4KV4A

Brd4 bromodomain 2 in complex with acetylated rel peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
111
structure length
111
Chain Sequence
AGSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Brd4 maintains constitutively active NF-kappa B in cancer cells by binding to acetylated RelA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4kv4A00
3IU6A 5FE4A 3UV5A 4RVRA 5DKDA 4LDFA 4YADA 2YEKA 4PTBA 2YW5A 5CY9A 4LYIA 4QSQA 4A9HA 4YY4A 3LQHA 4Q0NA 5CFWA 2WP1A 5E9IA 1WUGA 3K2JA 2DATA 4KV4A 5JWMA 4CL9A 4QC1A 5ENCA 3UV2A 4NR4A 4LR6A 3QZVA 5EK9A 5CS8A 3U5MA 4MEPA 5H1UA 5LKUA 5D24A 5I29A 5AD3A 5KTXA 1WUMA 2R0YA 4DONA 5FE0A 3IU5A 5FH7A 4HXNA 2MJVB 4IR4A 3AADA 3DAIA 4BW1A 2KTBB 5EPBA 4HXPA 5FDZA 4A9IA 5LJ0A 3S92A 4YH3A 2G4AA 4J0SA 5CP5A 2I7KA 5DX4A 5FB0A 5C8GA 4NRAA 4BJXA 5DLZA 3MB3A 5LJ2A 4BHWA 2I8NA 5D3TA 2OO1A 4CFLA 5E9KA 4NUDA 5BT3A 5CU8A 4Z93A 5KU3A 4LYWA 3LQJA 4YC9A 5F36A 3MB4A 5EISA 4MENA 5CQ3A 2NXBA 4A9MA 4O76A 4QY4A 5C4QA 4YYGA 5JI8A 4HBYA 5LKZA 5G4RA 5F60A 4QBMA 5D7XA 5EGUA 5HQ7A 5FG6A 4TQNA 5FH6A 2RO1A 5EQ1A 4TYLA 5FE1A 3UV4A 5I7YA 5I83A 4FLPA 4TU4A 3I3JA 3AQAA 4YYIA 3ONIA 5ENHA 5DFCA 4O7CA 2WP2A 4A9LA 5ENIA 1JM4B 5EA1A 3UVDA 4NR5A 4KV1A 4PY6A 5D3LA 4MR4A 2GRCA 4QEWA 4HXRA 4IR5A 3LJWA 4MEQA 5EWHA 4QYLA 5DYXA 4TT2A 4O7FA 3DWYA 5ENBA 3MULA 3SVHA 3UVXA 3U5PA 5F1HA 5II1A 5L98A 5CRMA 5E3DA 4TZ8A 5FFVA 4QEUA 2DVVA 4QEVA 4HXSA 5E3GA 5COIA 3SVGA 4UYGA 4YATA 4O77A 5F5ZA 5FH8A 3O34A 5H85A 4Z6IA 4C66A 3UVWA 4HBVA 5A5QA 5E0RA 5EM3A 2DVRA 3G0JA 4HXOA 4PCIA 4PCEA 4XY8A 4UYFB 4J3IA 3MXFA 3O35A 5TB6A 4QUUA 4BW4A 2R0SA 5IIDA 3P1CA 5E73A 4QZSA 5CQTA 4TU6A 3HMFA 5E9YA 5HRWA 4YK0A 5L8UA 4ZW1A 3Q2EA 4YYNA 4HXMA 4NRBA 5I86A 4HXLA 2YYNA 4QSTA 4CUSA 4ALHA 5DBMA 3G0LA 2RI7A 5ENJA 5DW1A 2N9GA 5FE3A 4NXJA 5TCMA 4ALGA 4A9FA 4WIVA 4UYHA 4YYJA 4WHWA 4YYHA 5HFQA 2DKWA 5FE7A 4UYEA 4IOOA 4QYDA 4QSRA 5IGMA 4O7BA 4QR5A 5A81A 4O71A 4LC2A 2YQDA 4HBXA 5EVAA 4QSVA 4QB3A 5F1LA 3D7CA 4BW3A 4LZRA 4O78A 5IGNA 5CUDA 4A9NA 5EWDA 3U5NA 4PKLA 4CUQA 5D0CA 4Q0OA 3QZTA 4O74A 5H1VA 4C67A 4QR4A 2DVSA 5HFRA 5LVRA 4AKNA 4CUUA 3JVKA 4IR6A 5EWCA 4CUTA 4CURA 4TTEA 2FSAA 4QSPA 5LUUA 4UITA 5HRXA 3SVFA 4N4GA 5L99A 2DVQA 4OGJA 2RFJA 5I89A 5FE6A 1JSPB 4YH4A 5CQ4A 5D3JA 4Z6HA 4UIUA 4NRCA 4ZQLA 3MQMA 5CGPA 3MUKA 2E3KA 4MR6A 4A9EA 5FE2A 4QC3A 3JVLA 4UIVA 4NS5A 3U5KA 3S91A 4LZSA 5HCLA 5C85A 5EPSA 5LKTA 5F62A 5FG5A 5KTWA 5EI4A 4CLBA 4XY9A 4OGIA 5LVQA 4IORA 5EWWA 3P1DA 1EQFA 4J0RA 5F25A 5FFYA 2R0VA 3ZYUA 5E9VA 5KO4A 4O7EA 5I1QA 4Z1QA 4IR3A 4NUEA 4UYFA 4X2IA 5E74A 3NXBA 2YELA 5E9LA 2L85A 2E7OA 4YYKA 2L84A 2YEMA 5D25A 5CQ8A 5A5RA 5CUBA 5CUGA 5CTLA 4BW2A 2D9EA 5CUCA 5ETDA 4YBMA 4YAXA 1X0JA 4NR8A 2E7NA 5DYUA 4YBTA 3P1FA 4CFKA 5I40A 5EWVA 5D26A 4MR5A 5DY7A 4NYWA 4LYSA 5D3PA 5ENGA 4Z1SA 2RNXA 2L5EA 5F63A 5CUAA 5D3HA 2H60A 2RNYA 5I80A 4O75A 5L8TA 4O72A 4GPJA 5HRVA 5CQ6A 4NQNA 5LJ1A 4IOQA 5AMEA 5IBNA 4UIWA 5DFBA 5HM0A 1N72A 4NR7A 2F6NA 5IG6A 5ENFA 4QSWA 5FBXA 5ETBA 5KTUA 4YY6A 4HBWA 4Y03A 5C87A 2R10A 2RS9B 2F6JA 5ENEA 5D3RA 4XUBA 4OUFA 5CQ5A 4O70A 5A85A 2OUOA 4LZ2A 5CPEA 4YYDA 4QSUA 4HXKA 5HENA 3GG3A 5HQ6A 4N4FA 5F3AA 5KHMA 5DKHA 5II2A 5A7CA 5CQAA 2OSSA 5I7XA 5EPRA 4PS5A 5IGKA 3LXJA 4NUCA 5EICA 5DYCA 3U5OA 4QSXA 3O36A 1ZS5A 2LSPB 4MR3A 5CRZA 5L97A 4CUPA 5FE9A 5HELA 5F2PA 4MEOA 4N3WA 4NYVA 5FB1A 5HJCA 4E96A 4WHUA 5K29A 5EV9A 3O37A 5AD2A 5CZGA 5E7DA 3U5JA 3RCWA 5A5PA 1F68A 5EU1A 4YYMA 4XUAA 3JVJA 3HMEA 5BT4A 5E9MA 5HLSA 5HEMA 5H1TA 5L96A 4O7AA 4NYXA 4NR9A 3HMHA 5HQ5A 5D3NA 5BT5A 5A5NA 4TZ2A 5A5OA 4NR6A 4QR3A 5D3SA 5C89A 5F61A 4A9JA 5FE5A 4UIZA 5LKXA 4A9OA 5DYAA 3U5LA 3TLPA 4J1PA 4QUTA 2RNWA 3O33A 5AMFA 5J0DA 5EP7A 4NQMA 3LQIA 4UYDA 5FG4A 5DFDA 5IGLA 3UW9A 4A9KA 5CUEA 4N4HA 4F3IA 5DKCA 2DWWA 4N4IA 1E6IA 5C7NA 5DW2A 4TS8A 4YBSA 5DLXA 4ZC9A 5ACYA 4YABA 4LRGA 4KCXA 4TT6A 5FE8A 3P1EA 5G4SA 5A5SA 4UIXA 4TT4A 4UIYA 3JVMA 5I88A 4QSSA 5A82A 4QNSA 4XYAA 2D82A 3UVYA 2YDWA 5FFWA 5A83A 3QZSA 3Q2FA 3P5OA 5CQ7A 3FKMX
chains in the Genus database with same CATH superfamily
3IU6A 5FE4A 3UV5A 4RVRA 5DKDA 4LDFA 4YADA 2YEKA 4PTBA 2YW5A 5CY9A 4LYIA 4QSQA 4A9HA 4YY4A 3LQHA 4Q0NA 5CFWA 2WP1A 5E9IA 1WUGA 3K2JA 2DATA 4KV4A 5JWMA 4CL9A 4QC1A 5ENCA 3UV2A 4NR4A 4LR6A 3QZVA 5EK9A 5CS8A 3U5MA 4MEPA 5H1UA 5LKUA 5D24A 5I29A 5AD3A 5KTXA 1WUMA 2R0YA 4DONA 5FE0A 3IU5A 5FH7A 4HXNA 2MJVB 4IR4A 3AADA 3DAIA 4BW1A 2KTBB 5EPBA 4HXPA 5FDZA 4A9IA 5LJ0A 3S92A 4YH3A 2G4AA 4J0SA 5CP5A 2I7KA 5DX4A 5FB0A 5C8GA 4NRAA 4BJXA 5DLZA 3MB3A 5LJ2A 4BHWA 2I8NA 5D3TA 2OO1A 4CFLA 5E9KA 4NUDA 5BT3A 5CU8A 4Z93A 5KU3A 4LYWA 3LQJA 4YC9A 5F36A 3MB4A 5EISA 4MENA 5CQ3A 2NXBA 4A9MA 4O76A 4QY4A 5C4QA 4YYGA 5JI8A 4HBYA 5LKZA 5G4RA 5F60A 4QBMA 5D7XA 5EGUA 5HQ7A 5FG6A 4TQNA 5FH6A 2RO1A 5EQ1A 4TYLA 5FE1A 3UV4A 5I7YA 5I83A 4FLPA 4TU4A 3I3JA 3AQAA 4YYIA 3ONIA 5ENHA 5DFCA 4O7CA 2WP2A 4A9LA 5ENIA 1JM4B 5EA1A 3UVDA 4NR5A 4KV1A 4PY6A 5D3LA 4MR4A 2GRCA 4QEWA 4HXRA 4IR5A 3LJWA 4MEQA 5EWHA 4QYLA 5DYXA 4TT2A 4O7FA 3DWYA 5ENBA 3MULA 3SVHA 3UVXA 3U5PA 5F1HA 5II1A 5L98A 5CRMA 5E3DA 4TZ8A 5FFVA 4QEUA 3D1DA 2DVVA 4QEVA 4HXSA 5E3GA 5COIA 3SVGA 4UYGA 4YATA 4O77A 5F5ZA 5FH8A 3O34A 5H85A 4Z6IA 4C66A 3UVWA 4HBVA 5A5QA 5E0RA 5EM3A 2DVRA 3G0JA 4HXOA 4PCIA 4PCEA 4XY8A 4UYFB 4J3IA 3MXFA 3O35A 5TB6A 4QUUA 4BW4A 2R0SA 5IIDA 3P1CA 5E73A 4QZSA 5CQTA 1PUOA 4TU6A 3HMFA 5E9YA 5HRWA 4YK0A 5L8UA 4ZW1A 3Q2EA 4YYNA 4HXMA 4NRBA 5I86A 4HXLA 2YYNA 4QSTA 4CUSA 4ALHA 5DBMA 3G0LA 2RI7A 5ENJA 5DW1A 2N9GA 5FE3A 4AKHA 4NXJA 5TCMA 4ALGA 4A9FA 4WIVA 4UYHA 4YYJA 4WHWA 4YYHA 5HFQA 2DKWA 5FE7A 4UYEA 4IOOA 4QYDA 4QSRA 5IGMA 4O7BA 4QR5A 5A81A 4O71A 4LC2A 2YQDA 4HBXA 5EVAA 4QSVA 4QB3A 4AKGA 5F1LA 3D7CA 4BW3A 4LZRA 4O78A 5IGNA 5CUDA 4A9NA 5EWDA 3U5NA 4PKLA 4CUQA 5D0CA 4Q0OA 3QZTA 4O74A 5H1VA 4C67A 4QR4A 2DVSA 5HFRA 5LVRA 4AKNA 4CUUA 3JVKA 4IR6A 5EWCA 4CUTA 4CURA 4TTEA 2FSAA 4QSPA 5LUUA 4UITA 5HRXA 3SVFA 4N4GA 5L99A 3VKGA 2DVQA 4OGJA 2RFJA 5I89A 5FE6A 1JSPB 4YH4A 5CQ4A 5D3JA 4Z6HA 4UIUA 4NRCA 4ZQLA 3MQMA 5CGPA 3MUKA 2E3KA 4MR6A 4A9EA 5FE2A 4QC3A 3JVLA 4UIVA 4NS5A 3U5KA 3S91A 4LZSA 5HCLA 5C85A 5EPSA 5LKTA 5F62A 5FG5A 5KTWA 5EI4A 4CLBA 4XY9A 4OGIA 5LVQA 4IORA 5EWWA 3P1DA 1EQFA 4J0RA 5F25A 5FFYA 2R0VA 3ZYUA 5E9VA 5KO4A 3ERRA 4O7EA 5I1QA 4Z1QA 4IR3A 4NUEA 4UYFA 4X2IA 5E74A 4AI6A 3NXBA 2YELA 5E9LA 2L85A 2E7OA 4YYKA 2L84A 2YEMA 5D25A 5CQ8A 5A5RA 5CUBA 5CUGA 5CTLA 4BW2A 2D9EA 5CUCA 5ETDA 4YBMA 4YAXA 1X0JA 4NR8A 2E7NA 5DYUA 4YBTA 3P1FA 4CFKA 5I40A 5EWVA 5D26A 4MR5A 5DY7A 4NYWA 4LYSA 5D3PA 5ENGA 3D1BA 4Z1SA 2RNXA 2L5EA 5F63A 5CUAA 5D3HA 2H60A 2RNYA 5I80A 4O75A 5L8TA 4O72A 4GPJA 5HRVA 5CQ6A 4NQNA 5LJ1A 4IOQA 5AMEA 5IBNA 4UIWA 5DFBA 5HM0A 1N72A 4NR7A 2F6NA 5IG6A 5ENFA 4QSWA 5FBXA 5ETBA 5KTUA 4YY6A 4AKIA 4HBWA 4Y03A 5C87A 2R10A 2RS9B 2F6JA 5ENEA 5D3RA 4XUBA 4OUFA 5CQ5A 4O70A 5A85A 2OUOA 4LZ2A 5CPEA 4YYDA 4QSUA 4HXKA 5HENA 3GG3A 5HQ6A 4N4FA 5F3AA 5KHMA 5DKHA 5II2A 5A7CA 5CQAA 2OSSA 5I7XA 5EPRA 4PS5A 5IGKA 3LXJA 4NUCA 5EICA 5DYCA 3U5OA 4QSXA 2EJNA 3O36A 1ZS5A 2LSPB 4MR3A 5CRZA 5L97A 4CUPA 5FE9A 5HELA 5F2PA 4MEOA 4N3WA 4NYVA 5FB1A 5HJCA 4E96A 4WHUA 5K29A 5EV9A 3O37A 5AD2A 5CZGA 5E7DA 3U5JA 3RCWA 5A5PA 1F68A 5EU1A 4YYMA 4XUAA 3JVJA 3HMEA 5BT4A 5E9MA 5HLSA 5HEMA 5H1TA 5L96A 4O7AA 4NYXA 4NR9A 3HMHA 5HQ5A 5D3NA 5BT5A 5A5NA 4TZ2A 5A5OA 4NR6A 4QR3A 5D3SA 5C89A 5F61A 4A9JA 5FE5A 4UIZA 5LKXA 4A9OA 5DYAA 3U5LA 3TLPA 4J1PA 4QUTA 2RNWA 3O33A 5AMFA 5J0DA 5EP7A 4NQMA 3LQIA 4UYDA 5FG4A 5DFDA 5IGLA 3UW9A 4A9KA 5CUEA 4N4HA 4F3IA 5DKCA 2DWWA 4N4IA 1E6IA 5C7NA 5DW2A 4TS8A 4YBSA 5DLXA 4ZC9A 5ACYA 1ZKRA 4YABA 4LRGA 4KCXA 4TT6A 5FE8A 3P1EA 5G4SA 5A5SA 4UIXA 4TT4A 4UIYA 3JVMA 3VKHA 5I88A 4QSSA 5A82A 4QNSA 4XYAA 2D82A 3UVYA 2YDWA 5FFWA 5A83A 3QZSA 3Q2FA 3P5OA 5CQ7A 3FKMX
chains in the Genus database with same CATH topology
3IU6A 5FE4A 3UV5A 4RVRA 5DKDA 4LDFA 4YADA 2YEKA 4PTBA 2YW5A 5CY9A 4LYIA 4QSQA 4A9HA 4YY4A 3LQHA 4Q0NA 5CFWA 2WP1A 5E9IA 1WUGA 3K2JA 2DATA 4KV4A 5JWMA 4CL9A 4QC1A 5ENCA 3UV2A 4NR4A 4LR6A 3QZVA 5EK9A 5CS8A 3U5MA 4MEPA 5H1UA 5LKUA 5D24A 5I29A 5AD3A 5KTXA 1WUMA 2R0YA 4DONA 5FE0A 3IU5A 5FH7A 4HXNA 2MJVB 4IR4A 3AADA 3DAIA 4BW1A 2KTBB 5EPBA 4HXPA 5FDZA 4A9IA 5LJ0A 3S92A 4YH3A 2G4AA 4J0SA 5CP5A 2I7KA 5DX4A 5FB0A 5C8GA 4NRAA 4BJXA 5DLZA 3MB3A 5LJ2A 4BHWA 2I8NA 5D3TA 2OO1A 4CFLA 5E9KA 4NUDA 5BT3A 5CU8A 4Z93A 5KU3A 4LYWA 3LQJA 4YC9A 5F36A 3MB4A 5EISA 4MENA 5CQ3A 2NXBA 4A9MA 4O76A 4QY4A 5C4QA 4YYGA 5JI8A 4HBYA 5LKZA 5G4RA 5F60A 4QBMA 5D7XA 5EGUA 5HQ7A 5FG6A 4TQNA 5FH6A 2RO1A 5EQ1A 4TYLA 5FE1A 3UV4A 5I7YA 5I83A 4FLPA 4TU4A 3I3JA 3AQAA 4YYIA 3ONIA 5ENHA 5DFCA 4O7CA 2WP2A 4A9LA 5ENIA 1JM4B 5EA1A 3UVDA 4NR5A 4KV1A 4PY6A 5D3LA 4MR4A 2GRCA 4QEWA 4HXRA 4IR5A 3LJWA 4MEQA 5EWHA 4QYLA 5DYXA 4TT2A 4O7FA 3DWYA 5ENBA 3MULA 3SVHA 3UVXA 3U5PA 5F1HA 5II1A 5L98A 5CRMA 5E3DA 4TZ8A 5FFVA 4QEUA 2DVVA 4QEVA 4HXSA 5E3GA 5COIA 3SVGA 4UYGA 4YATA 4O77A 5F5ZA 5FH8A 3O34A 5H85A 4Z6IA 4C66A 3UVWA 4HBVA 5A5QA 5E0RA 5EM3A 2DVRA 3G0JA 4HXOA 4PCIA 4PCEA 4XY8A 4UYFB 4J3IA 3MXFA 3O35A 5TB6A 4QUUA 4BW4A 2R0SA 5IIDA 3P1CA 5E73A 4QZSA 5CQTA 4TU6A 3HMFA 5E9YA 5HRWA 4YK0A 5L8UA 4ZW1A 3Q2EA 4YYNA 4HXMA 4NRBA 5I86A 4HXLA 2YYNA 4QSTA 4CUSA 4ALHA 5DBMA 3G0LA 2RI7A 5ENJA 5DW1A 2N9GA 5FE3A 4NXJA 5TCMA 4ALGA 4A9FA 4WIVA 4UYHA 4YYJA 4WHWA 4YYHA 5HFQA 2DKWA 5FE7A 4UYEA 4IOOA 4QYDA 4QSRA 5IGMA 4O7BA 4QR5A 5A81A 4O71A 4LC2A 2YQDA 4HBXA 5EVAA 4QSVA 4QB3A 5F1LA 3D7CA 4BW3A 4LZRA 4O78A 5IGNA 5CUDA 4A9NA 5EWDA 3U5NA 4PKLA 4CUQA 5D0CA 4Q0OA 3QZTA 4O74A 5H1VA 4C67A 4QR4A 2DVSA 5HFRA 5LVRA 4AKNA 4CUUA 3JVKA 4IR6A 5EWCA 4CUTA 4CURA 4TTEA 2FSAA 4QSPA 5LUUA 4UITA 5HRXA 3SVFA 4N4GA 5L99A 2DVQA 4OGJA 2RFJA 5I89A 5FE6A 1JSPB 4YH4A 5CQ4A 5D3JA 4Z6HA 4UIUA 4NRCA 4ZQLA 3MQMA 5CGPA 3MUKA 2E3KA 4MR6A 4A9EA 5FE2A 4QC3A 3JVLA 4UIVA 4NS5A 3U5KA 3S91A 4LZSA 5HCLA 5C85A 5EPSA 5LKTA 5F62A 5FG5A 5KTWA 5EI4A 4CLBA 4XY9A 4OGIA 5LVQA 4IORA 5EWWA 3P1DA 1EQFA 4J0RA 5F25A 5FFYA 2R0VA 3ZYUA 5E9VA 5KO4A 4O7EA 5I1QA 4Z1QA 4IR3A 4NUEA 4UYFA 4X2IA 5E74A 3NXBA 2YELA 5E9LA 2L85A 2E7OA 4YYKA 2L84A 2YEMA 5D25A 5CQ8A 5A5RA 5CUBA 5CUGA 5CTLA 4BW2A 2D9EA 5CUCA 5ETDA 4YBMA 4YAXA 1X0JA 4NR8A 2E7NA 5DYUA 4YBTA 3P1FA 4CFKA 5I40A 5EWVA 5D26A 4MR5A 5DY7A 4NYWA 4LYSA 5D3PA 5ENGA 4Z1SA 2RNXA 2L5EA 5F63A 5CUAA 5D3HA 2H60A 2RNYA 5I80A 4O75A 5L8TA 4O72A 4GPJA 5HRVA 5CQ6A 4NQNA 5LJ1A 4IOQA 5AMEA 5IBNA 4UIWA 5DFBA 5HM0A 1N72A 4NR7A 2F6NA 5IG6A 5ENFA 4QSWA 5FBXA 5ETBA 5KTUA 4YY6A 4HBWA 4Y03A 5C87A 2R10A 2RS9B 2F6JA 5ENEA 5D3RA 4XUBA 4OUFA 5CQ5A 4O70A 5A85A 2OUOA 4LZ2A 5CPEA 4YYDA 4QSUA 4HXKA 5HENA 3GG3A 5HQ6A 4N4FA 5F3AA 5KHMA 5DKHA 5II2A 5A7CA 5CQAA 2OSSA 5I7XA 5EPRA 4PS5A 5IGKA 3LXJA 4NUCA 5EICA 5DYCA 3U5OA 4QSXA 3O36A 1ZS5A 2LSPB 4MR3A 5CRZA 5L97A 4CUPA 5FE9A 5HELA 5F2PA 4MEOA 4N3WA 4NYVA 5FB1A 5HJCA 4E96A 4WHUA 5K29A 5EV9A 3O37A 5AD2A 5CZGA 5E7DA 3U5JA 3RCWA 5A5PA 1F68A 5EU1A 4YYMA 4XUAA 3JVJA 3HMEA 5BT4A 5E9MA 5HLSA 5HEMA 5H1TA 5L96A 4O7AA 4NYXA 4NR9A 3HMHA 5HQ5A 5D3NA 5BT5A 5A5NA 4TZ2A 5A5OA 4NR6A 4QR3A 5D3SA 5C89A 5F61A 4A9JA 5FE5A 4UIZA 5LKXA 4A9OA 5DYAA 3U5LA 3TLPA 4J1PA 4QUTA 2RNWA 3O33A 5AMFA 5J0DA 5EP7A 4NQMA 3LQIA 4UYDA 5FG4A 5DFDA 5IGLA 3UW9A 4A9KA 5CUEA 4N4HA 4F3IA 5DKCA 2DWWA 4N4IA 1E6IA 5C7NA 5DW2A 4TS8A 4YBSA 5DLXA 4ZC9A 5ACYA 4YABA 4LRGA 4KCXA 4TT6A 5FE8A 3P1EA 5G4SA 5A5SA 4UIXA 4TT4A 4UIYA 3JVMA 5I88A 4QSSA 5A82A 4QNSA 4XYAA 2D82A 3UVYA 2YDWA 5FFWA 5A83A 3QZSA 3Q2FA 3P5OA 5CQ7A 3FKMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU6 A;  5FE4 A;  3UV5 A;  4RVR A;  5DKD A;  4LDF A;  4YAD A;  2YEK A;  4PTB A;  2YW5 A;  5CY9 A;  4LYI A;  4QSQ A;  4A9H A;  4YY4 A;  3LQH A;  4Q0N A;  5CFW A;  2WP1 A;  5E9I A;  1WUG A;  3K2J A;  2DAT A;  4KV4 A;  5JWM A;  4CL9 A;  4QC1 A;  5ENC A;  3UV2 A;  4NR4 A;  4LR6 A;  3QZV A;  5EK9 A;  5CS8 A;  3U5M A;  4MEP A;  5H1U A;  5LKU A;  5D24 A;  5I29 A;  5AD3 A;  5KTX A;  1WUM A;  2R0Y A;  4DON A;  5FE0 A;  3IU5 A;  5FH7 A;  4HXN A;  2MJV B;  4IR4 A;  3AAD A;  3DAI A;  4BW1 A;  2KTB B;  5EPB A;  4HXP A;  5FDZ A;  4A9I A;  5LJ0 A;  3S92 A;  4YH3 A;  2G4A A;  4J0S A;  5CP5 A;  2I7K A;  5DX4 A;  5FB0 A;  5C8G A;  4NRA A;  4BJX A;  5DLZ A;  3MB3 A;  5LJ2 A;  4BHW A;  2I8N A;  5D3T A;  2OO1 A;  4CFL A;  5E9K A;  4NUD A;  5BT3 A;  5CU8 A;  4Z93 A;  5KU3 A;  4LYW A;  3LQJ A;  4YC9 A;  5F36 A;  3MB4 A;  5EIS A;  4MEN A;  5CQ3 A;  2NXB A;  4A9M A;  4O76 A;  4QY4 A;  5C4Q A;  4YYG A;  5JI8 A;  4HBY A;  5LKZ A;  5G4R A;  5F60 A;  4QBM A;  5D7X A;  5EGU A;  5HQ7 A;  5FG6 A;  4TQN A;  5FH6 A;  2RO1 A;  5EQ1 A;  4TYL A;  5FE1 A;  3UV4 A;  5I7Y A;  5I83 A;  4FLP A;  4TU4 A;  3I3J A;  3AQA A;  4YYI A;  3ONI A;  5ENH A;  5DFC A;  4O7C A;  2WP2 A;  4A9L A;  5ENI A;  1JM4 B;  5EA1 A;  3UVD A;  4NR5 A;  4KV1 A;  4PY6 A;  5D3L A;  4MR4 A;  2GRC A;  4QEW A;  4HXR A;  4IR5 A;  3LJW A;  4MEQ A;  5EWH A;  4QYL A;  5DYX A;  4TT2 A;  4O7F A;  3DWY A;  5ENB A;  3MUL A;  3SVH A;  3UVX A;  3U5P A;  5F1H A;  5II1 A;  5L98 A;  5CRM A;  5E3D A;  4TZ8 A;  5FFV A;  4QEU A;  2DVV A;  4QEV A;  4HXS A;  5E3G A;  5COI A;  3SVG A;  4UYG A;  4YAT A;  4O77 A;  5F5Z A;  5FH8 A;  3O34 A;  5H85 A;  4Z6I A;  4C66 A;  3UVW A;  4HBV A;  5A5Q A;  5E0R A;  5EM3 A;  2DVR A;  3G0J A;  4HXO A;  4PCI A;  4PCE A;  4XY8 A;  4UYF B;  4J3I A;  3MXF A;  3O35 A;  5TB6 A;  4QUU A;  4BW4 A;  2R0S A;  5IID A;  3P1C A;  5E73 A;  4QZS A;  5CQT A;  4TU6 A;  3HMF A;  5E9Y A;  5HRW A;  4YK0 A;  5L8U A;  4ZW1 A;  3Q2E A;  4YYN A;  4HXM A;  4NRB A;  5I86 A;  4HXL A;  2YYN A;  4QST A;  4CUS A;  4ALH A;  5DBM A;  3G0L A;  2RI7 A;  5ENJ A;  5DW1 A;  2N9G A;  5FE3 A;  4NXJ A;  5TCM A;  4ALG A;  4A9F A;  4WIV A;  4UYH A;  4YYJ A;  4WHW A;  4YYH A;  5HFQ A;  2DKW A;  5FE7 A;  4UYE A;  4IOO A;  4QYD A;  4QSR A;  5IGM A;  4O7B A;  4QR5 A;  5A81 A;  4O71 A;  4LC2 A;  2YQD A;  4HBX A;  5EVA A;  4QSV A;  4QB3 A;  5F1L A;  3D7C A;  4BW3 A;  4LZR A;  4O78 A;  5IGN A;  5CUD A;  4A9N A;  5EWD A;  3U5N A;  4PKL A;  4CUQ A;  5D0C A;  4Q0O A;  3QZT A;  4O74 A;  5H1V A;  4C67 A;  4QR4 A;  2DVS A;  5HFR A;  5LVR A;  4AKN A;  4CUU A;  3JVK A;  4IR6 A;  5EWC A;  4CUT A;  4CUR A;  4TTE A;  2FSA A;  4QSP A;  5LUU A;  4UIT A;  5HRX A;  3SVF A;  4N4G A;  5L99 A;  2DVQ A;  4OGJ A;  2RFJ A;  5I89 A;  5FE6 A;  1JSP B;  4YH4 A;  5CQ4 A;  5D3J A;  4Z6H A;  4UIU A;  4NRC A;  4ZQL A;  3MQM A;  5CGP A;  3MUK A;  2E3K A;  4MR6 A;  4A9E A;  5FE2 A;  4QC3 A;  3JVL A;  4UIV A;  4NS5 A;  3U5K A;  3S91 A;  4LZS A;  5HCL A;  5C85 A;  5EPS A;  5LKT A;  5F62 A;  5FG5 A;  5KTW A;  5EI4 A;  4CLB A;  4XY9 A;  4OGI A;  5LVQ A;  4IOR A;  5EWW A;  3P1D A;  1EQF A;  4J0R A;  5F25 A;  5FFY A;  2R0V A;  3ZYU A;  5E9V A;  5KO4 A;  4O7E A;  5I1Q A;  4Z1Q A;  4IR3 A;  4NUE A;  4UYF A;  4X2I A;  5E74 A;  3NXB A;  2YEL A;  5E9L A;  2L85 A;  2E7O A;  4YYK A;  2L84 A;  2YEM A;  5D25 A;  5CQ8 A;  5A5R A;  5CUB A;  5CUG A;  5CTL A;  4BW2 A;  2D9E A;  5CUC A;  5ETD A;  4YBM A;  4YAX A;  1X0J A;  4NR8 A;  2E7N A;  5DYU A;  4YBT A;  3P1F A;  4CFK A;  5I40 A;  5EWV A;  5D26 A;  4MR5 A;  5DY7 A;  4NYW A;  4LYS A;  5D3P A;  5ENG A;  4Z1S A;  2RNX A;  2L5E A;  5F63 A;  5CUA A;  5D3H A;  2H60 A;  2RNY A;  5I80 A;  4O75 A;  5L8T A;  4O72 A;  4GPJ A;  5HRV A;  5CQ6 A;  4NQN A;  5LJ1 A;  4IOQ A;  5AME A;  5IBN A;  4UIW A;  5DFB A;  5HM0 A;  1N72 A;  4NR7 A;  2F6N A;  5IG6 A;  5ENF A;  4QSW A;  5FBX A;  5ETB A;  5KTU A;  4YY6 A;  4HBW A;  4Y03 A;  5C87 A;  2R10 A;  2RS9 B;  2F6J A;  5ENE A;  5D3R A;  4XUB A;  4OUF A;  5CQ5 A;  4O70 A;  5A85 A;  2OUO A;  4LZ2 A;  5CPE A;  4YYD A;  4QSU A;  4HXK A;  5HEN A;  3GG3 A;  5HQ6 A;  4N4F A;  5F3A A;  5KHM A;  5DKH A;  5II2 A;  5A7C A;  5CQA A;  2OSS A;  5I7X A;  5EPR A;  4PS5 A;  5IGK A;  3LXJ A;  4NUC A;  5EIC A;  5DYC A;  3U5O A;  4QSX A;  3O36 A;  1ZS5 A;  2LSP B;  4MR3 A;  5CRZ A;  5L97 A;  4CUP A;  5FE9 A;  5HEL A;  5F2P A;  4MEO A;  4N3W A;  4NYV A;  5FB1 A;  5HJC A;  4E96 A;  4WHU A;  5K29 A;  5EV9 A;  3O37 A;  5AD2 A;  5CZG A;  5E7D A;  3U5J A;  3RCW A;  5A5P A;  1F68 A;  5EU1 A;  4YYM A;  4XUA A;  3JVJ A;  3HME A;  5BT4 A;  5E9M A;  5HLS A;  5HEM A;  5H1T A;  5L96 A;  4O7A A;  4NYX A;  4NR9 A;  3HMH A;  5HQ5 A;  5D3N A;  5BT5 A;  5A5N A;  4TZ2 A;  5A5O A;  4NR6 A;  4QR3 A;  5D3S A;  5C89 A;  5F61 A;  4A9J A;  5FE5 A;  4UIZ A;  5LKX A;  4A9O A;  5DYA A;  3U5L A;  3TLP A;  4J1P A;  4QUT A;  2RNW A;  3O33 A;  5AMF A;  5J0D A;  5EP7 A;  4NQM A;  3LQI A;  4UYD A;  5FG4 A;  5DFD A;  5IGL A;  3UW9 A;  4A9K A;  5CUE A;  4N4H A;  4F3I A;  5DKC A;  2DWW A;  4N4I A;  1E6I A;  5C7N A;  5DW2 A;  4TS8 A;  4YBS A;  5DLX A;  4ZC9 A;  5ACY A;  4YAB A;  4LRG A;  4KCX A;  4TT6 A;  5FE8 A;  3P1E A;  5G4S A;  5A5S A;  4UIX A;  4TT4 A;  4UIY A;  3JVM A;  5I88 A;  4QSS A;  5A82 A;  4QNS A;  4XYA A;  2D82 A;  3UVY A;  2YDW A;  5FFW A;  5A83 A;  3QZS A;  3Q2F A;  3P5O A;  5CQ7 A;  3FKM X; 
#chains in the Genus database with same CATH topology
 3IU6 A;  5FE4 A;  3UV5 A;  4RVR A;  5DKD A;  4LDF A;  4YAD A;  2YEK A;  4PTB A;  2YW5 A;  5CY9 A;  4LYI A;  4QSQ A;  4A9H A;  4YY4 A;  3LQH A;  4Q0N A;  5CFW A;  2WP1 A;  5E9I A;  1WUG A;  3K2J A;  2DAT A;  4KV4 A;  5JWM A;  4CL9 A;  4QC1 A;  5ENC A;  3UV2 A;  4NR4 A;  4LR6 A;  3QZV A;  5EK9 A;  5CS8 A;  3U5M A;  4MEP A;  5H1U A;  5LKU A;  5D24 A;  5I29 A;  5AD3 A;  5KTX A;  1WUM A;  2R0Y A;  4DON A;  5FE0 A;  3IU5 A;  5FH7 A;  4HXN A;  2MJV B;  4IR4 A;  3AAD A;  3DAI A;  4BW1 A;  2KTB B;  5EPB A;  4HXP A;  5FDZ A;  4A9I A;  5LJ0 A;  3S92 A;  4YH3 A;  2G4A A;  4J0S A;  5CP5 A;  2I7K A;  5DX4 A;  5FB0 A;  5C8G A;  4NRA A;  4BJX A;  5DLZ A;  3MB3 A;  5LJ2 A;  4BHW A;  2I8N A;  5D3T A;  2OO1 A;  4CFL A;  5E9K A;  4NUD A;  5BT3 A;  5CU8 A;  4Z93 A;  5KU3 A;  4LYW A;  3LQJ A;  4YC9 A;  5F36 A;  3MB4 A;  5EIS A;  4MEN A;  5CQ3 A;  2NXB A;  4A9M A;  4O76 A;  4QY4 A;  5C4Q A;  4YYG A;  5JI8 A;  4HBY A;  5LKZ A;  5G4R A;  5F60 A;  4QBM A;  5D7X A;  5EGU A;  5HQ7 A;  5FG6 A;  4TQN A;  5FH6 A;  2RO1 A;  5EQ1 A;  4TYL A;  5FE1 A;  3UV4 A;  5I7Y A;  5I83 A;  4FLP A;  4TU4 A;  3I3J A;  3AQA A;  4YYI A;  3ONI A;  5ENH A;  5DFC A;  4O7C A;  2WP2 A;  4A9L A;  5ENI A;  1JM4 B;  5EA1 A;  3UVD A;  4NR5 A;  4KV1 A;  4PY6 A;  5D3L A;  4MR4 A;  2GRC A;  4QEW A;  4HXR A;  4IR5 A;  3LJW A;  4MEQ A;  5EWH A;  4QYL A;  5DYX A;  4TT2 A;  4O7F A;  3DWY A;  5ENB A;  3MUL A;  3SVH A;  3UVX A;  3U5P A;  5F1H A;  5II1 A;  5L98 A;  5CRM A;  5E3D A;  4TZ8 A;  5FFV A;  4QEU A;  3D1D A;  2DVV A;  4QEV A;  4HXS A;  5E3G A;  5COI A;  3SVG A;  4UYG A;  4YAT A;  4O77 A;  5F5Z A;  5FH8 A;  3O34 A;  5H85 A;  4Z6I A;  4C66 A;  3UVW A;  4HBV A;  5A5Q A;  5E0R A;  5EM3 A;  2DVR A;  3G0J A;  4HXO A;  4PCI A;  4PCE A;  4XY8 A;  4UYF B;  4J3I A;  3MXF A;  3O35 A;  5TB6 A;  4QUU A;  4BW4 A;  2R0S A;  5IID A;  3P1C A;  5E73 A;  4QZS A;  5CQT A;  1PUO A;  4TU6 A;  3HMF A;  5E9Y A;  5HRW A;  4YK0 A;  5L8U A;  4ZW1 A;  3Q2E A;  4YYN A;  4HXM A;  4NRB A;  5I86 A;  4HXL A;  2YYN A;  4QST A;  4CUS A;  4ALH A;  5DBM A;  3G0L A;  2RI7 A;  5ENJ A;  5DW1 A;  2N9G A;  5FE3 A;  4AKH A;  4NXJ A;  5TCM A;  4ALG A;  4A9F A;  4WIV A;  4UYH A;  4YYJ A;  4WHW A;  4YYH A;  5HFQ A;  2DKW A;  5FE7 A;  4UYE A;  4IOO A;  4QYD A;  4QSR A;  5IGM A;  4O7B A;  4QR5 A;  5A81 A;  4O71 A;  4LC2 A;  2YQD A;  4HBX A;  5EVA A;  4QSV A;  4QB3 A;  4AKG A;  5F1L A;  3D7C A;  4BW3 A;  4LZR A;  4O78 A;  5IGN A;  5CUD A;  4A9N A;  5EWD A;  3U5N A;  4PKL A;  4CUQ A;  5D0C A;  4Q0O A;  3QZT A;  4O74 A;  5H1V A;  4C67 A;  4QR4 A;  2DVS A;  5HFR A;  5LVR A;  4AKN A;  4CUU A;  3JVK A;  4IR6 A;  5EWC A;  4CUT A;  4CUR A;  4TTE A;  2FSA A;  4QSP A;  5LUU A;  4UIT A;  5HRX A;  3SVF A;  4N4G A;  5L99 A;  3VKG A;  2DVQ A;  4OGJ A;  2RFJ A;  5I89 A;  5FE6 A;  1JSP B;  4YH4 A;  5CQ4 A;  5D3J A;  4Z6H A;  4UIU A;  4NRC A;  4ZQL A;  3MQM A;  5CGP A;  3MUK A;  2E3K A;  4MR6 A;  4A9E A;  5FE2 A;  4QC3 A;  3JVL A;  4UIV A;  4NS5 A;  3U5K A;  3S91 A;  4LZS A;  5HCL A;  5C85 A;  5EPS A;  5LKT A;  5F62 A;  5FG5 A;  5KTW A;  5EI4 A;  4CLB A;  4XY9 A;  4OGI A;  5LVQ A;  4IOR A;  5EWW A;  3P1D A;  1EQF A;  4J0R A;  5F25 A;  5FFY A;  2R0V A;  3ZYU A;  5E9V A;  5KO4 A;  3ERR A;  4O7E A;  5I1Q A;  4Z1Q A;  4IR3 A;  4NUE A;  4UYF A;  4X2I A;  5E74 A;  4AI6 A;  3NXB A;  2YEL A;  5E9L A;  2L85 A;  2E7O A;  4YYK A;  2L84 A;  2YEM A;  5D25 A;  5CQ8 A;  5A5R A;  5CUB A;  5CUG A;  5CTL A;  4BW2 A;  2D9E A;  5CUC A;  5ETD A;  4YBM A;  4YAX A;  1X0J A;  4NR8 A;  2E7N A;  5DYU A;  4YBT A;  3P1F A;  4CFK A;  5I40 A;  5EWV A;  5D26 A;  4MR5 A;  5DY7 A;  4NYW A;  4LYS A;  5D3P A;  5ENG A;  3D1B A;  4Z1S A;  2RNX A;  2L5E A;  5F63 A;  5CUA A;  5D3H A;  2H60 A;  2RNY A;  5I80 A;  4O75 A;  5L8T A;  4O72 A;  4GPJ A;  5HRV A;  5CQ6 A;  4NQN A;  5LJ1 A;  4IOQ A;  5AME A;  5IBN A;  4UIW A;  5DFB A;  5HM0 A;  1N72 A;  4NR7 A;  2F6N A;  5IG6 A;  5ENF A;  4QSW A;  5FBX A;  5ETB A;  5KTU A;  4YY6 A;  4AKI A;  4HBW A;  4Y03 A;  5C87 A;  2R10 A;  2RS9 B;  2F6J A;  5ENE A;  5D3R A;  4XUB A;  4OUF A;  5CQ5 A;  4O70 A;  5A85 A;  2OUO A;  4LZ2 A;  5CPE A;  4YYD A;  4QSU A;  4HXK A;  5HEN A;  3GG3 A;  5HQ6 A;  4N4F A;  5F3A A;  5KHM A;  5DKH A;  5II2 A;  5A7C A;  5CQA A;  2OSS A;  5I7X A;  5EPR A;  4PS5 A;  5IGK A;  3LXJ A;  4NUC A;  5EIC A;  5DYC A;  3U5O A;  4QSX A;  2EJN A;  3O36 A;  1ZS5 A;  2LSP B;  4MR3 A;  5CRZ A;  5L97 A;  4CUP A;  5FE9 A;  5HEL A;  5F2P A;  4MEO A;  4N3W A;  4NYV A;  5FB1 A;  5HJC A;  4E96 A;  4WHU A;  5K29 A;  5EV9 A;  3O37 A;  5AD2 A;  5CZG A;  5E7D A;  3U5J A;  3RCW A;  5A5P A;  1F68 A;  5EU1 A;  4YYM A;  4XUA A;  3JVJ A;  3HME A;  5BT4 A;  5E9M A;  5HLS A;  5HEM A;  5H1T A;  5L96 A;  4O7A A;  4NYX A;  4NR9 A;  3HMH A;  5HQ5 A;  5D3N A;  5BT5 A;  5A5N A;  4TZ2 A;  5A5O A;  4NR6 A;  4QR3 A;  5D3S A;  5C89 A;  5F61 A;  4A9J A;  5FE5 A;  4UIZ A;  5LKX A;  4A9O A;  5DYA A;  3U5L A;  3TLP A;  4J1P A;  4QUT A;  2RNW A;  3O33 A;  5AMF A;  5J0D A;  5EP7 A;  4NQM A;  3LQI A;  4UYD A;  5FG4 A;  5DFD A;  5IGL A;  3UW9 A;  4A9K A;  5CUE A;  4N4H A;  4F3I A;  5DKC A;  2DWW A;  4N4I A;  1E6I A;  5C7N A;  5DW2 A;  4TS8 A;  4YBS A;  5DLX A;  4ZC9 A;  5ACY A;  1ZKR A;  4YAB A;  4LRG A;  4KCX A;  4TT6 A;  5FE8 A;  3P1E A;  5G4S A;  5A5S A;  4UIX A;  4TT4 A;  4UIY A;  3JVM A;  3VKH A;  5I88 A;  4QSS A;  5A82 A;  4QNS A;  4XYA A;  2D82 A;  3UVY A;  2YDW A;  5FFW A;  5A83 A;  3QZS A;  3Q2F A;  3P5O A;  5CQ7 A;  3FKM X; 
#chains in the Genus database with same CATH homology
 3IU6 A;  5FE4 A;  3UV5 A;  4RVR A;  5DKD A;  4LDF A;  4YAD A;  2YEK A;  4PTB A;  2YW5 A;  5CY9 A;  4LYI A;  4QSQ A;  4A9H A;  4YY4 A;  3LQH A;  4Q0N A;  5CFW A;  2WP1 A;  5E9I A;  1WUG A;  3K2J A;  2DAT A;  4KV4 A;  5JWM A;  4CL9 A;  4QC1 A;  5ENC A;  3UV2 A;  4NR4 A;  4LR6 A;  3QZV A;  5EK9 A;  5CS8 A;  3U5M A;  4MEP A;  5H1U A;  5LKU A;  5D24 A;  5I29 A;  5AD3 A;  5KTX A;  1WUM A;  2R0Y A;  4DON A;  5FE0 A;  3IU5 A;  5FH7 A;  4HXN A;  2MJV B;  4IR4 A;  3AAD A;  3DAI A;  4BW1 A;  2KTB B;  5EPB A;  4HXP A;  5FDZ A;  4A9I A;  5LJ0 A;  3S92 A;  4YH3 A;  2G4A A;  4J0S A;  5CP5 A;  2I7K A;  5DX4 A;  5FB0 A;  5C8G A;  4NRA A;  4BJX A;  5DLZ A;  3MB3 A;  5LJ2 A;  4BHW A;  2I8N A;  5D3T A;  2OO1 A;  4CFL A;  5E9K A;  4NUD A;  5BT3 A;  5CU8 A;  4Z93 A;  5KU3 A;  4LYW A;  3LQJ A;  4YC9 A;  5F36 A;  3MB4 A;  5EIS A;  4MEN A;  5CQ3 A;  2NXB A;  4A9M A;  4O76 A;  4QY4 A;  5C4Q A;  4YYG A;  5JI8 A;  4HBY A;  5LKZ A;  5G4R A;  5F60 A;  4QBM A;  5D7X A;  5EGU A;  5HQ7 A;  5FG6 A;  4TQN A;  5FH6 A;  2RO1 A;  5EQ1 A;  4TYL A;  5FE1 A;  3UV4 A;  5I7Y A;  5I83 A;  4FLP A;  4TU4 A;  3I3J A;  3AQA A;  4YYI A;  3ONI A;  5ENH A;  5DFC A;  4O7C A;  2WP2 A;  4A9L A;  5ENI A;  1JM4 B;  5EA1 A;  3UVD A;  4NR5 A;  4KV1 A;  4PY6 A;  5D3L A;  4MR4 A;  2GRC A;  4QEW A;  4HXR A;  4IR5 A;  3LJW A;  4MEQ A;  5EWH A;  4QYL A;  5DYX A;  4TT2 A;  4O7F A;  3DWY A;  5ENB A;  3MUL A;  3SVH A;  3UVX A;  3U5P A;  5F1H A;  5II1 A;  5L98 A;  5CRM A;  5E3D A;  4TZ8 A;  5FFV A;  4QEU A;  2DVV A;  4QEV A;  4HXS A;  5E3G A;  5COI A;  3SVG A;  4UYG A;  4YAT A;  4O77 A;  5F5Z A;  5FH8 A;  3O34 A;  5H85 A;  4Z6I A;  4C66 A;  3UVW A;  4HBV A;  5A5Q A;  5E0R A;  5EM3 A;  2DVR A;  3G0J A;  4HXO A;  4PCI A;  4PCE A;  4XY8 A;  4UYF B;  4J3I A;  3MXF A;  3O35 A;  5TB6 A;  4QUU A;  4BW4 A;  2R0S A;  5IID A;  3P1C A;  5E73 A;  4QZS A;  5CQT A;  4TU6 A;  3HMF A;  5E9Y A;  5HRW A;  4YK0 A;  5L8U A;  4ZW1 A;  3Q2E A;  4YYN A;  4HXM A;  4NRB A;  5I86 A;  4HXL A;  2YYN A;  4QST A;  4CUS A;  4ALH A;  5DBM A;  3G0L A;  2RI7 A;  5ENJ A;  5DW1 A;  2N9G A;  5FE3 A;  4NXJ A;  5TCM A;  4ALG A;  4A9F A;  4WIV A;  4UYH A;  4YYJ A;  4WHW A;  4YYH A;  5HFQ A;  2DKW A;  5FE7 A;  4UYE A;  4IOO A;  4QYD A;  4QSR A;  5IGM A;  4O7B A;  4QR5 A;  5A81 A;  4O71 A;  4LC2 A;  2YQD A;  4HBX A;  5EVA A;  4QSV A;  4QB3 A;  5F1L A;  3D7C A;  4BW3 A;  4LZR A;  4O78 A;  5IGN A;  5CUD A;  4A9N A;  5EWD A;  3U5N A;  4PKL A;  4CUQ A;  5D0C A;  4Q0O A;  3QZT A;  4O74 A;  5H1V A;  4C67 A;  4QR4 A;  2DVS A;  5HFR A;  5LVR A;  4AKN A;  4CUU A;  3JVK A;  4IR6 A;  5EWC A;  4CUT A;  4CUR A;  4TTE A;  2FSA A;  4QSP A;  5LUU A;  4UIT A;  5HRX A;  3SVF A;  4N4G A;  5L99 A;  2DVQ A;  4OGJ A;  2RFJ A;  5I89 A;  5FE6 A;  1JSP B;  4YH4 A;  5CQ4 A;  5D3J A;  4Z6H A;  4UIU A;  4NRC A;  4ZQL A;  3MQM A;  5CGP A;  3MUK A;  2E3K A;  4MR6 A;  4A9E A;  5FE2 A;  4QC3 A;  3JVL A;  4UIV A;  4NS5 A;  3U5K A;  3S91 A;  4LZS A;  5HCL A;  5C85 A;  5EPS A;  5LKT A;  5F62 A;  5FG5 A;  5KTW A;  5EI4 A;  4CLB A;  4XY9 A;  4OGI A;  5LVQ A;  4IOR A;  5EWW A;  3P1D A;  1EQF A;  4J0R A;  5F25 A;  5FFY A;  2R0V A;  3ZYU A;  5E9V A;  5KO4 A;  4O7E A;  5I1Q A;  4Z1Q A;  4IR3 A;  4NUE A;  4UYF A;  4X2I A;  5E74 A;  3NXB A;  2YEL A;  5E9L A;  2L85 A;  2E7O A;  4YYK A;  2L84 A;  2YEM A;  5D25 A;  5CQ8 A;  5A5R A;  5CUB A;  5CUG A;  5CTL A;  4BW2 A;  2D9E A;  5CUC A;  5ETD A;  4YBM A;  4YAX A;  1X0J A;  4NR8 A;  2E7N A;  5DYU A;  4YBT A;  3P1F A;  4CFK A;  5I40 A;  5EWV A;  5D26 A;  4MR5 A;  5DY7 A;  4NYW A;  4LYS A;  5D3P A;  5ENG A;  4Z1S A;  2RNX A;  2L5E A;  5F63 A;  5CUA A;  5D3H A;  2H60 A;  2RNY A;  5I80 A;  4O75 A;  5L8T A;  4O72 A;  4GPJ A;  5HRV A;  5CQ6 A;  4NQN A;  5LJ1 A;  4IOQ A;  5AME A;  5IBN A;  4UIW A;  5DFB A;  5HM0 A;  1N72 A;  4NR7 A;  2F6N A;  5IG6 A;  5ENF A;  4QSW A;  5FBX A;  5ETB A;  5KTU A;  4YY6 A;  4HBW A;  4Y03 A;  5C87 A;  2R10 A;  2RS9 B;  2F6J A;  5ENE A;  5D3R A;  4XUB A;  4OUF A;  5CQ5 A;  4O70 A;  5A85 A;  2OUO A;  4LZ2 A;  5CPE A;  4YYD A;  4QSU A;  4HXK A;  5HEN A;  3GG3 A;  5HQ6 A;  4N4F A;  5F3A A;  5KHM A;  5DKH A;  5II2 A;  5A7C A;  5CQA A;  2OSS A;  5I7X A;  5EPR A;  4PS5 A;  5IGK A;  3LXJ A;  4NUC A;  5EIC A;  5DYC A;  3U5O A;  4QSX A;  3O36 A;  1ZS5 A;  2LSP B;  4MR3 A;  5CRZ A;  5L97 A;  4CUP A;  5FE9 A;  5HEL A;  5F2P A;  4MEO A;  4N3W A;  4NYV A;  5FB1 A;  5HJC A;  4E96 A;  4WHU A;  5K29 A;  5EV9 A;  3O37 A;  5AD2 A;  5CZG A;  5E7D A;  3U5J A;  3RCW A;  5A5P A;  1F68 A;  5EU1 A;  4YYM A;  4XUA A;  3JVJ A;  3HME A;  5BT4 A;  5E9M A;  5HLS A;  5HEM A;  5H1T A;  5L96 A;  4O7A A;  4NYX A;  4NR9 A;  3HMH A;  5HQ5 A;  5D3N A;  5BT5 A;  5A5N A;  4TZ2 A;  5A5O A;  4NR6 A;  4QR3 A;  5D3S A;  5C89 A;  5F61 A;  4A9J A;  5FE5 A;  4UIZ A;  5LKX A;  4A9O A;  5DYA A;  3U5L A;  3TLP A;  4J1P A;  4QUT A;  2RNW A;  3O33 A;  5AMF A;  5J0D A;  5EP7 A;  4NQM A;  3LQI A;  4UYD A;  5FG4 A;  5DFD A;  5IGL A;  3UW9 A;  4A9K A;  5CUE A;  4N4H A;  4F3I A;  5DKC A;  2DWW A;  4N4I A;  1E6I A;  5C7N A;  5DW2 A;  4TS8 A;  4YBS A;  5DLX A;  4ZC9 A;  5ACY A;  4YAB A;  4LRG A;  4KCX A;  4TT6 A;  5FE8 A;  3P1E A;  5G4S A;  5A5S A;  4UIX A;  4TT4 A;  4UIY A;  3JVM A;  5I88 A;  4QSS A;  5A82 A;  4QNS A;  4XYA A;  2D82 A;  3UVY A;  2YDW A;  5FFW A;  5A83 A;  3QZS A;  3Q2F A;  3P5O A;  5CQ7 A;  3FKM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...