4KV4A

Brd4 bromodomain 2 in complex with acetylated rel peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
111
structure length
111
Chain Sequence
AGSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Brd4 maintains constitutively active NF-kappa B in cancer cells by binding to acetylated RelA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4kv4A00
5L96A 5LKZA 5D3SA 5BT4A 4J1PA 4XYAA 2YEKA 3U5OA 5FE2A 3U5NA 4BHWA 2YELA 5FH8A 5IGLA 5CRZA 5CTLA 5F3AA 3UVWA 5FE0A 5DLZA 5I89A 3UW9A 5IGKA 1F68A 4NUDA 5L8UA 2MJVB 4PCIA 4LZRA 4HXRA 5EPBA 4A9OA 1JSPB 4XUBA 5EWVA 5HELA 4LYWA 4IR5A 3RCWA 4KV4A 3AQAA 5D7XA 2DATA 5DKHA 4YH4A 3LQJA 5FB0A 4O78A 4Z93A 4WHWA 5FH6A 5JI8A 4O7AA 5HQ6A 4UIZA 2LSPB 5HRWA 5EWWA 4N4GA 2OSSA 4HXLA 5A5QA 5BT3A 5HENA 4YBTA 5DLXA 5KO4A 5CRMA 3LQHA 4YYHA 4Q0OA 5I7XA 2D82A 4TQNA 4UYGA 3QZTA 4A9EA 5ENGA 3JVKA 5FE6A 3HMFA 1ZS5A 4UIYA 5EU1A 4QSPA 4HXPA 2F6JA 4LC2A 4QSUA 5CUDA 5E9LA 5CQ7A 5DKDA 5CP5A 5A82A 3UV5A 4UIXA 5DYAA 4HXNA 1X0JA 2F6NA 4Q0NA 4WHUA 4N3WA 5ETDA 5AMFA 4X2IA 4MEOA 2L84A 4NYVA 5F25A 2G4AA 5EISA 4QUUA 5K29A 4UIWA 5HFQA 5DFBA 1EQFA 5F2PA 4A9JA 4MENA 5A5SA 2E3KA 5A81A 4QSRA 2KTBB 2R10A 3U5LA 5FG6A 5KTXA 5LKTA 4ZQLA 4XUAA 5EA1A 4O7CA 5D3NA 4A9IA 4CUPA 5EK9A 2RS9B 4QY4A 5CUBA 3QZVA 2DWWA 5EWDA 5LKXA 4YABA 5JWMA 5CQ4A 1WUGA 4O75A 2WP2A 4MEQA 5CUGA 5KHMA 4CURA 4NYWA 4BJXA 4ZC9A 4QYLA 5D3TA 2GRCA 3ZYUA 4N4HA 4O70A 4IR6A 5EP7A 4QBMA 5HFRA 4YYMA 4MR3A 5E9KA 5FDZA 5HQ5A 4QR5A 4N4FA 5CQ3A 4PCEA 5COIA 5II1A 5E3GA 5E9VA 5FFWA 5D3HA 5FBXA 5ENEA 4FLPA 5F1LA 4IR4A 3S91A 5L99A 4Y03A 5FE1A 4MEPA 4NR9A 5A5NA 3HMEA 4A9FA 5EVAA 2E7NA 4NR4A 5DW1A 4ALHA 3MB4A 5H85A 4O7BA 2YDWA 3SVFA 4LDFA 2L5EA 5CQ6A 5LUUA 4Z1QA 4QC3A 4N4IA 4YYNA 4NR6A 5FH7A 5IG6A 4Z1SA 2H60A 4QZSA 5EI4A 3O33A 5LKUA 5DYXA 4HXOA 2I8NA 5DFCA 5DYUA 2WP1A 3K2JA 5J0DA 4O76A 2DVVA 4J0RA 5A85A 5D24A 5C89A 3HMHA 3UV4A 5FE7A 2R0YA 3P1DA 5EQ1A 4CL9A 4C67A 5TB6A 4DONA 4LYSA 4UYHA 2RFJA 3JVMA 4XY9A 3LQIA 5L98A 5CY9A 5HJCA 4NUCA 5CFWA 3I3JA 5EPRA 5EGUA 4UYFA 4HXSA 4J3IA 2DKWA 4YAXA 5II2A 2YQDA 5LVQA 4YADA 3UV2A 3AADA 3O34A 4HXMA 5KTUA 4YBSA 5CS8A 2R0SA 3S92A 5I86A 5AD2A 5FFYA 5EM3A 4BW1A 2RNXA 5E9IA 4NRBA 2NXBA 3P1FA 5D25A 4O72A 4QR3A 1WUMA 3LJWA 4ALGA 4A9HA 5I83A 3UVYA 2RNYA 4TYLA 4CFLA 5C87A 5FE9A 3MULA 4QNSA 4NQNA 4O7EA 3G0JA 5ENFA 4UYFB 4NR7A 4E96A 5CZGA 2OUOA 4OGIA 1E6IA 3SVHA 4A9NA 4TU4A 4BW2A 5FE5A 5A5RA 2D9EA 4YC9A 5ENJA 4YK0A 5F63A 4O71A 4A9KA 4QC1A 4PKLA 5CU8A 4HBVA 4QYDA 4J0SA 5ENHA 5CUCA 5EWHA 5H1TA 5HRVA 4XY8A 2E7OA 2OO1A 5FE8A 4NRCA 4LZSA 5CQTA 4CUQA 2DVSA 5ACYA 3TLPA 3P5OA 3O35A 4MR6A 3GG3A 5IGMA 5D26A 5HEMA 3G0LA 5A5OA 5IBNA 4YY6A 3IU5A 2YW5A 3NXBA 5L8TA 4O7FA 4A9MA 5C7NA 4NR8A 5TCMA 5DX4A 5EV9A 4F3IA 4KV1A 3D7CA 4CLBA 5E0RA 4YATA 5CUEA 2YEMA 5CPEA 4LYIA 5F36A 4TTEA 5F61A 5E7DA 5F1HA 1JM4B 4QEVA 3U5PA 5CUAA 4Z6HA 4CUTA 4YYDA 4KCXA 3UVXA 4TU6A 4UYDA 5D3PA 3U5JA 4LRGA 4WIVA 5D3JA 3Q2FA 4NQMA 4YBMA 4QSVA 3QZSA 5I29A 4HXKA 2R0VA 4ZW1A 4HBYA 3O36A 5D0CA 5HLSA 5BT5A 5C85A 1N72A 3Q2EA 2DVQA 5D3LA 5DY7A 4HBWA 3MXFA 5ENCA 2DVRA 3IU6A 3ONIA 3P1CA 3U5MA 5C8GA 4UYEA 4IOQA 4NR5A 5G4RA 4QSQA 4QSWA 5HRXA 5H1VA 4QSXA 4NRAA 4LR6A 5F62A 5F60A 4HBXA 3JVLA 5EWCA 2FSAA 4NUEA 5FG4A 5DW2A 4CUSA 5I1QA 2I7KA 5ETBA 5DBMA 4QUTA 5I80A 5E9MA 4YY4A 5FFVA 4QEWA 5A5PA 5AD3A 3FKMX 5EICA 4TT2A 4QSTA 3LXJA 5E9YA 5EPSA 4QR4A 4IOOA 4C66A 5FG5A 4TZ8A 5HCLA 4YYGA 5FE4A 3O37A 5I7YA 4AKNA 3P1EA 5IIDA 4TT6A 5I40A 5KU3A 4QSSA 3DWYA 2YYNA 5I88A 2L85A 2RO1A 4A9LA 5A83A 5IGNA 5H1UA 5LJ1A 5DYCA 5DKCA 5HM0A 5F5ZA 5DFDA 5CQ8A 4LZ2A 5E73A 3DAIA 5KTWA 2N9GA 5FB1A 4PTBA 4PS5A 3UVDA 4IORA 5FE3A 4MR5A 4TS8A 3SVGA 5CQ5A 4YYKA 3MQMA 4YYJA 4BW4A 4O77A 2RI7A 5E74A 4CUUA 4GPJA 4YYIA 5G4SA 4NS5A 3U5KA 4UIUA 5A7CA 4TZ2A 2RNWA 4UITA 5CQAA 4RVRA 3MUKA 4MR4A 4NYXA 5E3DA 4O74A 4YH3A 4NXJA 4TT4A 4QB3A 3JVJA 4OUFA 5CGPA 5D3RA 4BW3A 4Z6IA 5LJ0A 5HQ7A 4PY6A 4QEUA 5LJ2A 5ENIA 5AMEA 4UIVA 4IR3A 3MB3A 5LVRA 4CFKA 5C4QA 5L97A 4OGJA 5ENBA
chains in the Genus database with same CATH superfamily
5L96A 5LKZA 5D3SA 5BT4A 4J1PA 4XYAA 2YEKA 3U5OA 5FE2A 3U5NA 4BHWA 2YELA 5FH8A 5IGLA 5CRZA 5CTLA 5F3AA 3UVWA 3VKHA 5FE0A 5DLZA 5I89A 3UW9A 5IGKA 1F68A 4NUDA 5L8UA 2MJVB 4PCIA 4LZRA 4HXRA 5EPBA 4A9OA 1JSPB 4XUBA 5EWVA 5HELA 4LYWA 4IR5A 3RCWA 1PUOA 4KV4A 3AQAA 5D7XA 2DATA 5DKHA 4YH4A 3LQJA 5FB0A 4O78A 4Z93A 4WHWA 5FH6A 5JI8A 4O7AA 5HQ6A 4UIZA 2LSPB 5HRWA 5EWWA 4N4GA 2OSSA 4HXLA 5A5QA 5BT3A 5HENA 4YBTA 5DLXA 5KO4A 5CRMA 3LQHA 4YYHA 4Q0OA 5I7XA 2D82A 4TQNA 4UYGA 3QZTA 4A9EA 5ENGA 3JVKA 5FE6A 3HMFA 1ZS5A 4UIYA 2EJNA 5EU1A 4QSPA 4HXPA 2F6JA 4LC2A 4QSUA 5CUDA 5E9LA 5CQ7A 5DKDA 5CP5A 5A82A 3UV5A 4UIXA 5DYAA 4HXNA 1X0JA 2F6NA 4Q0NA 4WHUA 4N3WA 5ETDA 5AMFA 4X2IA 4MEOA 2L84A 4NYVA 5F25A 2G4AA 5EISA 4QUUA 5K29A 4UIWA 5HFQA 5DFBA 1EQFA 5F2PA 4A9JA 4MENA 5A5SA 2E3KA 5A81A 4QSRA 2KTBB 2R10A 3U5LA 5FG6A 5KTXA 5LKTA 4ZQLA 4XUAA 5EA1A 4O7CA 5D3NA 4A9IA 4CUPA 5EK9A 2RS9B 4QY4A 5CUBA 3QZVA 3VKGA 2DWWA 5EWDA 5LKXA 4YABA 5JWMA 5CQ4A 1WUGA 4O75A 2WP2A 3D1BA 4MEQA 5CUGA 5KHMA 4CURA 4NYWA 4BJXA 4ZC9A 4QYLA 5D3TA 2GRCA 3ZYUA 4N4HA 4O70A 4IR6A 5EP7A 4QBMA 5HFRA 4YYMA 4MR3A 5E9KA 5FDZA 5HQ5A 4QR5A 4N4FA 5CQ3A 4PCEA 5COIA 5II1A 5E3GA 5E9VA 5FFWA 5D3HA 4AKGA 5FBXA 5ENEA 4FLPA 5F1LA 4IR4A 3S91A 5L99A 4Y03A 5FE1A 4MEPA 4NR9A 5A5NA 3HMEA 4A9FA 5EVAA 2E7NA 4NR4A 5DW1A 4ALHA 3MB4A 5H85A 4O7BA 2YDWA 3SVFA 4LDFA 2L5EA 5CQ6A 5LUUA 4Z1QA 4QC3A 4N4IA 4YYNA 4NR6A 5FH7A 5IG6A 4Z1SA 2H60A 4QZSA 5EI4A 3O33A 5LKUA 5DYXA 4HXOA 2I8NA 5DFCA 5DYUA 2WP1A 3K2JA 5J0DA 3D1DA 4O76A 2DVVA 4J0RA 5A85A 5D24A 5C89A 3HMHA 3UV4A 5FE7A 2R0YA 3P1DA 5EQ1A 4CL9A 4C67A 5TB6A 4DONA 4LYSA 4UYHA 2RFJA 3ERRA 3JVMA 4XY9A 3LQIA 5L98A 5CY9A 5HJCA 4NUCA 5CFWA 3I3JA 5EPRA 5EGUA 4UYFA 4HXSA 4J3IA 2DKWA 4YAXA 5II2A 2YQDA 5LVQA 4YADA 3UV2A 3AADA 3O34A 4HXMA 5KTUA 4YBSA 5CS8A 2R0SA 3S92A 5I86A 5AD2A 5FFYA 5EM3A 4BW1A 2RNXA 5E9IA 4NRBA 2NXBA 3P1FA 5D25A 4O72A 4QR3A 1WUMA 3LJWA 4ALGA 4A9HA 5I83A 3UVYA 2RNYA 4TYLA 4CFLA 5C87A 5FE9A 3MULA 4QNSA 4NQNA 4O7EA 3G0JA 5ENFA 4UYFB 4NR7A 4E96A 5CZGA 2OUOA 4OGIA 1E6IA 3SVHA 4A9NA 4TU4A 4BW2A 5FE5A 5A5RA 2D9EA 4YC9A 5ENJA 4YK0A 5F63A 4O71A 4A9KA 4QC1A 4PKLA 5CU8A 4HBVA 4QYDA 4J0SA 5ENHA 4AKHA 5CUCA 5EWHA 5H1TA 5HRVA 4XY8A 2E7OA 2OO1A 5FE8A 4NRCA 4LZSA 5CQTA 4CUQA 2DVSA 5ACYA 3TLPA 3P5OA 3O35A 4MR6A 3GG3A 5IGMA 5D26A 5HEMA 3G0LA 5A5OA 5IBNA 4YY6A 3IU5A 2YW5A 3NXBA 5L8TA 4O7FA 4A9MA 5C7NA 4NR8A 5TCMA 5DX4A 5EV9A 4F3IA 4KV1A 4AKIA 3D7CA 4CLBA 5E0RA 4YATA 5CUEA 2YEMA 5CPEA 4LYIA 4AI6A 5F36A 4TTEA 5F61A 5E7DA 5F1HA 1JM4B 4QEVA 3U5PA 5CUAA 4Z6HA 4CUTA 4YYDA 4KCXA 3UVXA 4TU6A 4UYDA 5D3PA 3U5JA 4LRGA 4WIVA 5D3JA 3Q2FA 4NQMA 4YBMA 4QSVA 3QZSA 5I29A 4HXKA 2R0VA 4ZW1A 4HBYA 3O36A 5D0CA 5HLSA 5BT5A 5C85A 1N72A 3Q2EA 2DVQA 5D3LA 5DY7A 4HBWA 3MXFA 5ENCA 2DVRA 3IU6A 3ONIA 3P1CA 3U5MA 5C8GA 4UYEA 4IOQA 4NR5A 5G4RA 4QSQA 4QSWA 5HRXA 5H1VA 4QSXA 4NRAA 4LR6A 5F62A 5F60A 4HBXA 3JVLA 5EWCA 2FSAA 4NUEA 5FG4A 5DW2A 4CUSA 5I1QA 2I7KA 5ETBA 5DBMA 4QUTA 5I80A 5E9MA 4YY4A 5FFVA 4QEWA 5A5PA 5AD3A 3FKMX 5EICA 4TT2A 4QSTA 3LXJA 5E9YA 5EPSA 4QR4A 4IOOA 4C66A 5FG5A 4TZ8A 5HCLA 4YYGA 1ZKRA 5FE4A 3O37A 5I7YA 4AKNA 3P1EA 5IIDA 4TT6A 5I40A 5KU3A 4QSSA 3DWYA 2YYNA 5I88A 2L85A 2RO1A 4A9LA 5A83A 5IGNA 5H1UA 5LJ1A 5DYCA 5DKCA 5HM0A 5F5ZA 5DFDA 5CQ8A 4LZ2A 5E73A 3DAIA 5KTWA 2N9GA 5FB1A 4PTBA 4PS5A 3UVDA 4IORA 5FE3A 4MR5A 4TS8A 3SVGA 5CQ5A 4YYKA 3MQMA 4YYJA 4BW4A 4O77A 2RI7A 5E74A 4CUUA 4GPJA 4YYIA 5G4SA 4NS5A 3U5KA 4UIUA 5A7CA 4TZ2A 2RNWA 4UITA 5CQAA 4RVRA 3MUKA 4MR4A 4NYXA 5E3DA 4O74A 4YH3A 4NXJA 4TT4A 4QB3A 3JVJA 4OUFA 5CGPA 5D3RA 4BW3A 4Z6IA 5LJ0A 5HQ7A 4PY6A 4QEUA 5LJ2A 5ENIA 5AMEA 4UIVA 4IR3A 3MB3A 5LVRA 4CFKA 5C4QA 5L97A 4OGJA 5ENBA
chains in the Genus database with same CATH topology
5L96A 5LKZA 5D3SA 5BT4A 4J1PA 4XYAA 2YEKA 3U5OA 5FE2A 3U5NA 4BHWA 2YELA 5FH8A 5IGLA 5CRZA 5CTLA 5F3AA 3UVWA 5FE0A 5DLZA 5I89A 3UW9A 5IGKA 1F68A 4NUDA 5L8UA 2MJVB 4PCIA 4LZRA 4HXRA 5EPBA 4A9OA 1JSPB 4XUBA 5EWVA 5HELA 4LYWA 4IR5A 3RCWA 4KV4A 3AQAA 5D7XA 2DATA 5DKHA 4YH4A 3LQJA 5FB0A 4O78A 4Z93A 4WHWA 5FH6A 5JI8A 4O7AA 5HQ6A 4UIZA 2LSPB 5HRWA 5EWWA 4N4GA 2OSSA 4HXLA 5A5QA 5BT3A 5HENA 4YBTA 5DLXA 5KO4A 5CRMA 3LQHA 4YYHA 4Q0OA 5I7XA 2D82A 4TQNA 4UYGA 3QZTA 4A9EA 5ENGA 3JVKA 5FE6A 3HMFA 1ZS5A 4UIYA 5EU1A 4QSPA 4HXPA 2F6JA 4LC2A 4QSUA 5CUDA 5E9LA 5CQ7A 5DKDA 5CP5A 5A82A 3UV5A 4UIXA 5DYAA 4HXNA 1X0JA 2F6NA 4Q0NA 4WHUA 4N3WA 5ETDA 5AMFA 4X2IA 4MEOA 2L84A 4NYVA 5F25A 2G4AA 5EISA 4QUUA 5K29A 4UIWA 5HFQA 5DFBA 1EQFA 5F2PA 4A9JA 4MENA 5A5SA 2E3KA 5A81A 4QSRA 2KTBB 2R10A 3U5LA 5FG6A 5KTXA 5LKTA 4ZQLA 4XUAA 5EA1A 4O7CA 5D3NA 4A9IA 4CUPA 5EK9A 2RS9B 4QY4A 5CUBA 3QZVA 2DWWA 5EWDA 5LKXA 4YABA 5JWMA 5CQ4A 1WUGA 4O75A 2WP2A 4MEQA 5CUGA 5KHMA 4CURA 4NYWA 4BJXA 4ZC9A 4QYLA 5D3TA 2GRCA 3ZYUA 4N4HA 4O70A 4IR6A 5EP7A 4QBMA 5HFRA 4YYMA 4MR3A 5E9KA 5FDZA 5HQ5A 4QR5A 4N4FA 5CQ3A 4PCEA 5COIA 5II1A 5E3GA 5E9VA 5FFWA 5D3HA 5FBXA 5ENEA 4FLPA 5F1LA 4IR4A 3S91A 5L99A 4Y03A 5FE1A 4MEPA 4NR9A 5A5NA 3HMEA 4A9FA 5EVAA 2E7NA 4NR4A 5DW1A 4ALHA 3MB4A 5H85A 4O7BA 2YDWA 3SVFA 4LDFA 2L5EA 5CQ6A 5LUUA 4Z1QA 4QC3A 4N4IA 4YYNA 4NR6A 5FH7A 5IG6A 4Z1SA 2H60A 4QZSA 5EI4A 3O33A 5LKUA 5DYXA 4HXOA 2I8NA 5DFCA 5DYUA 2WP1A 3K2JA 5J0DA 4O76A 2DVVA 4J0RA 5A85A 5D24A 5C89A 3HMHA 3UV4A 5FE7A 2R0YA 3P1DA 5EQ1A 4CL9A 4C67A 5TB6A 4DONA 4LYSA 4UYHA 2RFJA 3JVMA 4XY9A 3LQIA 5L98A 5CY9A 5HJCA 4NUCA 5CFWA 3I3JA 5EPRA 5EGUA 4UYFA 4HXSA 4J3IA 2DKWA 4YAXA 5II2A 2YQDA 5LVQA 4YADA 3UV2A 3AADA 3O34A 4HXMA 5KTUA 4YBSA 5CS8A 2R0SA 3S92A 5I86A 5AD2A 5FFYA 5EM3A 4BW1A 2RNXA 5E9IA 4NRBA 2NXBA 3P1FA 5D25A 4O72A 4QR3A 1WUMA 3LJWA 4ALGA 4A9HA 5I83A 3UVYA 2RNYA 4TYLA 4CFLA 5C87A 5FE9A 3MULA 4QNSA 4NQNA 4O7EA 3G0JA 5ENFA 4UYFB 4NR7A 4E96A 5CZGA 2OUOA 4OGIA 1E6IA 3SVHA 4A9NA 4TU4A 4BW2A 5FE5A 5A5RA 2D9EA 4YC9A 5ENJA 4YK0A 5F63A 4O71A 4A9KA 4QC1A 4PKLA 5CU8A 4HBVA 4QYDA 4J0SA 5ENHA 5CUCA 5EWHA 5H1TA 5HRVA 4XY8A 2E7OA 2OO1A 5FE8A 4NRCA 4LZSA 5CQTA 4CUQA 2DVSA 5ACYA 3TLPA 3P5OA 3O35A 4MR6A 3GG3A 5IGMA 5D26A 5HEMA 3G0LA 5A5OA 5IBNA 4YY6A 3IU5A 2YW5A 3NXBA 5L8TA 4O7FA 4A9MA 5C7NA 4NR8A 5TCMA 5DX4A 5EV9A 4F3IA 4KV1A 3D7CA 4CLBA 5E0RA 4YATA 5CUEA 2YEMA 5CPEA 4LYIA 5F36A 4TTEA 5F61A 5E7DA 5F1HA 1JM4B 4QEVA 3U5PA 5CUAA 4Z6HA 4CUTA 4YYDA 4KCXA 3UVXA 4TU6A 4UYDA 5D3PA 3U5JA 4LRGA 4WIVA 5D3JA 3Q2FA 4NQMA 4YBMA 4QSVA 3QZSA 5I29A 4HXKA 2R0VA 4ZW1A 4HBYA 3O36A 5D0CA 5HLSA 5BT5A 5C85A 1N72A 3Q2EA 2DVQA 5D3LA 5DY7A 4HBWA 3MXFA 5ENCA 2DVRA 3IU6A 3ONIA 3P1CA 3U5MA 5C8GA 4UYEA 4IOQA 4NR5A 5G4RA 4QSQA 4QSWA 5HRXA 5H1VA 4QSXA 4NRAA 4LR6A 5F62A 5F60A 4HBXA 3JVLA 5EWCA 2FSAA 4NUEA 5FG4A 5DW2A 4CUSA 5I1QA 2I7KA 5ETBA 5DBMA 4QUTA 5I80A 5E9MA 4YY4A 5FFVA 4QEWA 5A5PA 5AD3A 3FKMX 5EICA 4TT2A 4QSTA 3LXJA 5E9YA 5EPSA 4QR4A 4IOOA 4C66A 5FG5A 4TZ8A 5HCLA 4YYGA 5FE4A 3O37A 5I7YA 4AKNA 3P1EA 5IIDA 4TT6A 5I40A 5KU3A 4QSSA 3DWYA 2YYNA 5I88A 2L85A 2RO1A 4A9LA 5A83A 5IGNA 5H1UA 5LJ1A 5DYCA 5DKCA 5HM0A 5F5ZA 5DFDA 5CQ8A 4LZ2A 5E73A 3DAIA 5KTWA 2N9GA 5FB1A 4PTBA 4PS5A 3UVDA 4IORA 5FE3A 4MR5A 4TS8A 3SVGA 5CQ5A 4YYKA 3MQMA 4YYJA 4BW4A 4O77A 2RI7A 5E74A 4CUUA 4GPJA 4YYIA 5G4SA 4NS5A 3U5KA 4UIUA 5A7CA 4TZ2A 2RNWA 4UITA 5CQAA 4RVRA 3MUKA 4MR4A 4NYXA 5E3DA 4O74A 4YH3A 4NXJA 4TT4A 4QB3A 3JVJA 4OUFA 5CGPA 5D3RA 4BW3A 4Z6IA 5LJ0A 5HQ7A 4PY6A 4QEUA 5LJ2A 5ENIA 5AMEA 4UIVA 4IR3A 3MB3A 5LVRA 4CFKA 5C4QA 5L97A 4OGJA 5ENBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L96 A;  5LKZ A;  5D3S A;  5BT4 A;  4J1P A;  4XYA A;  2YEK A;  3U5O A;  5FE2 A;  3U5N A;  4BHW A;  2YEL A;  5FH8 A;  5IGL A;  5CRZ A;  5CTL A;  5F3A A;  3UVW A;  5FE0 A;  5DLZ A;  5I89 A;  3UW9 A;  5IGK A;  1F68 A;  4NUD A;  5L8U A;  2MJV B;  4PCI A;  4LZR A;  4HXR A;  5EPB A;  4A9O A;  1JSP B;  4XUB A;  5EWV A;  5HEL A;  4LYW A;  4IR5 A;  3RCW A;  4KV4 A;  3AQA A;  5D7X A;  2DAT A;  5DKH A;  4YH4 A;  3LQJ A;  5FB0 A;  4O78 A;  4Z93 A;  4WHW A;  5FH6 A;  5JI8 A;  4O7A A;  5HQ6 A;  4UIZ A;  2LSP B;  5HRW A;  5EWW A;  4N4G A;  2OSS A;  4HXL A;  5A5Q A;  5BT3 A;  5HEN A;  4YBT A;  5DLX A;  5KO4 A;  5CRM A;  3LQH A;  4YYH A;  4Q0O A;  5I7X A;  2D82 A;  4TQN A;  4UYG A;  3QZT A;  4A9E A;  5ENG A;  3JVK A;  5FE6 A;  3HMF A;  1ZS5 A;  4UIY A;  5EU1 A;  4QSP A;  4HXP A;  2F6J A;  4LC2 A;  4QSU A;  5CUD A;  5E9L A;  5CQ7 A;  5DKD A;  5CP5 A;  5A82 A;  3UV5 A;  4UIX A;  5DYA A;  4HXN A;  1X0J A;  2F6N A;  4Q0N A;  4WHU A;  4N3W A;  5ETD A;  5AMF A;  4X2I A;  4MEO A;  2L84 A;  4NYV A;  5F25 A;  2G4A A;  5EIS A;  4QUU A;  5K29 A;  4UIW A;  5HFQ A;  5DFB A;  1EQF A;  5F2P A;  4A9J A;  4MEN A;  5A5S A;  2E3K A;  5A81 A;  4QSR A;  2KTB B;  2R10 A;  3U5L A;  5FG6 A;  5KTX A;  5LKT A;  4ZQL A;  4XUA A;  5EA1 A;  4O7C A;  5D3N A;  4A9I A;  4CUP A;  5EK9 A;  2RS9 B;  4QY4 A;  5CUB A;  3QZV A;  2DWW A;  5EWD A;  5LKX A;  4YAB A;  5JWM A;  5CQ4 A;  1WUG A;  4O75 A;  2WP2 A;  4MEQ A;  5CUG A;  5KHM A;  4CUR A;  4NYW A;  4BJX A;  4ZC9 A;  4QYL A;  5D3T A;  2GRC A;  3ZYU A;  4N4H A;  4O70 A;  4IR6 A;  5EP7 A;  4QBM A;  5HFR A;  4YYM A;  4MR3 A;  5E9K A;  5FDZ A;  5HQ5 A;  4QR5 A;  4N4F A;  5CQ3 A;  4PCE A;  5COI A;  5II1 A;  5E3G A;  5E9V A;  5FFW A;  5D3H A;  5FBX A;  5ENE A;  4FLP A;  5F1L A;  4IR4 A;  3S91 A;  5L99 A;  4Y03 A;  5FE1 A;  4MEP A;  4NR9 A;  5A5N A;  3HME A;  4A9F A;  5EVA A;  2E7N A;  4NR4 A;  5DW1 A;  4ALH A;  3MB4 A;  5H85 A;  4O7B A;  2YDW A;  3SVF A;  4LDF A;  2L5E A;  5CQ6 A;  5LUU A;  4Z1Q A;  4QC3 A;  4N4I A;  4YYN A;  4NR6 A;  5FH7 A;  5IG6 A;  4Z1S A;  2H60 A;  4QZS A;  5EI4 A;  3O33 A;  5LKU A;  5DYX A;  4HXO A;  2I8N A;  5DFC A;  5DYU A;  2WP1 A;  3K2J A;  5J0D A;  4O76 A;  2DVV A;  4J0R A;  5A85 A;  5D24 A;  5C89 A;  3HMH A;  3UV4 A;  5FE7 A;  2R0Y A;  3P1D A;  5EQ1 A;  4CL9 A;  4C67 A;  5TB6 A;  4DON A;  4LYS A;  4UYH A;  2RFJ A;  3JVM A;  4XY9 A;  3LQI A;  5L98 A;  5CY9 A;  5HJC A;  4NUC A;  5CFW A;  3I3J A;  5EPR A;  5EGU A;  4UYF A;  4HXS A;  4J3I A;  2DKW A;  4YAX A;  5II2 A;  2YQD A;  5LVQ A;  4YAD A;  3UV2 A;  3AAD A;  3O34 A;  4HXM A;  5KTU A;  4YBS A;  5CS8 A;  2R0S A;  3S92 A;  5I86 A;  5AD2 A;  5FFY A;  5EM3 A;  4BW1 A;  2RNX A;  5E9I A;  4NRB A;  2NXB A;  3P1F A;  5D25 A;  4O72 A;  4QR3 A;  1WUM A;  3LJW A;  4ALG A;  4A9H A;  5I83 A;  3UVY A;  2RNY A;  4TYL A;  4CFL A;  5C87 A;  5FE9 A;  3MUL A;  4QNS A;  4NQN A;  4O7E A;  3G0J A;  5ENF A;  4UYF B;  4NR7 A;  4E96 A;  5CZG A;  2OUO A;  4OGI A;  1E6I A;  3SVH A;  4A9N A;  4TU4 A;  4BW2 A;  5FE5 A;  5A5R A;  2D9E A;  4YC9 A;  5ENJ A;  4YK0 A;  5F63 A;  4O71 A;  4A9K A;  4QC1 A;  4PKL A;  5CU8 A;  4HBV A;  4QYD A;  4J0S A;  5ENH A;  5CUC A;  5EWH A;  5H1T A;  5HRV A;  4XY8 A;  2E7O A;  2OO1 A;  5FE8 A;  4NRC A;  4LZS A;  5CQT A;  4CUQ A;  2DVS A;  5ACY A;  3TLP A;  3P5O A;  3O35 A;  4MR6 A;  3GG3 A;  5IGM A;  5D26 A;  5HEM A;  3G0L A;  5A5O A;  5IBN A;  4YY6 A;  3IU5 A;  2YW5 A;  3NXB A;  5L8T A;  4O7F A;  4A9M A;  5C7N A;  4NR8 A;  5TCM A;  5DX4 A;  5EV9 A;  4F3I A;  4KV1 A;  3D7C A;  4CLB A;  5E0R A;  4YAT A;  5CUE A;  2YEM A;  5CPE A;  4LYI A;  5F36 A;  4TTE A;  5F61 A;  5E7D A;  5F1H A;  1JM4 B;  4QEV A;  3U5P A;  5CUA A;  4Z6H A;  4CUT A;  4YYD A;  4KCX A;  3UVX A;  4TU6 A;  4UYD A;  5D3P A;  3U5J A;  4LRG A;  4WIV A;  5D3J A;  3Q2F A;  4NQM A;  4YBM A;  4QSV A;  3QZS A;  5I29 A;  4HXK A;  2R0V A;  4ZW1 A;  4HBY A;  3O36 A;  5D0C A;  5HLS A;  5BT5 A;  5C85 A;  1N72 A;  3Q2E A;  2DVQ A;  5D3L A;  5DY7 A;  4HBW A;  3MXF A;  5ENC A;  2DVR A;  3IU6 A;  3ONI A;  3P1C A;  3U5M A;  5C8G A;  4UYE A;  4IOQ A;  4NR5 A;  5G4R A;  4QSQ A;  4QSW A;  5HRX A;  5H1V A;  4QSX A;  4NRA A;  4LR6 A;  5F62 A;  5F60 A;  4HBX A;  3JVL A;  5EWC A;  2FSA A;  4NUE A;  5FG4 A;  5DW2 A;  4CUS A;  5I1Q A;  2I7K A;  5ETB A;  5DBM A;  4QUT A;  5I80 A;  5E9M A;  4YY4 A;  5FFV A;  4QEW A;  5A5P A;  5AD3 A;  3FKM X;  5EIC A;  4TT2 A;  4QST A;  3LXJ A;  5E9Y A;  5EPS A;  4QR4 A;  4IOO A;  4C66 A;  5FG5 A;  4TZ8 A;  5HCL A;  4YYG A;  5FE4 A;  3O37 A;  5I7Y A;  4AKN A;  3P1E A;  5IID A;  4TT6 A;  5I40 A;  5KU3 A;  4QSS A;  3DWY A;  2YYN A;  5I88 A;  2L85 A;  2RO1 A;  4A9L A;  5A83 A;  5IGN A;  5H1U A;  5LJ1 A;  5DYC A;  5DKC A;  5HM0 A;  5F5Z A;  5DFD A;  5CQ8 A;  4LZ2 A;  5E73 A;  3DAI A;  5KTW A;  2N9G A;  5FB1 A;  4PTB A;  4PS5 A;  3UVD A;  4IOR A;  5FE3 A;  4MR5 A;  4TS8 A;  3SVG A;  5CQ5 A;  4YYK A;  3MQM A;  4YYJ A;  4BW4 A;  4O77 A;  2RI7 A;  5E74 A;  4CUU A;  4GPJ A;  4YYI A;  5G4S A;  4NS5 A;  3U5K A;  4UIU A;  5A7C A;  4TZ2 A;  2RNW A;  4UIT A;  5CQA A;  4RVR A;  3MUK A;  4MR4 A;  4NYX A;  5E3D A;  4O74 A;  4YH3 A;  4NXJ A;  4TT4 A;  4QB3 A;  3JVJ A;  4OUF A;  5CGP A;  5D3R A;  4BW3 A;  4Z6I A;  5LJ0 A;  5HQ7 A;  4PY6 A;  4QEU A;  5LJ2 A;  5ENI A;  5AME A;  4UIV A;  4IR3 A;  3MB3 A;  5LVR A;  4CFK A;  5C4Q A;  5L97 A;  4OGJ A;  5ENB A; 
#chains in the Genus database with same CATH topology
 5L96 A;  5LKZ A;  5D3S A;  5BT4 A;  4J1P A;  4XYA A;  2YEK A;  3U5O A;  5FE2 A;  3U5N A;  4BHW A;  2YEL A;  5FH8 A;  5IGL A;  5CRZ A;  5CTL A;  5F3A A;  3UVW A;  3VKH A;  5FE0 A;  5DLZ A;  5I89 A;  3UW9 A;  5IGK A;  1F68 A;  4NUD A;  5L8U A;  2MJV B;  4PCI A;  4LZR A;  4HXR A;  5EPB A;  4A9O A;  1JSP B;  4XUB A;  5EWV A;  5HEL A;  4LYW A;  4IR5 A;  3RCW A;  1PUO A;  4KV4 A;  3AQA A;  5D7X A;  2DAT A;  5DKH A;  4YH4 A;  3LQJ A;  5FB0 A;  4O78 A;  4Z93 A;  4WHW A;  5FH6 A;  5JI8 A;  4O7A A;  5HQ6 A;  4UIZ A;  2LSP B;  5HRW A;  5EWW A;  4N4G A;  2OSS A;  4HXL A;  5A5Q A;  5BT3 A;  5HEN A;  4YBT A;  5DLX A;  5KO4 A;  5CRM A;  3LQH A;  4YYH A;  4Q0O A;  5I7X A;  2D82 A;  4TQN A;  4UYG A;  3QZT A;  4A9E A;  5ENG A;  3JVK A;  5FE6 A;  3HMF A;  1ZS5 A;  4UIY A;  2EJN A;  5EU1 A;  4QSP A;  4HXP A;  2F6J A;  4LC2 A;  4QSU A;  5CUD A;  5E9L A;  5CQ7 A;  5DKD A;  5CP5 A;  5A82 A;  3UV5 A;  4UIX A;  5DYA A;  4HXN A;  1X0J A;  2F6N A;  4Q0N A;  4WHU A;  4N3W A;  5ETD A;  5AMF A;  4X2I A;  4MEO A;  2L84 A;  4NYV A;  5F25 A;  2G4A A;  5EIS A;  4QUU A;  5K29 A;  4UIW A;  5HFQ A;  5DFB A;  1EQF A;  5F2P A;  4A9J A;  4MEN A;  5A5S A;  2E3K A;  5A81 A;  4QSR A;  2KTB B;  2R10 A;  3U5L A;  5FG6 A;  5KTX A;  5LKT A;  4ZQL A;  4XUA A;  5EA1 A;  4O7C A;  5D3N A;  4A9I A;  4CUP A;  5EK9 A;  2RS9 B;  4QY4 A;  5CUB A;  3QZV A;  3VKG A;  2DWW A;  5EWD A;  5LKX A;  4YAB A;  5JWM A;  5CQ4 A;  1WUG A;  4O75 A;  2WP2 A;  3D1B A;  4MEQ A;  5CUG A;  5KHM A;  4CUR A;  4NYW A;  4BJX A;  4ZC9 A;  4QYL A;  5D3T A;  2GRC A;  3ZYU A;  4N4H A;  4O70 A;  4IR6 A;  5EP7 A;  4QBM A;  5HFR A;  4YYM A;  4MR3 A;  5E9K A;  5FDZ A;  5HQ5 A;  4QR5 A;  4N4F A;  5CQ3 A;  4PCE A;  5COI A;  5II1 A;  5E3G A;  5E9V A;  5FFW A;  5D3H A;  4AKG A;  5FBX A;  5ENE A;  4FLP A;  5F1L A;  4IR4 A;  3S91 A;  5L99 A;  4Y03 A;  5FE1 A;  4MEP A;  4NR9 A;  5A5N A;  3HME A;  4A9F A;  5EVA A;  2E7N A;  4NR4 A;  5DW1 A;  4ALH A;  3MB4 A;  5H85 A;  4O7B A;  2YDW A;  3SVF A;  4LDF A;  2L5E A;  5CQ6 A;  5LUU A;  4Z1Q A;  4QC3 A;  4N4I A;  4YYN A;  4NR6 A;  5FH7 A;  5IG6 A;  4Z1S A;  2H60 A;  4QZS A;  5EI4 A;  3O33 A;  5LKU A;  5DYX A;  4HXO A;  2I8N A;  5DFC A;  5DYU A;  2WP1 A;  3K2J A;  5J0D A;  3D1D A;  4O76 A;  2DVV A;  4J0R A;  5A85 A;  5D24 A;  5C89 A;  3HMH A;  3UV4 A;  5FE7 A;  2R0Y A;  3P1D A;  5EQ1 A;  4CL9 A;  4C67 A;  5TB6 A;  4DON A;  4LYS A;  4UYH A;  2RFJ A;  3ERR A;  3JVM A;  4XY9 A;  3LQI A;  5L98 A;  5CY9 A;  5HJC A;  4NUC A;  5CFW A;  3I3J A;  5EPR A;  5EGU A;  4UYF A;  4HXS A;  4J3I A;  2DKW A;  4YAX A;  5II2 A;  2YQD A;  5LVQ A;  4YAD A;  3UV2 A;  3AAD A;  3O34 A;  4HXM A;  5KTU A;  4YBS A;  5CS8 A;  2R0S A;  3S92 A;  5I86 A;  5AD2 A;  5FFY A;  5EM3 A;  4BW1 A;  2RNX A;  5E9I A;  4NRB A;  2NXB A;  3P1F A;  5D25 A;  4O72 A;  4QR3 A;  1WUM A;  3LJW A;  4ALG A;  4A9H A;  5I83 A;  3UVY A;  2RNY A;  4TYL A;  4CFL A;  5C87 A;  5FE9 A;  3MUL A;  4QNS A;  4NQN A;  4O7E A;  3G0J A;  5ENF A;  4UYF B;  4NR7 A;  4E96 A;  5CZG A;  2OUO A;  4OGI A;  1E6I A;  3SVH A;  4A9N A;  4TU4 A;  4BW2 A;  5FE5 A;  5A5R A;  2D9E A;  4YC9 A;  5ENJ A;  4YK0 A;  5F63 A;  4O71 A;  4A9K A;  4QC1 A;  4PKL A;  5CU8 A;  4HBV A;  4QYD A;  4J0S A;  5ENH A;  4AKH A;  5CUC A;  5EWH A;  5H1T A;  5HRV A;  4XY8 A;  2E7O A;  2OO1 A;  5FE8 A;  4NRC A;  4LZS A;  5CQT A;  4CUQ A;  2DVS A;  5ACY A;  3TLP A;  3P5O A;  3O35 A;  4MR6 A;  3GG3 A;  5IGM A;  5D26 A;  5HEM A;  3G0L A;  5A5O A;  5IBN A;  4YY6 A;  3IU5 A;  2YW5 A;  3NXB A;  5L8T A;  4O7F A;  4A9M A;  5C7N A;  4NR8 A;  5TCM A;  5DX4 A;  5EV9 A;  4F3I A;  4KV1 A;  4AKI A;  3D7C A;  4CLB A;  5E0R A;  4YAT A;  5CUE A;  2YEM A;  5CPE A;  4LYI A;  4AI6 A;  5F36 A;  4TTE A;  5F61 A;  5E7D A;  5F1H A;  1JM4 B;  4QEV A;  3U5P A;  5CUA A;  4Z6H A;  4CUT A;  4YYD A;  4KCX A;  3UVX A;  4TU6 A;  4UYD A;  5D3P A;  3U5J A;  4LRG A;  4WIV A;  5D3J A;  3Q2F A;  4NQM A;  4YBM A;  4QSV A;  3QZS A;  5I29 A;  4HXK A;  2R0V A;  4ZW1 A;  4HBY A;  3O36 A;  5D0C A;  5HLS A;  5BT5 A;  5C85 A;  1N72 A;  3Q2E A;  2DVQ A;  5D3L A;  5DY7 A;  4HBW A;  3MXF A;  5ENC A;  2DVR A;  3IU6 A;  3ONI A;  3P1C A;  3U5M A;  5C8G A;  4UYE A;  4IOQ A;  4NR5 A;  5G4R A;  4QSQ A;  4QSW A;  5HRX A;  5H1V A;  4QSX A;  4NRA A;  4LR6 A;  5F62 A;  5F60 A;  4HBX A;  3JVL A;  5EWC A;  2FSA A;  4NUE A;  5FG4 A;  5DW2 A;  4CUS A;  5I1Q A;  2I7K A;  5ETB A;  5DBM A;  4QUT A;  5I80 A;  5E9M A;  4YY4 A;  5FFV A;  4QEW A;  5A5P A;  5AD3 A;  3FKM X;  5EIC A;  4TT2 A;  4QST A;  3LXJ A;  5E9Y A;  5EPS A;  4QR4 A;  4IOO A;  4C66 A;  5FG5 A;  4TZ8 A;  5HCL A;  4YYG A;  1ZKR A;  5FE4 A;  3O37 A;  5I7Y A;  4AKN A;  3P1E A;  5IID A;  4TT6 A;  5I40 A;  5KU3 A;  4QSS A;  3DWY A;  2YYN A;  5I88 A;  2L85 A;  2RO1 A;  4A9L A;  5A83 A;  5IGN A;  5H1U A;  5LJ1 A;  5DYC A;  5DKC A;  5HM0 A;  5F5Z A;  5DFD A;  5CQ8 A;  4LZ2 A;  5E73 A;  3DAI A;  5KTW A;  2N9G A;  5FB1 A;  4PTB A;  4PS5 A;  3UVD A;  4IOR A;  5FE3 A;  4MR5 A;  4TS8 A;  3SVG A;  5CQ5 A;  4YYK A;  3MQM A;  4YYJ A;  4BW4 A;  4O77 A;  2RI7 A;  5E74 A;  4CUU A;  4GPJ A;  4YYI A;  5G4S A;  4NS5 A;  3U5K A;  4UIU A;  5A7C A;  4TZ2 A;  2RNW A;  4UIT A;  5CQA A;  4RVR A;  3MUK A;  4MR4 A;  4NYX A;  5E3D A;  4O74 A;  4YH3 A;  4NXJ A;  4TT4 A;  4QB3 A;  3JVJ A;  4OUF A;  5CGP A;  5D3R A;  4BW3 A;  4Z6I A;  5LJ0 A;  5HQ7 A;  4PY6 A;  4QEU A;  5LJ2 A;  5ENI A;  5AME A;  4UIV A;  4IR3 A;  3MB3 A;  5LVR A;  4CFK A;  5C4Q A;  5L97 A;  4OGJ A;  5ENB A; 
#chains in the Genus database with same CATH homology
 5L96 A;  5LKZ A;  5D3S A;  5BT4 A;  4J1P A;  4XYA A;  2YEK A;  3U5O A;  5FE2 A;  3U5N A;  4BHW A;  2YEL A;  5FH8 A;  5IGL A;  5CRZ A;  5CTL A;  5F3A A;  3UVW A;  5FE0 A;  5DLZ A;  5I89 A;  3UW9 A;  5IGK A;  1F68 A;  4NUD A;  5L8U A;  2MJV B;  4PCI A;  4LZR A;  4HXR A;  5EPB A;  4A9O A;  1JSP B;  4XUB A;  5EWV A;  5HEL A;  4LYW A;  4IR5 A;  3RCW A;  4KV4 A;  3AQA A;  5D7X A;  2DAT A;  5DKH A;  4YH4 A;  3LQJ A;  5FB0 A;  4O78 A;  4Z93 A;  4WHW A;  5FH6 A;  5JI8 A;  4O7A A;  5HQ6 A;  4UIZ A;  2LSP B;  5HRW A;  5EWW A;  4N4G A;  2OSS A;  4HXL A;  5A5Q A;  5BT3 A;  5HEN A;  4YBT A;  5DLX A;  5KO4 A;  5CRM A;  3LQH A;  4YYH A;  4Q0O A;  5I7X A;  2D82 A;  4TQN A;  4UYG A;  3QZT A;  4A9E A;  5ENG A;  3JVK A;  5FE6 A;  3HMF A;  1ZS5 A;  4UIY A;  5EU1 A;  4QSP A;  4HXP A;  2F6J A;  4LC2 A;  4QSU A;  5CUD A;  5E9L A;  5CQ7 A;  5DKD A;  5CP5 A;  5A82 A;  3UV5 A;  4UIX A;  5DYA A;  4HXN A;  1X0J A;  2F6N A;  4Q0N A;  4WHU A;  4N3W A;  5ETD A;  5AMF A;  4X2I A;  4MEO A;  2L84 A;  4NYV A;  5F25 A;  2G4A A;  5EIS A;  4QUU A;  5K29 A;  4UIW A;  5HFQ A;  5DFB A;  1EQF A;  5F2P A;  4A9J A;  4MEN A;  5A5S A;  2E3K A;  5A81 A;  4QSR A;  2KTB B;  2R10 A;  3U5L A;  5FG6 A;  5KTX A;  5LKT A;  4ZQL A;  4XUA A;  5EA1 A;  4O7C A;  5D3N A;  4A9I A;  4CUP A;  5EK9 A;  2RS9 B;  4QY4 A;  5CUB A;  3QZV A;  2DWW A;  5EWD A;  5LKX A;  4YAB A;  5JWM A;  5CQ4 A;  1WUG A;  4O75 A;  2WP2 A;  4MEQ A;  5CUG A;  5KHM A;  4CUR A;  4NYW A;  4BJX A;  4ZC9 A;  4QYL A;  5D3T A;  2GRC A;  3ZYU A;  4N4H A;  4O70 A;  4IR6 A;  5EP7 A;  4QBM A;  5HFR A;  4YYM A;  4MR3 A;  5E9K A;  5FDZ A;  5HQ5 A;  4QR5 A;  4N4F A;  5CQ3 A;  4PCE A;  5COI A;  5II1 A;  5E3G A;  5E9V A;  5FFW A;  5D3H A;  5FBX A;  5ENE A;  4FLP A;  5F1L A;  4IR4 A;  3S91 A;  5L99 A;  4Y03 A;  5FE1 A;  4MEP A;  4NR9 A;  5A5N A;  3HME A;  4A9F A;  5EVA A;  2E7N A;  4NR4 A;  5DW1 A;  4ALH A;  3MB4 A;  5H85 A;  4O7B A;  2YDW A;  3SVF A;  4LDF A;  2L5E A;  5CQ6 A;  5LUU A;  4Z1Q A;  4QC3 A;  4N4I A;  4YYN A;  4NR6 A;  5FH7 A;  5IG6 A;  4Z1S A;  2H60 A;  4QZS A;  5EI4 A;  3O33 A;  5LKU A;  5DYX A;  4HXO A;  2I8N A;  5DFC A;  5DYU A;  2WP1 A;  3K2J A;  5J0D A;  4O76 A;  2DVV A;  4J0R A;  5A85 A;  5D24 A;  5C89 A;  3HMH A;  3UV4 A;  5FE7 A;  2R0Y A;  3P1D A;  5EQ1 A;  4CL9 A;  4C67 A;  5TB6 A;  4DON A;  4LYS A;  4UYH A;  2RFJ A;  3JVM A;  4XY9 A;  3LQI A;  5L98 A;  5CY9 A;  5HJC A;  4NUC A;  5CFW A;  3I3J A;  5EPR A;  5EGU A;  4UYF A;  4HXS A;  4J3I A;  2DKW A;  4YAX A;  5II2 A;  2YQD A;  5LVQ A;  4YAD A;  3UV2 A;  3AAD A;  3O34 A;  4HXM A;  5KTU A;  4YBS A;  5CS8 A;  2R0S A;  3S92 A;  5I86 A;  5AD2 A;  5FFY A;  5EM3 A;  4BW1 A;  2RNX A;  5E9I A;  4NRB A;  2NXB A;  3P1F A;  5D25 A;  4O72 A;  4QR3 A;  1WUM A;  3LJW A;  4ALG A;  4A9H A;  5I83 A;  3UVY A;  2RNY A;  4TYL A;  4CFL A;  5C87 A;  5FE9 A;  3MUL A;  4QNS A;  4NQN A;  4O7E A;  3G0J A;  5ENF A;  4UYF B;  4NR7 A;  4E96 A;  5CZG A;  2OUO A;  4OGI A;  1E6I A;  3SVH A;  4A9N A;  4TU4 A;  4BW2 A;  5FE5 A;  5A5R A;  2D9E A;  4YC9 A;  5ENJ A;  4YK0 A;  5F63 A;  4O71 A;  4A9K A;  4QC1 A;  4PKL A;  5CU8 A;  4HBV A;  4QYD A;  4J0S A;  5ENH A;  5CUC A;  5EWH A;  5H1T A;  5HRV A;  4XY8 A;  2E7O A;  2OO1 A;  5FE8 A;  4NRC A;  4LZS A;  5CQT A;  4CUQ A;  2DVS A;  5ACY A;  3TLP A;  3P5O A;  3O35 A;  4MR6 A;  3GG3 A;  5IGM A;  5D26 A;  5HEM A;  3G0L A;  5A5O A;  5IBN A;  4YY6 A;  3IU5 A;  2YW5 A;  3NXB A;  5L8T A;  4O7F A;  4A9M A;  5C7N A;  4NR8 A;  5TCM A;  5DX4 A;  5EV9 A;  4F3I A;  4KV1 A;  3D7C A;  4CLB A;  5E0R A;  4YAT A;  5CUE A;  2YEM A;  5CPE A;  4LYI A;  5F36 A;  4TTE A;  5F61 A;  5E7D A;  5F1H A;  1JM4 B;  4QEV A;  3U5P A;  5CUA A;  4Z6H A;  4CUT A;  4YYD A;  4KCX A;  3UVX A;  4TU6 A;  4UYD A;  5D3P A;  3U5J A;  4LRG A;  4WIV A;  5D3J A;  3Q2F A;  4NQM A;  4YBM A;  4QSV A;  3QZS A;  5I29 A;  4HXK A;  2R0V A;  4ZW1 A;  4HBY A;  3O36 A;  5D0C A;  5HLS A;  5BT5 A;  5C85 A;  1N72 A;  3Q2E A;  2DVQ A;  5D3L A;  5DY7 A;  4HBW A;  3MXF A;  5ENC A;  2DVR A;  3IU6 A;  3ONI A;  3P1C A;  3U5M A;  5C8G A;  4UYE A;  4IOQ A;  4NR5 A;  5G4R A;  4QSQ A;  4QSW A;  5HRX A;  5H1V A;  4QSX A;  4NRA A;  4LR6 A;  5F62 A;  5F60 A;  4HBX A;  3JVL A;  5EWC A;  2FSA A;  4NUE A;  5FG4 A;  5DW2 A;  4CUS A;  5I1Q A;  2I7K A;  5ETB A;  5DBM A;  4QUT A;  5I80 A;  5E9M A;  4YY4 A;  5FFV A;  4QEW A;  5A5P A;  5AD3 A;  3FKM X;  5EIC A;  4TT2 A;  4QST A;  3LXJ A;  5E9Y A;  5EPS A;  4QR4 A;  4IOO A;  4C66 A;  5FG5 A;  4TZ8 A;  5HCL A;  4YYG A;  5FE4 A;  3O37 A;  5I7Y A;  4AKN A;  3P1E A;  5IID A;  4TT6 A;  5I40 A;  5KU3 A;  4QSS A;  3DWY A;  2YYN A;  5I88 A;  2L85 A;  2RO1 A;  4A9L A;  5A83 A;  5IGN A;  5H1U A;  5LJ1 A;  5DYC A;  5DKC A;  5HM0 A;  5F5Z A;  5DFD A;  5CQ8 A;  4LZ2 A;  5E73 A;  3DAI A;  5KTW A;  2N9G A;  5FB1 A;  4PTB A;  4PS5 A;  3UVD A;  4IOR A;  5FE3 A;  4MR5 A;  4TS8 A;  3SVG A;  5CQ5 A;  4YYK A;  3MQM A;  4YYJ A;  4BW4 A;  4O77 A;  2RI7 A;  5E74 A;  4CUU A;  4GPJ A;  4YYI A;  5G4S A;  4NS5 A;  3U5K A;  4UIU A;  5A7C A;  4TZ2 A;  2RNW A;  4UIT A;  5CQA A;  4RVR A;  3MUK A;  4MR4 A;  4NYX A;  5E3D A;  4O74 A;  4YH3 A;  4NXJ A;  4TT4 A;  4QB3 A;  3JVJ A;  4OUF A;  5CGP A;  5D3R A;  4BW3 A;  4Z6I A;  5LJ0 A;  5HQ7 A;  4PY6 A;  4QEU A;  5LJ2 A;  5ENI A;  5AME A;  4UIV A;  4IR3 A;  3MB3 A;  5LVR A;  4CFK A;  5C4Q A;  5L97 A;  4OGJ A;  5ENB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...