4KV4A

Brd4 bromodomain 2 in complex with acetylated rel peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
111
structure length
111
Chain Sequence
AGSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 4
publication title Brd4 maintains constitutively active NF-kappa B in cancer cells by binding to acetylated RelA.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4kv4A00
3AQAA 2I8NA 4TS8A 4KV1A 5E9YA 2RNXA 4J1PA 5DYAA 5FG4A 3U5NA 2YW5A 4IOOA 5CU8A 4MR5A 3JVLA 4YY6A 4YYHA 4WIVA 3UW9A 5EWCA 3LQHA 1ZS5A 5FE8A 5F3AA 5D3LA 4YATA 5CP5A 5DX4A 3P1EA 4YY4A 5F25A 1WUMA 4LC2A 5HFRA 5CQAA 5FE0A 5CQ4A 5DLZA 5L98A 5LKXA 3K2JA 5TB6A 4AKNA 5ENFA 3LJWA 4HBYA 1EQFA 5FDZA 4QEUA 4DONA 4XY9A 4Q0NA 4MEOA 5EISA 5ENEA 4NR6A 5C85A 3UVWA 4TT2A 4NYVA 2D9EA 5DKDA 5L96A 5LVRA 5DYXA 2YYNA 4YYDA 4ZQLA 3LXJA 3IU5A 4WHUA 4OUFA 5FFYA 3AADA 3RCWA 5C4QA 5FE5A 5A5QA 4Z1SA 5AMFA 2DATA 4QEVA 4NUEA 3TLPA 5HM0A 4UIWA 5A83A 5L8TA 4NYWA 5DFBA 5HRXA 2WP2A 1E6IA 4YADA 3G0LA 4C67A 4O75A 3S92A 2DWWA 4YBTA 4YH4A 5HJCA 4WHWA 2YQDA 2E7NA 4YH3A 4YYJA 4UIYA 2WP1A 5C89A 4MR6A 4IR6A 5KU3A 4YYGA 4E96A 5L8UA 4UYEA 5LJ0A 5L99A 3Q2FA 5IGLA 2OUOA 5D3RA 4IOQA 5LKZA 4GPJA 5DBMA 2R0VA 5A81A 5FE2A 3ONIA 5F61A 4NR8A 5CQ7A 4O7FA 5D3JA 5IG6A 5L97A 4QY4A 2D82A 5FB0A 2DVQA 3SVHA 5D24A 3O34A 3U5LA 3GG3A 3QZTA 4YK0A 4TQNA 3UVYA 5LVQA 2E7OA 5LKTA 5D3PA 4UYGA 4QSUA 5FE3A 2RFJA 3MXFA 3HMHA 4TZ8A 3MB4A 4C66A 5DFCA 5H1VA 5F1LA 5LJ1A 5F1HA 5HQ6A 5CRMA 5FH7A 5FBXA 5ACYA 4UIUA 4A9EA 5ENJA 5AD3A 4NS5A 4CUSA 4QEWA 4BW3A 4UYDA 4Q0OA 5CS8A 1X0JA 4HXPA 4HBVA 5A85A 5BT5A 5D7XA 5A5PA 4QUTA 5J0DA 4CUTA 5CZGA 3SVFA 3LQIA 2OSSA 5E9MA 4TT6A 5H85A 4Y03A 5H1TA 2DVSA 5HRWA 4CUQA 5C87A 5FG5A 3U5OA 5K29A 4PKLA 4UYHA 3U5MA 4UIZA 4A9IA 4A9JA 5LKUA 2DVRA 5EPSA 4NXJA 5D3HA 4MR3A 2L84A 5AMEA 4QYLA 4BW2A 5EWVA 5E74A 5I40A 4IR3A 4XY8A 5FE9A 5E3DA 4ALHA 2RO1A 4HXKA 5F36A 2R0YA 3U5JA 4QSRA 4QNSA 4OGIA 2RNWA 4QBMA 4LZRA 4N3WA 4HXRA 4PCIA 4N4GA 5ENHA 5FH6A 5FH8A 5EI4A 5FG6A 5EP7A 3P1FA 4KCXA 5DLXA 2R0SA 4N4IA 5CQ5A 4NUCA 5ENIA 4CLBA 5FFWA 4IR5A 5I80A 4O70A 5II2A 4BW4A 4QSPA 4LYWA 5E7DA 5DYUA 5EQ1A 5HFQA 4YBMA 5CUEA 4LZ2A 5I29A 2I7KA 4TU4A 5EU1A 5KHMA 5H1UA 5I83A 4QC3A 2YDWA 3MUKA 4LYIA 5IGMA 5AD2A 5DKCA 4CFLA 4QYDA 5I1QA 4HXLA 5EWDA 5HRVA 5FE6A 4O74A 4NRAA 4BW1A 4IORA 3I3JA 3MQMA 5D26A 3O33A 4O77A 3IU6A 5F60A 3MB3A 4PY6A 5CQ3A 4QB3A 4ALGA 2DKWA 5CUBA 3P5OA 5ETDA 2MJVB 5DY7A 5CTLA 5D3SA 3P1DA 3MULA 2L5EA 4QSXA 5FB1A 4RVRA 4N4FA 4LZSA 5HQ7A 4HBXA 4J0RA 4QR4A 2KTBB 1JSPB 5LUUA 5DYCA 3ZYUA 1F68A 3U5KA 5F62A 4NRCA 4UYFB 5ENBA 3UV4A 4QSTA 4NQMA 5CFWA 2NXBA 4QSVA 5KTWA 5HLSA 4HBWA 5LJ2A 3QZVA 4MENA 4Z1QA 2F6NA 4QC1A 5ETBA 5HCLA 5I88A 3Q2EA 2GRCA 4NYXA 3G0JA 2DVVA 5D25A 5E0RA 4HXNA 5EWWA 3UVXA 3P1CA 4A9KA 4PTBA 5A82A 4IR4A 5CUAA 4NRBA 4NR7A 5CPEA 2YEKA 1N72A 5HQ5A 5JWMA 5CUGA 5EWHA 4N4HA 4J0SA 2N9GA 5A5SA 2R10A 3LQJA 4QSQA 5IGNA 5F5ZA 4OGJA 2RS9B 2RNYA 5TCMA 5KO4A 4TTEA 4O7EA 4PCEA 5HEMA 4XUAA 5KTXA 4ZW1A 3U5PA 4ZC9A 5HELA 2YELA 4CUUA 5EVAA 5ENCA 3O37A 5A7CA 4X2IA 4YC9A 5F63A 4O76A 3UV2A 5D3TA 5E73A 4QSWA 4A9MA 4XUBA 5EPRA 4QR5A 5FE1A 2RI7A 2YEMA 1WUGA 4BJXA 5EICA 5EA1A 3SVGA 4QSSA 4UITA 3DWYA 4J3IA 5EPBA 4NR4A 5F2PA 5I86A 4HXMA 4O78A 2LSPB 5DW1A 4CURA 4LYSA 4FLPA 5DKHA 5IIDA 4LRGA 5C8GA 5IBNA 4NR5A 4O7AA 5KTUA 4CFKA 4YYNA 4MEQA 3HMFA 4A9LA 4TZ2A 2OO1A 5C7NA 2H60A 4A9FA 3O36A 4MEPA 3DAIA 4CUPA 3JVKA 4KV4A 5A5RA 5JI8A 5CUCA 4QZSA 3O35A 3HMEA 4TT4A 5D0CA 4HXOA 4O7BA 4O72A 5HENA 4XYAA 4QUUA 5CRZA 4F3IA 3S91A 5E3GA 4TU6A 5G4SA 5FE7A 4QR3A 4LR6A 5CQ8A 5E9LA 3UV5A 4YABA 4Z6IA 5FE4A 4HXSA 2G4AA 5BT4A 5DW2A 5A5NA 4YBSA 5E9VA 5I7YA 4YAXA 5D3NA 5I89A 4UYFA 3D7CA 3JVMA 5BT3A 4BHWA 3JVJA 4A9HA 4TYLA 4MR4A 5IGKA 4A9OA 5FFVA 4YYKA 4NUDA 4A9NA 3FKMX 5COIA 5CQTA 4UIVA 5A5OA 5CQ6A 2F6JA 4PS5A 4UIXA 5G4RA 5E9KA 5CUDA 5ENGA 2E3KA 2FSAA 4O71A 5EGUA 3NXBA 5DFDA 5CY9A 3QZSA 5CGPA 5I7XA 4YYMA 4LDFA 4YYIA 4NR9A 5EV9A 2L85A 4Z6HA 5EK9A 5EM3A 1JM4B 4CL9A 5E9IA 4NQNA 4O7CA 3UVDA 4Z93A 5II1A
chains in the Genus database with same CATH superfamily
3AQAA 2I8NA 4TS8A 4KV1A 5E9YA 2RNXA 4J1PA 5DYAA 5FG4A 3U5NA 2YW5A 4IOOA 5CU8A 4MR5A 3JVLA 4YY6A 4YYHA 4WIVA 3UW9A 5EWCA 3LQHA 1ZS5A 5FE8A 5F3AA 5D3LA 4YATA 5CP5A 5DX4A 3P1EA 4YY4A 5F25A 1WUMA 4LC2A 5HFRA 5CQAA 5FE0A 5CQ4A 5DLZA 5L98A 5LKXA 3K2JA 5TB6A 4AKNA 5ENFA 3LJWA 4HBYA 1EQFA 5FDZA 4QEUA 4DONA 4XY9A 4Q0NA 4MEOA 5EISA 5ENEA 4NR6A 5C85A 3UVWA 4TT2A 4NYVA 2D9EA 5DKDA 5L96A 5LVRA 5DYXA 2YYNA 4YYDA 4ZQLA 3LXJA 3IU5A 4WHUA 4OUFA 5FFYA 3AADA 3RCWA 5C4QA 5FE5A 5A5QA 4Z1SA 5AMFA 2DATA 4QEVA 4NUEA 3TLPA 5HM0A 4UIWA 5A83A 5L8TA 4NYWA 5DFBA 5HRXA 2WP2A 1E6IA 4YADA 3G0LA 4C67A 4O75A 3S92A 2DWWA 4YBTA 4YH4A 5HJCA 4WHWA 2YQDA 2E7NA 4YH3A 4YYJA 4UIYA 2WP1A 5C89A 4MR6A 4IR6A 5KU3A 4YYGA 4E96A 5L8UA 4UYEA 5LJ0A 5L99A 3Q2FA 5IGLA 2OUOA 5D3RA 4IOQA 5LKZA 4GPJA 5DBMA 2R0VA 5A81A 5FE2A 3ONIA 5F61A 4NR8A 5CQ7A 4O7FA 5D3JA 5IG6A 5L97A 4QY4A 2D82A 5FB0A 2DVQA 2EJNA 3SVHA 5D24A 3O34A 3U5LA 3GG3A 3QZTA 4YK0A 4TQNA 3UVYA 5LVQA 2E7OA 5LKTA 5D3PA 4UYGA 4QSUA 5FE3A 2RFJA 3MXFA 3HMHA 4TZ8A 3MB4A 4C66A 5DFCA 5H1VA 5F1LA 5LJ1A 5F1HA 5HQ6A 5CRMA 5FH7A 5FBXA 5ACYA 4UIUA 4A9EA 5ENJA 5AD3A 4NS5A 4CUSA 4QEWA 4BW3A 4UYDA 4Q0OA 5CS8A 1X0JA 4HXPA 4HBVA 5A85A 5BT5A 5D7XA 5A5PA 4QUTA 5J0DA 4CUTA 5CZGA 3SVFA 3LQIA 2OSSA 5E9MA 4TT6A 5H85A 4Y03A 5H1TA 2DVSA 3VKHA 5HRWA 4CUQA 5C87A 5FG5A 3U5OA 5K29A 4PKLA 4UYHA 4Z93A 3U5MA 4UIZA 4A9IA 4A9JA 5LKUA 2DVRA 5EPSA 4NXJA 5D3HA 4MR3A 2L84A 5AMEA 4QYLA 4BW2A 5EWVA 5E74A 5I40A 4IR3A 4XY8A 5FE9A 5E3DA 4ALHA 2RO1A 4HXKA 5F36A 2R0YA 3U5JA 4QSRA 4QNSA 4OGIA 2RNWA 4QBMA 4LZRA 4N3WA 4HXRA 4PCIA 4N4GA 5ENHA 5FH6A 5FH8A 5EI4A 5FG6A 5EP7A 3P1FA 4KCXA 5DLXA 2R0SA 4N4IA 5CQ5A 4NUCA 5ENIA 4CLBA 5FFWA 4IR5A 4AKIA 5I80A 3ERRA 4O70A 5II2A 4BW4A 4AKGA 4QSPA 4LYWA 3D1DA 5E7DA 5DYUA 5EQ1A 5HFQA 4YBMA 5CUEA 4LZ2A 5I29A 2I7KA 4TU4A 5EU1A 5KHMA 5H1UA 5I83A 4QC3A 2YDWA 3MUKA 4LYIA 5IGMA 5AD2A 5DKCA 4CFLA 4QYDA 5I1QA 4HXLA 5EWDA 5HRVA 5FE6A 4O74A 4NRAA 4BW1A 1ZKRA 3I3JA 4IORA 3MQMA 5D26A 3O33A 4O77A 3IU6A 3VKGA 5F60A 3MB3A 4PY6A 5CQ3A 4QB3A 4ALGA 4AKHA 2DKWA 5CUBA 3P5OA 5ETDA 2MJVB 5DY7A 5CTLA 5D3SA 3P1DA 3MULA 2L5EA 4QSXA 5FB1A 4RVRA 4N4FA 4LZSA 5HQ7A 4HBXA 4J0RA 4QR4A 2KTBB 1JSPB 5LUUA 5DYCA 3ZYUA 1F68A 3U5KA 5F62A 4NRCA 4UYFB 5ENBA 3UV4A 4QSTA 4NQMA 5CFWA 2NXBA 4QSVA 5KTWA 5HLSA 4HBWA 5LJ2A 3QZVA 4MENA 4Z1QA 2F6NA 4QC1A 5ETBA 5HCLA 5I88A 3Q2EA 2GRCA 4NYXA 3G0JA 2DVVA 5D25A 5E0RA 4HXNA 5EWWA 3UVXA 3P1CA 4A9KA 4PTBA 5A82A 4IR4A 5CUAA 4NRBA 4NR7A 5CPEA 2YEKA 1N72A 5HQ5A 5JWMA 5CUGA 5EWHA 4N4HA 4J0SA 2N9GA 5A5SA 2R10A 3LQJA 4QSQA 5IGNA 5F5ZA 4OGJA 1PUOA 2RS9B 5TCMA 5KO4A 4TTEA 4O7EA 4PCEA 5HEMA 4XUAA 5KTXA 4ZW1A 3U5PA 4ZC9A 5HELA 2YELA 4CUUA 5EVAA 5ENCA 3O37A 5A7CA 4X2IA 4YC9A 5F63A 4O76A 3UV2A 5D3TA 5E73A 4QSWA 4A9MA 4XUBA 5EPRA 4QR5A 5FE1A 2RI7A 2YEMA 1WUGA 4BJXA 5EICA 5EA1A 3SVGA 4QSSA 4UITA 3DWYA 4J3IA 3D1BA 5EPBA 4NR4A 5F2PA 5I86A 4HXMA 4O78A 2LSPB 5DW1A 4CURA 4LYSA 4FLPA 5DKHA 5IIDA 4LRGA 5C8GA 5IBNA 4NR5A 4O7AA 5KTUA 4CFKA 4YYNA 4MEQA 3HMFA 4A9LA 4TZ2A 2OO1A 5C7NA 4AI6A 2H60A 4A9FA 3O36A 4MEPA 3DAIA 4CUPA 3JVKA 4KV4A 5A5RA 5JI8A 5CUCA 4QZSA 3O35A 3HMEA 4TT4A 5D0CA 4HXOA 4O7BA 4O72A 5HENA 4XYAA 4QUUA 5CRZA 4F3IA 3S91A 5E3GA 4TU6A 5G4SA 5FE7A 4QR3A 4LR6A 5CQ8A 5E9LA 3UV5A 4YABA 4Z6IA 5FE4A 4HXSA 2G4AA 5BT4A 5DW2A 5A5NA 4YBSA 5E9VA 5I7YA 4YAXA 5D3NA 5I89A 4UYFA 3D7CA 3JVMA 5BT3A 4BHWA 3JVJA 4A9HA 4TYLA 4MR4A 5IGKA 4A9OA 5FFVA 4YYKA 4NUDA 4A9NA 3FKMX 5COIA 5CQTA 4UIVA 5A5OA 5CQ6A 2F6JA 4PS5A 4UIXA 5G4RA 5E9KA 5CUDA 5ENGA 2E3KA 2FSAA 4O71A 5EGUA 3NXBA 5DFDA 5CY9A 3QZSA 5CGPA 5I7XA 4YYMA 4LDFA 4YYIA 4NR9A 5EV9A 2L85A 4Z6HA 5EK9A 5EM3A 1JM4B 4CL9A 5E9IA 4NQNA 4O7CA 3UVDA 2RNYA 5II1A
chains in the Genus database with same CATH topology
3AQAA 2I8NA 4TS8A 4KV1A 5E9YA 2RNXA 4J1PA 5DYAA 5FG4A 3U5NA 2YW5A 4IOOA 5CU8A 4MR5A 3JVLA 4YY6A 4YYHA 4WIVA 3UW9A 5EWCA 3LQHA 1ZS5A 5FE8A 5F3AA 5D3LA 4YATA 5CP5A 5DX4A 3P1EA 4YY4A 5F25A 1WUMA 4LC2A 5HFRA 5CQAA 5FE0A 5CQ4A 5DLZA 5L98A 5LKXA 3K2JA 5TB6A 4AKNA 5ENFA 3LJWA 4HBYA 1EQFA 5FDZA 4QEUA 4DONA 4XY9A 4Q0NA 4MEOA 5EISA 5ENEA 4NR6A 5C85A 3UVWA 4TT2A 4NYVA 2D9EA 5DKDA 5L96A 5LVRA 5DYXA 2YYNA 4YYDA 4ZQLA 3LXJA 3IU5A 4WHUA 4OUFA 5FFYA 3AADA 3RCWA 5C4QA 5FE5A 5A5QA 4Z1SA 5AMFA 2DATA 4QEVA 4NUEA 3TLPA 5HM0A 4UIWA 5A83A 5L8TA 4NYWA 5DFBA 5HRXA 2WP2A 1E6IA 4YADA 3G0LA 4C67A 4O75A 3S92A 2DWWA 4YBTA 4YH4A 5HJCA 4WHWA 2YQDA 2E7NA 4YH3A 4YYJA 4UIYA 2WP1A 5C89A 4MR6A 4IR6A 5KU3A 4YYGA 4E96A 5L8UA 4UYEA 5LJ0A 5L99A 3Q2FA 5IGLA 2OUOA 5D3RA 4IOQA 5LKZA 4GPJA 5DBMA 2R0VA 5A81A 5FE2A 3ONIA 5F61A 4NR8A 5CQ7A 4O7FA 5D3JA 5IG6A 5L97A 4QY4A 2D82A 5FB0A 2DVQA 3SVHA 5D24A 3O34A 3U5LA 3GG3A 3QZTA 4YK0A 4TQNA 3UVYA 5LVQA 2E7OA 5LKTA 5D3PA 4UYGA 4QSUA 5FE3A 2RFJA 3MXFA 3HMHA 4TZ8A 3MB4A 4C66A 5DFCA 5H1VA 5F1LA 5LJ1A 5F1HA 5HQ6A 5CRMA 5FH7A 5FBXA 5ACYA 4UIUA 4A9EA 5ENJA 5AD3A 4NS5A 4CUSA 4QEWA 4BW3A 4UYDA 4Q0OA 5CS8A 1X0JA 4HXPA 4HBVA 5A85A 5BT5A 5D7XA 5A5PA 4QUTA 5J0DA 4CUTA 5CZGA 3SVFA 3LQIA 2OSSA 5E9MA 4TT6A 5H85A 4Y03A 5H1TA 2DVSA 5HRWA 4CUQA 5C87A 5FG5A 3U5OA 5K29A 4PKLA 4UYHA 3U5MA 4UIZA 4A9IA 4A9JA 5LKUA 2DVRA 5EPSA 4NXJA 5D3HA 4MR3A 2L84A 5AMEA 4QYLA 4BW2A 5EWVA 5E74A 5I40A 4IR3A 4XY8A 5FE9A 5E3DA 4ALHA 2RO1A 4HXKA 5F36A 2R0YA 3U5JA 4QSRA 4QNSA 4OGIA 2RNWA 4QBMA 4LZRA 4N3WA 4HXRA 4PCIA 4N4GA 5ENHA 5FH6A 5FH8A 5EI4A 5FG6A 5EP7A 3P1FA 4KCXA 5DLXA 2R0SA 4N4IA 5CQ5A 4NUCA 5ENIA 4CLBA 5FFWA 4IR5A 5I80A 4O70A 5II2A 4BW4A 4QSPA 4LYWA 5E7DA 5DYUA 5EQ1A 5HFQA 4YBMA 5CUEA 4LZ2A 5I29A 2I7KA 4TU4A 5EU1A 5KHMA 5H1UA 5I83A 4QC3A 2YDWA 3MUKA 4LYIA 5IGMA 5AD2A 5DKCA 4CFLA 4QYDA 5I1QA 4HXLA 5EWDA 5HRVA 5FE6A 4O74A 4NRAA 4BW1A 4IORA 3I3JA 3MQMA 5D26A 3O33A 4O77A 3IU6A 5F60A 3MB3A 4PY6A 5CQ3A 4QB3A 4ALGA 2DKWA 5CUBA 3P5OA 5ETDA 2MJVB 5DY7A 5CTLA 5D3SA 3P1DA 3MULA 2L5EA 4QSXA 5FB1A 4RVRA 4N4FA 4LZSA 5HQ7A 4HBXA 4J0RA 4QR4A 2KTBB 1JSPB 5LUUA 5DYCA 3ZYUA 1F68A 3U5KA 5F62A 4NRCA 4UYFB 5ENBA 3UV4A 4QSTA 4NQMA 5CFWA 2NXBA 4QSVA 5KTWA 5HLSA 4HBWA 5LJ2A 3QZVA 4MENA 4Z1QA 2F6NA 4QC1A 5ETBA 5HCLA 5I88A 3Q2EA 2GRCA 4NYXA 3G0JA 2DVVA 5D25A 5E0RA 4HXNA 5EWWA 3UVXA 3P1CA 4A9KA 4PTBA 5A82A 4IR4A 5CUAA 4NRBA 4NR7A 5CPEA 2YEKA 1N72A 5HQ5A 5JWMA 5CUGA 5EWHA 4N4HA 4J0SA 2N9GA 5A5SA 2R10A 3LQJA 4QSQA 5IGNA 5F5ZA 4OGJA 2RS9B 2RNYA 5TCMA 5KO4A 4TTEA 4O7EA 4PCEA 5HEMA 4XUAA 5KTXA 4ZW1A 3U5PA 4ZC9A 5HELA 2YELA 4CUUA 5EVAA 5ENCA 3O37A 5A7CA 4X2IA 4YC9A 5F63A 4O76A 3UV2A 5D3TA 5E73A 4QSWA 4A9MA 4XUBA 5EPRA 4QR5A 5FE1A 2RI7A 2YEMA 1WUGA 4BJXA 5EICA 5EA1A 3SVGA 4QSSA 4UITA 3DWYA 4J3IA 5EPBA 4NR4A 5F2PA 5I86A 4HXMA 4O78A 2LSPB 5DW1A 4CURA 4LYSA 4FLPA 5DKHA 5IIDA 4LRGA 5C8GA 5IBNA 4NR5A 4O7AA 5KTUA 4CFKA 4YYNA 4MEQA 3HMFA 4A9LA 4TZ2A 2OO1A 5C7NA 2H60A 4A9FA 3O36A 4MEPA 3DAIA 4CUPA 3JVKA 4KV4A 5A5RA 5JI8A 5CUCA 4QZSA 3O35A 3HMEA 4TT4A 5D0CA 4HXOA 4O7BA 4O72A 5HENA 4XYAA 4QUUA 5CRZA 4F3IA 3S91A 5E3GA 4TU6A 5G4SA 5FE7A 4QR3A 4LR6A 5CQ8A 5E9LA 3UV5A 4YABA 4Z6IA 5FE4A 4HXSA 2G4AA 5BT4A 5DW2A 5A5NA 4YBSA 5E9VA 5I7YA 4YAXA 5D3NA 5I89A 4UYFA 3D7CA 3JVMA 5BT3A 4BHWA 3JVJA 4A9HA 4TYLA 4MR4A 5IGKA 4A9OA 5FFVA 4YYKA 4NUDA 4A9NA 3FKMX 5COIA 5CQTA 4UIVA 5A5OA 5CQ6A 2F6JA 4PS5A 4UIXA 5G4RA 5E9KA 5CUDA 5ENGA 2E3KA 2FSAA 4O71A 5EGUA 3NXBA 5DFDA 5CY9A 3QZSA 5CGPA 5I7XA 4YYMA 4LDFA 4YYIA 4NR9A 5EV9A 2L85A 4Z6HA 5EK9A 5EM3A 1JM4B 4CL9A 5E9IA 4NQNA 4O7CA 3UVDA 4Z93A 5II1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQA A;  2I8N A;  4TS8 A;  4KV1 A;  5E9Y A;  2RNX A;  4J1P A;  5DYA A;  5FG4 A;  3U5N A;  2YW5 A;  4IOO A;  5CU8 A;  4MR5 A;  3JVL A;  4YY6 A;  4YYH A;  4WIV A;  3UW9 A;  5EWC A;  3LQH A;  1ZS5 A;  5FE8 A;  5F3A A;  5D3L A;  4YAT A;  5CP5 A;  5DX4 A;  3P1E A;  4YY4 A;  5F25 A;  1WUM A;  4LC2 A;  5HFR A;  5CQA A;  5FE0 A;  5CQ4 A;  5DLZ A;  5L98 A;  5LKX A;  3K2J A;  5TB6 A;  4AKN A;  5ENF A;  3LJW A;  4HBY A;  1EQF A;  5FDZ A;  4QEU A;  4DON A;  4XY9 A;  4Q0N A;  4MEO A;  5EIS A;  5ENE A;  4NR6 A;  5C85 A;  3UVW A;  4TT2 A;  4NYV A;  2D9E A;  5DKD A;  5L96 A;  5LVR A;  5DYX A;  2YYN A;  4YYD A;  4ZQL A;  3LXJ A;  3IU5 A;  4WHU A;  4OUF A;  5FFY A;  3AAD A;  3RCW A;  5C4Q A;  5FE5 A;  5A5Q A;  4Z1S A;  5AMF A;  2DAT A;  4QEV A;  4NUE A;  3TLP A;  5HM0 A;  4UIW A;  5A83 A;  5L8T A;  4NYW A;  5DFB A;  5HRX A;  2WP2 A;  1E6I A;  4YAD A;  3G0L A;  4C67 A;  4O75 A;  3S92 A;  2DWW A;  4YBT A;  4YH4 A;  5HJC A;  4WHW A;  2YQD A;  2E7N A;  4YH3 A;  4YYJ A;  4UIY A;  2WP1 A;  5C89 A;  4MR6 A;  4IR6 A;  5KU3 A;  4YYG A;  4E96 A;  5L8U A;  4UYE A;  5LJ0 A;  5L99 A;  3Q2F A;  5IGL A;  2OUO A;  5D3R A;  4IOQ A;  5LKZ A;  4GPJ A;  5DBM A;  2R0V A;  5A81 A;  5FE2 A;  3ONI A;  5F61 A;  4NR8 A;  5CQ7 A;  4O7F A;  5D3J A;  5IG6 A;  5L97 A;  4QY4 A;  2D82 A;  5FB0 A;  2DVQ A;  3SVH A;  5D24 A;  3O34 A;  3U5L A;  3GG3 A;  3QZT A;  4YK0 A;  4TQN A;  3UVY A;  5LVQ A;  2E7O A;  5LKT A;  5D3P A;  4UYG A;  4QSU A;  5FE3 A;  2RFJ A;  3MXF A;  3HMH A;  4TZ8 A;  3MB4 A;  4C66 A;  5DFC A;  5H1V A;  5F1L A;  5LJ1 A;  5F1H A;  5HQ6 A;  5CRM A;  5FH7 A;  5FBX A;  5ACY A;  4UIU A;  4A9E A;  5ENJ A;  5AD3 A;  4NS5 A;  4CUS A;  4QEW A;  4BW3 A;  4UYD A;  4Q0O A;  5CS8 A;  1X0J A;  4HXP A;  4HBV A;  5A85 A;  5BT5 A;  5D7X A;  5A5P A;  4QUT A;  5J0D A;  4CUT A;  5CZG A;  3SVF A;  3LQI A;  2OSS A;  5E9M A;  4TT6 A;  5H85 A;  4Y03 A;  5H1T A;  2DVS A;  5HRW A;  4CUQ A;  5C87 A;  5FG5 A;  3U5O A;  5K29 A;  4PKL A;  4UYH A;  3U5M A;  4UIZ A;  4A9I A;  4A9J A;  5LKU A;  2DVR A;  5EPS A;  4NXJ A;  5D3H A;  4MR3 A;  2L84 A;  5AME A;  4QYL A;  4BW2 A;  5EWV A;  5E74 A;  5I40 A;  4IR3 A;  4XY8 A;  5FE9 A;  5E3D A;  4ALH A;  2RO1 A;  4HXK A;  5F36 A;  2R0Y A;  3U5J A;  4QSR A;  4QNS A;  4OGI A;  2RNW A;  4QBM A;  4LZR A;  4N3W A;  4HXR A;  4PCI A;  4N4G A;  5ENH A;  5FH6 A;  5FH8 A;  5EI4 A;  5FG6 A;  5EP7 A;  3P1F A;  4KCX A;  5DLX A;  2R0S A;  4N4I A;  5CQ5 A;  4NUC A;  5ENI A;  4CLB A;  5FFW A;  4IR5 A;  5I80 A;  4O70 A;  5II2 A;  4BW4 A;  4QSP A;  4LYW A;  5E7D A;  5DYU A;  5EQ1 A;  5HFQ A;  4YBM A;  5CUE A;  4LZ2 A;  5I29 A;  2I7K A;  4TU4 A;  5EU1 A;  5KHM A;  5H1U A;  5I83 A;  4QC3 A;  2YDW A;  3MUK A;  4LYI A;  5IGM A;  5AD2 A;  5DKC A;  4CFL A;  4QYD A;  5I1Q A;  4HXL A;  5EWD A;  5HRV A;  5FE6 A;  4O74 A;  4NRA A;  4BW1 A;  4IOR A;  3I3J A;  3MQM A;  5D26 A;  3O33 A;  4O77 A;  3IU6 A;  5F60 A;  3MB3 A;  4PY6 A;  5CQ3 A;  4QB3 A;  4ALG A;  2DKW A;  5CUB A;  3P5O A;  5ETD A;  2MJV B;  5DY7 A;  5CTL A;  5D3S A;  3P1D A;  3MUL A;  2L5E A;  4QSX A;  5FB1 A;  4RVR A;  4N4F A;  4LZS A;  5HQ7 A;  4HBX A;  4J0R A;  4QR4 A;  2KTB B;  1JSP B;  5LUU A;  5DYC A;  3ZYU A;  1F68 A;  3U5K A;  5F62 A;  4NRC A;  4UYF B;  5ENB A;  3UV4 A;  4QST A;  4NQM A;  5CFW A;  2NXB A;  4QSV A;  5KTW A;  5HLS A;  4HBW A;  5LJ2 A;  3QZV A;  4MEN A;  4Z1Q A;  2F6N A;  4QC1 A;  5ETB A;  5HCL A;  5I88 A;  3Q2E A;  2GRC A;  4NYX A;  3G0J A;  2DVV A;  5D25 A;  5E0R A;  4HXN A;  5EWW A;  3UVX A;  3P1C A;  4A9K A;  4PTB A;  5A82 A;  4IR4 A;  5CUA A;  4NRB A;  4NR7 A;  5CPE A;  2YEK A;  1N72 A;  5HQ5 A;  5JWM A;  5CUG A;  5EWH A;  4N4H A;  4J0S A;  2N9G A;  5A5S A;  2R10 A;  3LQJ A;  4QSQ A;  5IGN A;  5F5Z A;  4OGJ A;  2RS9 B;  2RNY A;  5TCM A;  5KO4 A;  4TTE A;  4O7E A;  4PCE A;  5HEM A;  4XUA A;  5KTX A;  4ZW1 A;  3U5P A;  4ZC9 A;  5HEL A;  2YEL A;  4CUU A;  5EVA A;  5ENC A;  3O37 A;  5A7C A;  4X2I A;  4YC9 A;  5F63 A;  4O76 A;  3UV2 A;  5D3T A;  5E73 A;  4QSW A;  4A9M A;  4XUB A;  5EPR A;  4QR5 A;  5FE1 A;  2RI7 A;  2YEM A;  1WUG A;  4BJX A;  5EIC A;  5EA1 A;  3SVG A;  4QSS A;  4UIT A;  3DWY A;  4J3I A;  5EPB A;  4NR4 A;  5F2P A;  5I86 A;  4HXM A;  4O78 A;  2LSP B;  5DW1 A;  4CUR A;  4LYS A;  4FLP A;  5DKH A;  5IID A;  4LRG A;  5C8G A;  5IBN A;  4NR5 A;  4O7A A;  5KTU A;  4CFK A;  4YYN A;  4MEQ A;  3HMF A;  4A9L A;  4TZ2 A;  2OO1 A;  5C7N A;  2H60 A;  4A9F A;  3O36 A;  4MEP A;  3DAI A;  4CUP A;  3JVK A;  4KV4 A;  5A5R A;  5JI8 A;  5CUC A;  4QZS A;  3O35 A;  3HME A;  4TT4 A;  5D0C A;  4HXO A;  4O7B A;  4O72 A;  5HEN A;  4XYA A;  4QUU A;  5CRZ A;  4F3I A;  3S91 A;  5E3G A;  4TU6 A;  5G4S A;  5FE7 A;  4QR3 A;  4LR6 A;  5CQ8 A;  5E9L A;  3UV5 A;  4YAB A;  4Z6I A;  5FE4 A;  4HXS A;  2G4A A;  5BT4 A;  5DW2 A;  5A5N A;  4YBS A;  5E9V A;  5I7Y A;  4YAX A;  5D3N A;  5I89 A;  4UYF A;  3D7C A;  3JVM A;  5BT3 A;  4BHW A;  3JVJ A;  4A9H A;  4TYL A;  4MR4 A;  5IGK A;  4A9O A;  5FFV A;  4YYK A;  4NUD A;  4A9N A;  3FKM X;  5COI A;  5CQT A;  4UIV A;  5A5O A;  5CQ6 A;  2F6J A;  4PS5 A;  4UIX A;  5G4R A;  5E9K A;  5CUD A;  5ENG A;  2E3K A;  2FSA A;  4O71 A;  5EGU A;  3NXB A;  5DFD A;  5CY9 A;  3QZS A;  5CGP A;  5I7X A;  4YYM A;  4LDF A;  4YYI A;  4NR9 A;  5EV9 A;  2L85 A;  4Z6H A;  5EK9 A;  5EM3 A;  1JM4 B;  4CL9 A;  5E9I A;  4NQN A;  4O7C A;  3UVD A;  4Z93 A;  5II1 A; 
#chains in the Genus database with same CATH topology
 3AQA A;  2I8N A;  4TS8 A;  4KV1 A;  5E9Y A;  2RNX A;  4J1P A;  5DYA A;  5FG4 A;  3U5N A;  2YW5 A;  4IOO A;  5CU8 A;  4MR5 A;  3JVL A;  4YY6 A;  4YYH A;  4WIV A;  3UW9 A;  5EWC A;  3LQH A;  1ZS5 A;  5FE8 A;  5F3A A;  5D3L A;  4YAT A;  5CP5 A;  5DX4 A;  3P1E A;  4YY4 A;  5F25 A;  1WUM A;  4LC2 A;  5HFR A;  5CQA A;  5FE0 A;  5CQ4 A;  5DLZ A;  5L98 A;  5LKX A;  3K2J A;  5TB6 A;  4AKN A;  5ENF A;  3LJW A;  4HBY A;  1EQF A;  5FDZ A;  4QEU A;  4DON A;  4XY9 A;  4Q0N A;  4MEO A;  5EIS A;  5ENE A;  4NR6 A;  5C85 A;  3UVW A;  4TT2 A;  4NYV A;  2D9E A;  5DKD A;  5L96 A;  5LVR A;  5DYX A;  2YYN A;  4YYD A;  4ZQL A;  3LXJ A;  3IU5 A;  4WHU A;  4OUF A;  5FFY A;  3AAD A;  3RCW A;  5C4Q A;  5FE5 A;  5A5Q A;  4Z1S A;  5AMF A;  2DAT A;  4QEV A;  4NUE A;  3TLP A;  5HM0 A;  4UIW A;  5A83 A;  5L8T A;  4NYW A;  5DFB A;  5HRX A;  2WP2 A;  1E6I A;  4YAD A;  3G0L A;  4C67 A;  4O75 A;  3S92 A;  2DWW A;  4YBT A;  4YH4 A;  5HJC A;  4WHW A;  2YQD A;  2E7N A;  4YH3 A;  4YYJ A;  4UIY A;  2WP1 A;  5C89 A;  4MR6 A;  4IR6 A;  5KU3 A;  4YYG A;  4E96 A;  5L8U A;  4UYE A;  5LJ0 A;  5L99 A;  3Q2F A;  5IGL A;  2OUO A;  5D3R A;  4IOQ A;  5LKZ A;  4GPJ A;  5DBM A;  2R0V A;  5A81 A;  5FE2 A;  3ONI A;  5F61 A;  4NR8 A;  5CQ7 A;  4O7F A;  5D3J A;  5IG6 A;  5L97 A;  4QY4 A;  2D82 A;  5FB0 A;  2DVQ A;  2EJN A;  3SVH A;  5D24 A;  3O34 A;  3U5L A;  3GG3 A;  3QZT A;  4YK0 A;  4TQN A;  3UVY A;  5LVQ A;  2E7O A;  5LKT A;  5D3P A;  4UYG A;  4QSU A;  5FE3 A;  2RFJ A;  3MXF A;  3HMH A;  4TZ8 A;  3MB4 A;  4C66 A;  5DFC A;  5H1V A;  5F1L A;  5LJ1 A;  5F1H A;  5HQ6 A;  5CRM A;  5FH7 A;  5FBX A;  5ACY A;  4UIU A;  4A9E A;  5ENJ A;  5AD3 A;  4NS5 A;  4CUS A;  4QEW A;  4BW3 A;  4UYD A;  4Q0O A;  5CS8 A;  1X0J A;  4HXP A;  4HBV A;  5A85 A;  5BT5 A;  5D7X A;  5A5P A;  4QUT A;  5J0D A;  4CUT A;  5CZG A;  3SVF A;  3LQI A;  2OSS A;  5E9M A;  4TT6 A;  5H85 A;  4Y03 A;  5H1T A;  2DVS A;  3VKH A;  5HRW A;  4CUQ A;  5C87 A;  5FG5 A;  3U5O A;  5K29 A;  4PKL A;  4UYH A;  4Z93 A;  3U5M A;  4UIZ A;  4A9I A;  4A9J A;  5LKU A;  2DVR A;  5EPS A;  4NXJ A;  5D3H A;  4MR3 A;  2L84 A;  5AME A;  4QYL A;  4BW2 A;  5EWV A;  5E74 A;  5I40 A;  4IR3 A;  4XY8 A;  5FE9 A;  5E3D A;  4ALH A;  2RO1 A;  4HXK A;  5F36 A;  2R0Y A;  3U5J A;  4QSR A;  4QNS A;  4OGI A;  2RNW A;  4QBM A;  4LZR A;  4N3W A;  4HXR A;  4PCI A;  4N4G A;  5ENH A;  5FH6 A;  5FH8 A;  5EI4 A;  5FG6 A;  5EP7 A;  3P1F A;  4KCX A;  5DLX A;  2R0S A;  4N4I A;  5CQ5 A;  4NUC A;  5ENI A;  4CLB A;  5FFW A;  4IR5 A;  4AKI A;  5I80 A;  3ERR A;  4O70 A;  5II2 A;  4BW4 A;  4AKG A;  4QSP A;  4LYW A;  3D1D A;  5E7D A;  5DYU A;  5EQ1 A;  5HFQ A;  4YBM A;  5CUE A;  4LZ2 A;  5I29 A;  2I7K A;  4TU4 A;  5EU1 A;  5KHM A;  5H1U A;  5I83 A;  4QC3 A;  2YDW A;  3MUK A;  4LYI A;  5IGM A;  5AD2 A;  5DKC A;  4CFL A;  4QYD A;  5I1Q A;  4HXL A;  5EWD A;  5HRV A;  5FE6 A;  4O74 A;  4NRA A;  4BW1 A;  1ZKR A;  3I3J A;  4IOR A;  3MQM A;  5D26 A;  3O33 A;  4O77 A;  3IU6 A;  3VKG A;  5F60 A;  3MB3 A;  4PY6 A;  5CQ3 A;  4QB3 A;  4ALG A;  4AKH A;  2DKW A;  5CUB A;  3P5O A;  5ETD A;  2MJV B;  5DY7 A;  5CTL A;  5D3S A;  3P1D A;  3MUL A;  2L5E A;  4QSX A;  5FB1 A;  4RVR A;  4N4F A;  4LZS A;  5HQ7 A;  4HBX A;  4J0R A;  4QR4 A;  2KTB B;  1JSP B;  5LUU A;  5DYC A;  3ZYU A;  1F68 A;  3U5K A;  5F62 A;  4NRC A;  4UYF B;  5ENB A;  3UV4 A;  4QST A;  4NQM A;  5CFW A;  2NXB A;  4QSV A;  5KTW A;  5HLS A;  4HBW A;  5LJ2 A;  3QZV A;  4MEN A;  4Z1Q A;  2F6N A;  4QC1 A;  5ETB A;  5HCL A;  5I88 A;  3Q2E A;  2GRC A;  4NYX A;  3G0J A;  2DVV A;  5D25 A;  5E0R A;  4HXN A;  5EWW A;  3UVX A;  3P1C A;  4A9K A;  4PTB A;  5A82 A;  4IR4 A;  5CUA A;  4NRB A;  4NR7 A;  5CPE A;  2YEK A;  1N72 A;  5HQ5 A;  5JWM A;  5CUG A;  5EWH A;  4N4H A;  4J0S A;  2N9G A;  5A5S A;  2R10 A;  3LQJ A;  4QSQ A;  5IGN A;  5F5Z A;  4OGJ A;  1PUO A;  2RS9 B;  5TCM A;  5KO4 A;  4TTE A;  4O7E A;  4PCE A;  5HEM A;  4XUA A;  5KTX A;  4ZW1 A;  3U5P A;  4ZC9 A;  5HEL A;  2YEL A;  4CUU A;  5EVA A;  5ENC A;  3O37 A;  5A7C A;  4X2I A;  4YC9 A;  5F63 A;  4O76 A;  3UV2 A;  5D3T A;  5E73 A;  4QSW A;  4A9M A;  4XUB A;  5EPR A;  4QR5 A;  5FE1 A;  2RI7 A;  2YEM A;  1WUG A;  4BJX A;  5EIC A;  5EA1 A;  3SVG A;  4QSS A;  4UIT A;  3DWY A;  4J3I A;  3D1B A;  5EPB A;  4NR4 A;  5F2P A;  5I86 A;  4HXM A;  4O78 A;  2LSP B;  5DW1 A;  4CUR A;  4LYS A;  4FLP A;  5DKH A;  5IID A;  4LRG A;  5C8G A;  5IBN A;  4NR5 A;  4O7A A;  5KTU A;  4CFK A;  4YYN A;  4MEQ A;  3HMF A;  4A9L A;  4TZ2 A;  2OO1 A;  5C7N A;  4AI6 A;  2H60 A;  4A9F A;  3O36 A;  4MEP A;  3DAI A;  4CUP A;  3JVK A;  4KV4 A;  5A5R A;  5JI8 A;  5CUC A;  4QZS A;  3O35 A;  3HME A;  4TT4 A;  5D0C A;  4HXO A;  4O7B A;  4O72 A;  5HEN A;  4XYA A;  4QUU A;  5CRZ A;  4F3I A;  3S91 A;  5E3G A;  4TU6 A;  5G4S A;  5FE7 A;  4QR3 A;  4LR6 A;  5CQ8 A;  5E9L A;  3UV5 A;  4YAB A;  4Z6I A;  5FE4 A;  4HXS A;  2G4A A;  5BT4 A;  5DW2 A;  5A5N A;  4YBS A;  5E9V A;  5I7Y A;  4YAX A;  5D3N A;  5I89 A;  4UYF A;  3D7C A;  3JVM A;  5BT3 A;  4BHW A;  3JVJ A;  4A9H A;  4TYL A;  4MR4 A;  5IGK A;  4A9O A;  5FFV A;  4YYK A;  4NUD A;  4A9N A;  3FKM X;  5COI A;  5CQT A;  4UIV A;  5A5O A;  5CQ6 A;  2F6J A;  4PS5 A;  4UIX A;  5G4R A;  5E9K A;  5CUD A;  5ENG A;  2E3K A;  2FSA A;  4O71 A;  5EGU A;  3NXB A;  5DFD A;  5CY9 A;  3QZS A;  5CGP A;  5I7X A;  4YYM A;  4LDF A;  4YYI A;  4NR9 A;  5EV9 A;  2L85 A;  4Z6H A;  5EK9 A;  5EM3 A;  1JM4 B;  4CL9 A;  5E9I A;  4NQN A;  4O7C A;  3UVD A;  2RNY A;  5II1 A; 
#chains in the Genus database with same CATH homology
 3AQA A;  2I8N A;  4TS8 A;  4KV1 A;  5E9Y A;  2RNX A;  4J1P A;  5DYA A;  5FG4 A;  3U5N A;  2YW5 A;  4IOO A;  5CU8 A;  4MR5 A;  3JVL A;  4YY6 A;  4YYH A;  4WIV A;  3UW9 A;  5EWC A;  3LQH A;  1ZS5 A;  5FE8 A;  5F3A A;  5D3L A;  4YAT A;  5CP5 A;  5DX4 A;  3P1E A;  4YY4 A;  5F25 A;  1WUM A;  4LC2 A;  5HFR A;  5CQA A;  5FE0 A;  5CQ4 A;  5DLZ A;  5L98 A;  5LKX A;  3K2J A;  5TB6 A;  4AKN A;  5ENF A;  3LJW A;  4HBY A;  1EQF A;  5FDZ A;  4QEU A;  4DON A;  4XY9 A;  4Q0N A;  4MEO A;  5EIS A;  5ENE A;  4NR6 A;  5C85 A;  3UVW A;  4TT2 A;  4NYV A;  2D9E A;  5DKD A;  5L96 A;  5LVR A;  5DYX A;  2YYN A;  4YYD A;  4ZQL A;  3LXJ A;  3IU5 A;  4WHU A;  4OUF A;  5FFY A;  3AAD A;  3RCW A;  5C4Q A;  5FE5 A;  5A5Q A;  4Z1S A;  5AMF A;  2DAT A;  4QEV A;  4NUE A;  3TLP A;  5HM0 A;  4UIW A;  5A83 A;  5L8T A;  4NYW A;  5DFB A;  5HRX A;  2WP2 A;  1E6I A;  4YAD A;  3G0L A;  4C67 A;  4O75 A;  3S92 A;  2DWW A;  4YBT A;  4YH4 A;  5HJC A;  4WHW A;  2YQD A;  2E7N A;  4YH3 A;  4YYJ A;  4UIY A;  2WP1 A;  5C89 A;  4MR6 A;  4IR6 A;  5KU3 A;  4YYG A;  4E96 A;  5L8U A;  4UYE A;  5LJ0 A;  5L99 A;  3Q2F A;  5IGL A;  2OUO A;  5D3R A;  4IOQ A;  5LKZ A;  4GPJ A;  5DBM A;  2R0V A;  5A81 A;  5FE2 A;  3ONI A;  5F61 A;  4NR8 A;  5CQ7 A;  4O7F A;  5D3J A;  5IG6 A;  5L97 A;  4QY4 A;  2D82 A;  5FB0 A;  2DVQ A;  3SVH A;  5D24 A;  3O34 A;  3U5L A;  3GG3 A;  3QZT A;  4YK0 A;  4TQN A;  3UVY A;  5LVQ A;  2E7O A;  5LKT A;  5D3P A;  4UYG A;  4QSU A;  5FE3 A;  2RFJ A;  3MXF A;  3HMH A;  4TZ8 A;  3MB4 A;  4C66 A;  5DFC A;  5H1V A;  5F1L A;  5LJ1 A;  5F1H A;  5HQ6 A;  5CRM A;  5FH7 A;  5FBX A;  5ACY A;  4UIU A;  4A9E A;  5ENJ A;  5AD3 A;  4NS5 A;  4CUS A;  4QEW A;  4BW3 A;  4UYD A;  4Q0O A;  5CS8 A;  1X0J A;  4HXP A;  4HBV A;  5A85 A;  5BT5 A;  5D7X A;  5A5P A;  4QUT A;  5J0D A;  4CUT A;  5CZG A;  3SVF A;  3LQI A;  2OSS A;  5E9M A;  4TT6 A;  5H85 A;  4Y03 A;  5H1T A;  2DVS A;  5HRW A;  4CUQ A;  5C87 A;  5FG5 A;  3U5O A;  5K29 A;  4PKL A;  4UYH A;  3U5M A;  4UIZ A;  4A9I A;  4A9J A;  5LKU A;  2DVR A;  5EPS A;  4NXJ A;  5D3H A;  4MR3 A;  2L84 A;  5AME A;  4QYL A;  4BW2 A;  5EWV A;  5E74 A;  5I40 A;  4IR3 A;  4XY8 A;  5FE9 A;  5E3D A;  4ALH A;  2RO1 A;  4HXK A;  5F36 A;  2R0Y A;  3U5J A;  4QSR A;  4QNS A;  4OGI A;  2RNW A;  4QBM A;  4LZR A;  4N3W A;  4HXR A;  4PCI A;  4N4G A;  5ENH A;  5FH6 A;  5FH8 A;  5EI4 A;  5FG6 A;  5EP7 A;  3P1F A;  4KCX A;  5DLX A;  2R0S A;  4N4I A;  5CQ5 A;  4NUC A;  5ENI A;  4CLB A;  5FFW A;  4IR5 A;  5I80 A;  4O70 A;  5II2 A;  4BW4 A;  4QSP A;  4LYW A;  5E7D A;  5DYU A;  5EQ1 A;  5HFQ A;  4YBM A;  5CUE A;  4LZ2 A;  5I29 A;  2I7K A;  4TU4 A;  5EU1 A;  5KHM A;  5H1U A;  5I83 A;  4QC3 A;  2YDW A;  3MUK A;  4LYI A;  5IGM A;  5AD2 A;  5DKC A;  4CFL A;  4QYD A;  5I1Q A;  4HXL A;  5EWD A;  5HRV A;  5FE6 A;  4O74 A;  4NRA A;  4BW1 A;  4IOR A;  3I3J A;  3MQM A;  5D26 A;  3O33 A;  4O77 A;  3IU6 A;  5F60 A;  3MB3 A;  4PY6 A;  5CQ3 A;  4QB3 A;  4ALG A;  2DKW A;  5CUB A;  3P5O A;  5ETD A;  2MJV B;  5DY7 A;  5CTL A;  5D3S A;  3P1D A;  3MUL A;  2L5E A;  4QSX A;  5FB1 A;  4RVR A;  4N4F A;  4LZS A;  5HQ7 A;  4HBX A;  4J0R A;  4QR4 A;  2KTB B;  1JSP B;  5LUU A;  5DYC A;  3ZYU A;  1F68 A;  3U5K A;  5F62 A;  4NRC A;  4UYF B;  5ENB A;  3UV4 A;  4QST A;  4NQM A;  5CFW A;  2NXB A;  4QSV A;  5KTW A;  5HLS A;  4HBW A;  5LJ2 A;  3QZV A;  4MEN A;  4Z1Q A;  2F6N A;  4QC1 A;  5ETB A;  5HCL A;  5I88 A;  3Q2E A;  2GRC A;  4NYX A;  3G0J A;  2DVV A;  5D25 A;  5E0R A;  4HXN A;  5EWW A;  3UVX A;  3P1C A;  4A9K A;  4PTB A;  5A82 A;  4IR4 A;  5CUA A;  4NRB A;  4NR7 A;  5CPE A;  2YEK A;  1N72 A;  5HQ5 A;  5JWM A;  5CUG A;  5EWH A;  4N4H A;  4J0S A;  2N9G A;  5A5S A;  2R10 A;  3LQJ A;  4QSQ A;  5IGN A;  5F5Z A;  4OGJ A;  2RS9 B;  2RNY A;  5TCM A;  5KO4 A;  4TTE A;  4O7E A;  4PCE A;  5HEM A;  4XUA A;  5KTX A;  4ZW1 A;  3U5P A;  4ZC9 A;  5HEL A;  2YEL A;  4CUU A;  5EVA A;  5ENC A;  3O37 A;  5A7C A;  4X2I A;  4YC9 A;  5F63 A;  4O76 A;  3UV2 A;  5D3T A;  5E73 A;  4QSW A;  4A9M A;  4XUB A;  5EPR A;  4QR5 A;  5FE1 A;  2RI7 A;  2YEM A;  1WUG A;  4BJX A;  5EIC A;  5EA1 A;  3SVG A;  4QSS A;  4UIT A;  3DWY A;  4J3I A;  5EPB A;  4NR4 A;  5F2P A;  5I86 A;  4HXM A;  4O78 A;  2LSP B;  5DW1 A;  4CUR A;  4LYS A;  4FLP A;  5DKH A;  5IID A;  4LRG A;  5C8G A;  5IBN A;  4NR5 A;  4O7A A;  5KTU A;  4CFK A;  4YYN A;  4MEQ A;  3HMF A;  4A9L A;  4TZ2 A;  2OO1 A;  5C7N A;  2H60 A;  4A9F A;  3O36 A;  4MEP A;  3DAI A;  4CUP A;  3JVK A;  4KV4 A;  5A5R A;  5JI8 A;  5CUC A;  4QZS A;  3O35 A;  3HME A;  4TT4 A;  5D0C A;  4HXO A;  4O7B A;  4O72 A;  5HEN A;  4XYA A;  4QUU A;  5CRZ A;  4F3I A;  3S91 A;  5E3G A;  4TU6 A;  5G4S A;  5FE7 A;  4QR3 A;  4LR6 A;  5CQ8 A;  5E9L A;  3UV5 A;  4YAB A;  4Z6I A;  5FE4 A;  4HXS A;  2G4A A;  5BT4 A;  5DW2 A;  5A5N A;  4YBS A;  5E9V A;  5I7Y A;  4YAX A;  5D3N A;  5I89 A;  4UYF A;  3D7C A;  3JVM A;  5BT3 A;  4BHW A;  3JVJ A;  4A9H A;  4TYL A;  4MR4 A;  5IGK A;  4A9O A;  5FFV A;  4YYK A;  4NUD A;  4A9N A;  3FKM X;  5COI A;  5CQT A;  4UIV A;  5A5O A;  5CQ6 A;  2F6J A;  4PS5 A;  4UIX A;  5G4R A;  5E9K A;  5CUD A;  5ENG A;  2E3K A;  2FSA A;  4O71 A;  5EGU A;  3NXB A;  5DFD A;  5CY9 A;  3QZS A;  5CGP A;  5I7X A;  4YYM A;  4LDF A;  4YYI A;  4NR9 A;  5EV9 A;  2L85 A;  4Z6H A;  5EK9 A;  5EM3 A;  1JM4 B;  4CL9 A;  5E9I A;  4NQN A;  4O7C A;  3UVD A;  4Z93 A;  5II1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...