;  5D3N A;  4N4I A;  3P1C A;  5KU3 A;  2RNX A;  4QSR A;  4LYW A;  4MR5 A;  5EVA A;  3ONI A;  2N9G A;  2RNW A;  5BT5 A;  4XUA A;  4N4H A;  5E3D A;  2E7N A;  5D24 A;  4CLB A;  5FB1 A;  5L96 A;  4UIY A;  5LKX A;  5CQ4 A;  4HXP A;  5LKU A;  5F1H A;  3QZV A;  5H1V A;  5E3G A;  5ACY A;  4QR5 A;  4Z6H A;  5F2P A;  4LZR A;  1N72 A;  5FG6 A;  3UVW A;  5HQ5 A;  5E7D A;  4O72 A;  2I8N A;  2L84 A;  5IGM A;  5EPB A;  5D3J A;  5A5N A;  4N4G A;  2H60 A;  4O7B A;  5IGK A;  5J0D A;  3O33 A;  5CY9 A;  5LKT A;  2R0V A;  5DKC A;  5EWC A;  5K29 A;  5CUC A;  4KCX A;  2DVR A;  5DKD A;  5C4Q A;  2NXB A;  4LZS A;  4HBW A;  4O77 A;  4YAT A;  3Q2F A;  5CQ3 A;  5CU8 A;  3P5O A;  4IR4 A;  4QC1 A;  3Q2E A;  4ZC9 A;  5DFD A;  5DKH A;  3JVK A;  3LQH A;  3O37 A;  5CQ7 A;  5A5S A;  4Q0O A;  4O7C A;  5HFQ A;  4YAX A;  2G4A A;  4YYD A;  4XY8 A;  5A83 A;  4MR3 A;  5F63 A;  3LQJ A;  5EPS A;  4O7E A;  3I3J A;  5CUG A;  5I29 A;  5FE6 A;  5ENB A;  4MEN A;  5ENG A;  4FLP A;  4HXN A;  5FH7 A;  4XYA A;  4HBY A;  5CZG A;  5EWW A;  5E73 A;  5D3T A;  4NR9 A;  5L8U A;  4HXM A;  4NUE A;  3P1E A;  5CQ5 A;  1X0J A;  4QR4 A;  3LQI A;  5H85 A;  4QNS A;  4AI6 A;  2LSP B;  4QB3 A;  4O7A A;  2GRC A;  5FBX A;  4MEP A;  5H1T A;  2R10 A;  4AKI A;  4YC9 A;  4ALG A;  2YYN A;  4O76 A;  4TT2 A;  3O35 A;  5CPE A;  5I80 A;  5E9L A;  5C87 A;  5D26 A;  4YAD A;  3LJW A;  4TU6 A;  5A7C A;  4C66 A;  3HME A;  4A9N A;  4YBM A;  5HQ6 A;  4UYG A;  1WUG A;  4NS5 A;  5DLX A;  5DW1 A;  4QUU A;  2E7O A;  5I7Y A;  2RI7 A;  5E9I A;  2YEK A;  5DYA A;  5G4R A;  5A82 A;  1PUO A;  3IU5 A;  5G4S A;  2YW5 A;  5TB6 A;  3UV5 A;  2I7K A;  4C67 A;  5E9K A;  5HLS A;  3MUL A;  5F36 A;  4PCI A;  5AD2 A;  3G0L A;  5FE1 A;  4J0S A;  3O34 A;  2FSA A;  4A9J A;  3U5N A;  2KTB B;  5ENC A;  4QEU A;  4HXL A;  4TU4 A;  2RO1 A;  4OUF A;  4QSP A;  3D1B A;  4QYL A;  5F5Z A;  4A9F A;  5EK9 A;  3S92 A;  4J1P A;  3G0J A;  4O70 A;  5E9Y A;  4UYH A;  4AKN A;  4NR4 A;  5A5P A;  3U5J A;  4TT6 A;  5F25 A;  5FDZ A;  3QZT A;  1JSP B;  4NR7 A;  3U5P A;  4Z93 A;  4CUQ A;  5EPR A;  1JM4 B;  3DAI A;  4ALH A;  5I88 A;  5L99 A;  4CL9 A;  2L5E A;  4NRB A;  4CFK A;  3D7C A;  5ENF A;  4OGI A;  5CS8 A;  5C7N A;  4TZ2 A;  4NYV A;  3MQM A;  4GPJ A;  3U5L A;  5I1Q A;  4A9E A;  4O71 A;  2DVV A;  5LJ2 A;  4Z6I A;  4QSW A;  5FE3 A;  5AME A;  5FE2 A;  4N4F A;  3UVY A;  5HRX A;  3FKM X;  3D1D A;  3P1F A;  4QSV A;  5IID A;  5EQ1 A;  2DWW A;  2R0S A;  5C8G A;  4TT4 A;  1WUM A;  3VKH A;  1ZKR A;  5HRV A;  4UYD A;  4A9M A;  5EWH A;  5IGN A;  4HXO A;  4PTB A;  5FE0 A;  5IBN A;  5FB0 A;  5FFW A;  4NQN A;  4NR5 A;  5L8T A;  4YBS A;  4YYJ A;  2DVQ A;  3MB3 A;  5EWD A;  3S91 A;  4NUC A;  5DLZ A;  4PKL A;  5L97 A;  4F3I A;  4CUT A;  4ZW1 A;  2WP2 A;  4QSX A;  2YEL A;  4O74 A;  5FG5 A;  4A9I A;  4NRC A;  5F61 A;  3UVD A;  5CP5 A;  4IR5 A;  5FFY A;  5LKZ A;  4YH3 A;  4QSQ A;  3RCW A;  5LJ1 A;  5CQA A;  4MEO A;  4OGJ A;  5II2 A;  5ENH A;  5EA1 A;  4A9H A;  2YEM A;  4DON A;  4UYE A;  4YAB A;  4A9O A;  4NR6 A;  5FG4 A;  4UYF A;  5FH8 A;  2YDW A;  4CUP A;  4J0R A;  5HQ7 A;  3P1D A;  5EP7 A;  2DKW A;  4QUT A;  5ENI A;  5D3R A;  5F60 A;  5CUD A;  5E9M A;  4BJX A;  5DBM A;  5KO4 A;  5BT4 A;  4PCE A;  2RFJ A;  5LVR A;  5IGL A;  2OUO A;  2OO1 A;  3MXF A;  1EQF A;  3JVM A;  3VKG A;  2L85 A;  5ETD A;  5EU1 A;  4UYF B;  4AKH A;  2R0Y A;  4UIV A;  4AKG A;  5HEL A;  4Z1Q A;  4TS8 A;  4HXR A;  4CFL A;  5I89 A;  4J3I A;  5HJC A;  4UIX A;  4LRG A;  4BW1 A;  4X2I A;  5D25 A;  4QR3 A;  5E9V A;  5E0R A;  4CUR A;  5I83 A;  5D3P A;  5DYX A;  3U5K A;  4UIT A;  5KTW A;  5HM0 A;  4ZQL A;  4WIV A;  5EV9 A;  5FFV A;  3ZYU A;  4Z1S A;  4KV1 A;  4QC3 A;  5H1U A;  4HXK A;  2RNY A;  5F62 A;  4YYI A;  4QBM A;  3AQA A;  5CQ8 A;  5F3A A;  5HEM A;  4WHU A;  5DYC A;  5DY7 A;  5FE9 A;  3U5O A;  2D82 A;  5AD3 A;  2D9E A;  2F6J A;  3DWY A;  4O78 A;  3QZS A;  2YQD A;  4A9K A;  5LJ0 A;  4NYX A;  4UIW A;  3UVX A;  5HRW A;  5DW2 A;  5D3L A;  5KTU A;  5I40 A;  3HMF A;  3AAD A;  5COI A;  3IU6 A;  5EI4 A;  4BHW A;  4NYW A;  5EWV A;  5KHM A;  5CFW A;  1ZS5 A;  5D7X A;  5BT3 A;  5CTL A;  4YYM A;  4CUS A;  5EGU A;  5D0C A;  4TZ8 A;  5DX4 A;  4BW4 A;  4O7F A;  4IOQ A;  5A5R A;  5DYU A;  5I7X A;  5FE4 A;  5LUU A;  5II1 A;  4Y03 A;  5JWM A;  4YYG A;  2F6N A;  2OSS A;  4A9L A;  5ENJ A;  5FH6 A;  5A81 A;  4MR6 A;  5TCM A;  5CRM A;  4RVR A;  5L98 A;  4NXJ A;  4QSS A;  3JVJ A;  4HBX A;  5I86 A;  5EM3 A;  3UW9 A;  5F1L A;  4TTE A;  4YYK A;  5C89 A;  3LXJ A;  2EJN A;  5IG6 A;  4QZS A;  2RS9 B;  4LZ2 A;  5A5O A;  5EIC A;  3MB4 A;  3NXB A;  4WHW A;  3O36 A;  5FE8 A;  4YY6 A;  4IOR A;  5HCL A;  5ENE A;  4LYS A;  3MUK A;  5C85 A;  5KTX A;  4QST A;  4QSU A;  3UV4 A;  5FE7 A;  3TLP A;  5EIS A;  4KV4 A;  5D3H A;  5CRZ A;  4YYN A;  4UIU A;  3HMH A;  4NR8 A;  4PY6 A;  4MR4 A;  2DAT A;  3UV2 A;  4UIZ A;  5CQT A;  5DFB A;  1F68 A; 
#chains in the Genus database with same CATH homology
 4NQM A;  5CGP A;  4Q0N A;  5DFC A;  4QY4 A;  4CUU A;  3JVL A;  5CUA A;  4TYL A;  5CQ6 A;  4HXS A;  4O75 A;  4LYI A;  2WP1 A;  3SVF A;  3GG3 A;  2MJV B;  5CUE A;  4QEV A;  4YH4 A;  4XUB A;  4NUD A;  5A5Q A;  4HBV A;  4YK0 A;  5HEN A;  4YY4 A;  4LC2 A;  4BW2 A;  4LR6 A;  4QYD A;  5ETB A;  4XY9 A;  3U5M A;  4YBT A;  5CUB A;  4LDF A;  1E6I A;  4YYH A;  3SVH A;  5D3S A;  5FE5 A;  2E3K A;  4MEQ A;  5AMF A;  2DVS A;  4PS5 A;  5A85 A;  4E96 A;  5JI8 A;  4QEW A;  4N3W A;  4IR3 A;  4NRA A;  3SVG A;  4IOO A;  4BW3 A;  4IR6 A;  4TQN A;  5E74 A;  5HFR A;  3K2J A;  5LVQ A;  5D3N A;  4N4I A;  3P1C A;  5KU3 A;  2RNX A;  4QSR A;  4LYW A;  4MR5 A;  5EVA A;  3ONI A;  2N9G A;  2RNW A;  5BT5 A;  4XUA A;  4N4H A;  5E3D A;  2E7N A;  5D24 A;  4CLB A;  5FB1 A;  5L96 A;  4UIY A;  5LKX A;  5CQ4 A;  4HXP A;  5LKU A;  5F1H A;  3QZV A;  5H1V A;  5E3G A;  5ACY A;  4QR5 A;  4Z6H A;  5F2P A;  4LZR A;  1N72 A;  5FG6 A;  3UVW A;  5HQ5 A;  5E7D A;  4O72 A;  2I8N A;  2L84 A;  5IGM A;  5EPB A;  5D3J A;  5A5N A;  4N4G A;  2H60 A;  4O7B A;  5IGK A;  5J0D A;  3O33 A;  5CY9 A;  5LKT A;  2R0V A;  5DKC A;  5EWC A;  5K29 A;  5CUC A;  4KCX A;  2DVR A;  5DKD A;  5C4Q A;  2NXB A;  4LZS A;  4HBW A;  4O77 A;  4YAT A;  3Q2F A;  5CQ3 A;  5CU8 A;  3P5O A;  4IR4 A;  4QC1 A;  3Q2E A;  4ZC9 A;  5DFD A;  5DKH A;  3JVK A;  3LQH A;  3O37 A;  5CQ7 A;  5A5S A;  4Q0O A;  4O7C A;  5HFQ A;  4YAX A;  2G4A A;  4YYD A;  4XY8 A;  5A83 A;  4MR3 A;  5F63 A;  3LQJ A;  5EPS A;  4O7E A;  3I3J A;  5CUG A;  5I29 A;  5FE6 A;  5ENB A;  4MEN A;  5ENG A;  4FLP A;  4HXN A;  5FH7 A;  4XYA A;  4HBY A;  5CZG A;  5EWW A;  5E73 A;  5D3T A;  4NR9 A;  5L8U A;  4HXM A;  4NUE A;  3P1E A;  5CQ5 A;  1X0J A;  4QR4 A;  3LQI A;  5H85 A;  4QNS A;  2LSP B;  4QB3 A;  4O7A A;  2GRC A;  5FBX A;  4MEP A;  5H1T A;  2R10 A;  4YC9 A;  4ALG A;  2YYN A;  4O76 A;  4TT2 A;  3O35 A;  5CPE A;  5I80 A;  5E9L A;  5C87 A;  5D26 A;  4YAD A;  3LJW A;  4TU6 A;  5A7C A;  4C66 A;  3HME A;  4A9N A;  4YBM A;  5HQ6 A;  4UYG A;  1WUG A;  4NS5 A;  5DLX A;  5DW1 A;  4QUU A;  2E7O A;  5I7Y A;  2RI7 A;  5E9I A;  2YEK A;  5DYA A;  5G4R A;  5A82 A;  3IU5 A;  5G4S A;  2YW5 A;  5TB6 A;  3UV5 A;  2I7K A;  4C67 A;  5E9K A;  5HLS A;  3MUL A;  5F36 A;  4PCI A;  5AD2 A;  3G0L A;  5FE1 A;  4J0S A;  3O34 A;  2FSA A;  4A9J A;  3U5N A;  2KTB B;  5ENC A;  4QEU A;  4HXL A;  4TU4 A;  2RO1 A;  4OUF A;  4QSP A;  4QYL A;  5F5Z A;  4A9F A;  5EK9 A;  3S92 A;  4J1P A;  3G0J A;  4O70 A;  5E9Y A;  4UYH A;  4AKN A;  4NR4 A;  5A5P A;  3U5J A;  4TT6 A;  5F25 A;  5FDZ A;  3QZT A;  1JSP B;  4NR7 A;  3U5P A;  4Z93 A;  4CUQ A;  5EPR A;  1JM4 B;  3DAI A;  4ALH A;  5I88 A;  5L99 A;  4CL9 A;  2L5E A;  4NRB A;  4CFK A;  3D7C A;  5ENF A;  4OGI A;  5CS8 A;  5C7N A;  4TZ2 A;  4NYV A;  3MQM A;  4GPJ A;  3U5L A;  5I1Q A;  4A9E A;  4O71 A;  2DVV A;  5LJ2 A;  4Z6I A;  4QSW A;  5FE3 A;  5AME A;  5FE2 A;  4N4F A;  3UVY A;  5HRX A;  3FKM X;  3P1F A;  4QSV A;  5IID A;  5EQ1 A;  2DWW A;  2R0S A;  5C8G A;  4TT4 A;  1WUM A;  5HRV A;  4A9M A;  4UYD A;  5EWH A;  5IGN A;  4HXO A;  4PTB A;  5FE0 A;  5IBN A;  5FB0 A;  5FFW A;  4NQN A;  4NR5 A;  5L8T A;  4YBS A;  4YYJ A;  2DVQ A;  3MB3 A;  5EWD A;  3S91 A;  4NUC A;  5DLZ A;  4PKL A;  5L97 A;  4F3I A;  4CUT A;  4ZW1 A;  2WP2 A;  4QSX A;  2YEL A;  4O74 A;  5FG5 A;  4A9I A;  4NRC A;  5F61 A;  3UVD A;  5CP5 A;  4IR5 A;  5FFY A;  5LKZ A;  4YH3 A;  4QSQ A;  3RCW A;  5LJ1 A;  5CQA A;  4MEO A;  4OGJ A;  5II2 A;  5ENH A;  5EA1 A;  4A9H A;  2YEM A;  4DON A;  4UYE A;  4YAB A;  4A9O A;  4NR6 A;  5FG4 A;  4UYF A;  5FH8 A;  2YDW A;  4CUP A;  4J0R A;  5HQ7 A;  3P1D A;  5EP7 A;  2DKW A;  4QUT A;  5ENI A;  5D3R A;  5F60 A;  5CUD A;  5E9M A;  4BJX A;  5DBM A;  5KO4 A;  5BT4 A;  4PCE A;  2RFJ A;  5LVR A;  5IGL A;  2OUO A;  2OO1 A;  3MXF A;  1EQF A;  3JVM A;  2L85 A;  5ETD A;  5EU1 A;  4UYF B;  2R0Y A;  4UIV A;  5HEL A;  4Z1Q A;  4TS8 A;  4HXR A;  4CFL A;  5I89 A;  4J3I A;  5HJC A;  4UIX A;  4LRG A;  4BW1 A;  4X2I A;  5D25 A;  4QR3 A;  5E9V A;  5E0R A;  4CUR A;  5I83 A;  5D3P A;  5DYX A;  3U5K A;  4UIT A;  5KTW A;  5HM0 A;  4ZQL A;  4WIV A;  5EV9 A;  5FFV A;  3ZYU A;  4Z1S A;  4KV1 A;  4QC3 A;  5H1U A;  4HXK A;  2RNY A;  5F62 A;  4YYI A;  4QBM A;  3AQA A;  5CQ8 A;  5F3A A;  5HEM A;  4WHU A;  5DYC A;  5DY7 A;  5FE9 A;  3U5O A;  2D82 A;  5AD3 A;  2D9E A;  2F6J A;  3DWY A;  4O78 A;  3QZS A;  2YQD A;  4A9K A;  5LJ0 A;  4NYX A;  4UIW A;  3UVX A;  5HRW A;  5DW2 A;  5D3L A;  5KTU A;  5I40 A;  3HMF A;  3AAD A;  5COI A;  3IU6 A;  5EI4 A;  4BHW A;  4NYW A;  5EWV A;  5KHM A;  5CFW A;  1ZS5 A;  5D7X A;  5BT3 A;  5CTL A;  4YYM A;  4CUS A;  5EGU A;  5D0C A;  4TZ8 A;  5DX4 A;  4BW4 A;  4O7F A;  4IOQ A;  5A5R A;  5DYU A;  5I7X A;  5FE4 A;  5LUU A;  5II1 A;  4Y03 A;  5JWM A;  4YYG A;  2F6N A;  2OSS A;  4A9L A;  5ENJ A;  5FH6 A;  5A81 A;  4MR6 A;  5TCM A;  5CRM A;  4RVR A;  5L98 A;  4NXJ A;  4QSS A;  3JVJ A;  4HBX A;  5I86 A;  5EM3 A;  3UW9 A;  5F1L A;  4TTE A;  4YYK A;  5C89 A;  3LXJ A;  5IG6 A;  4QZS A;  2RS9 B;  4LZ2 A;  5A5O A;  5EIC A;  3MB4 A;  3NXB A;  4WHW A;  3O36 A;  5FE8 A;  4YY6 A;  4IOR A;  5HCL A;  5ENE A;  4LYS A;  3MUK A;  5C85 A;  5KTX A;  4QST A;  4QSU A;  3UV4 A;  5FE7 A;  3TLP A;  5EIS A;  4KV4 A;  5D3H A;  5CRZ A;  4YYN A;  4UIU A;  3HMH A;  4NR8 A;  4PY6 A;  4MR4 A;  2DAT A;  3UV2 A;  4UIZ A;  5CQT A;  5DFB A;  1F68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...