5E3DA

Crystal structure of the human brpf1 bromodomain in complex with seed7
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 36
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5e3dA00
4NUEA 4DONA 2WP2A 4NR6A 4BW4A 5ENEA 4O72A 4NS5A 5EI4A 5A5RA 5EQ1A 4BW1A 2H60A 5CQTA 5E9KA 5FB1A 4HXMA 4Z1QA 5FE2A 2R0YA 5FE7A 3U5OA 5G4RA 5BT4A 3HMHA 4TYLA 5E9LA 4AKNA 3LXJA 5L8UA 4PTBA 5DFCA 5E0RA 2LSPB 5CUBA 5I7YA 5EPBA 5E3DA 5C8GA 4OUFA 3MB4A 5ETDA 2YELA 5ENIA 5D0CA 5FDZA 5CGPA 5K29A 2YYNA 5FBXA 5EA1A 5F3AA 4Q0NA 5EGUA 5A5PA 4O7AA 5F1LA 5ENHA 4LR6A 4ZQLA 4IR6A 4Z6IA 5EWWA 3UV4A 3UW9A 5EWHA 3O34A 5F63A 3HMEA 5IBNA 4CUTA 4IR4A 4QSXA 3UV2A 5FE8A 5D7XA 4MR5A 4QUUA 3UVWA 4O74A 5DYXA 5C85A 3ZYUA 5A81A 2F6NA 5AMFA 5EU1A 4J3IA 4HXRA 3NXBA 3MULA 1E6IA 5DLZA 4ALHA 5E3GA 5I1QA 5HQ6A 2DATA 4QNSA 2GRCA 3G0LA 5FFVA 4NRCA 2RO1A 4A9LA 4O7EA 4BW3A 5L8TA 5ENGA 5E9IA 2DVRA 5I40A 4CUUA 3LQHA 2RS9B 4YAXA 4A9HA 4A9OA 5KTXA 4LRGA 4C66A 3DWYA 4IORA 4MENA 4YY4A 5CQ4A 4YYHA 2R0SA 2R0VA 4XY9A 2DVVA 4YYGA 4LC2A 4NR8A 4MEQA 5I83A 4LYIA 5CUDA 3D7CA 4Z1SA 5II2A 5D3LA 2YW5A 4IR5A 4KV4A 5CQAA 4FLPA 5KTUA 4QSUA 4N4IA 4TU6A 4A9EA 4UIUA 5L99A 5DKHA 5A82A 4HXPA 5CRZA 2RI7A 4QBMA 4CFLA 2RNXA 5HJCA 1X0JA 5DX4A 5HQ7A 5AD3A 4QEVA 4GPJA 1EQFA 5CS8A 5H1VA 4ALGA 4BW2A 4PKLA 5EPSA 5LUUA 4IOQA 4QEUA 3FKMX 5F5ZA 4UYGA 4OGIA 4LDFA 3MB3A 3JVKA 3QZVA 4O75A 3MUKA 4QZSA 5ETBA 1JSPB 5HELA 4WIVA 5HQ5A 2OO1A 4UIWA 1F68A 5HM0A 4E96A 2DVSA 5D3JA 5HEMA 4TU4A 4QSVA 4QYLA 5L96A 5IGMA 4PCIA 2E3KA 2RNYA 4CUSA 4CLBA 2D82A 5COIA 5H1UA 5TB6A 5LKXA 5HCLA 5F62A 1N72A 5CPEA 5LJ0A 5TCMA 4CUPA 4UITA 3O37A 5HFQA 4QC1A 5D25A 4QB3A 5A5QA 5DW2A 4YBMA 5CP5A 4NQMA 4TTEA 5CU8A 5ENJA 5A5NA 5D3SA 5A5SA 4N4FA 5I29A 3P5OA 5F25A 4LZ2A 5EK9A 5DBMA 5I86A 4QEWA 5HRWA 3MQMA 5LJ2A 4Z6HA 4NYVA 4TT4A 4QSQA 5FG4A 5JWMA 4A9JA 4F3IA 5DLXA 3U5NA 5F1HA 4NUDA 5LKTA 5JI8A 4YBTA 5EISA 5KHMA 3S91A 4YH3A 3IU6A 5H1TA 3U5PA 4UYHA 5D24A 5C87A 5FH6A 5FE5A 4O7CA 5DFBA 4YK0A 4UIYA 2G4AA 5AMEA 4NRAA 3O36A 4YADA 3U5MA 4O7FA 3O35A 4HXOA 4LYWA 5E74A 5CQ6A 5A5OA 4YYNA 1ZS5A 3JVLA 2RNWA 2NXBA 5D3RA 5CY9A 4A9FA 5CUAA 2DWWA 4YH4A 4CUQA 3QZSA 5EV9A 5I88A 5CTLA 5EICA 5FFYA 3U5KA 4PY6A 4O77A 3UVDA 5E7DA 5FE4A 2OSSA 5FG5A 5ENFA 2L5EA 4QSTA 4QR5A 3RCWA 5FG6A 3I3JA 4QSPA 3HMFA 5LKZA 4NR9A 5F60A 5DYUA 4A9IA 3P1CA 5IGKA 3LQIA 4O76A 2DVQA 3MXFA 2N9GA 4N4GA 3SVFA 5CUCA 4WHWA 4UIXA 5L97A 4J0RA 5C4QA 4TS8A 2I7KA 4HBXA 4YATA 3O33A 5DKCA 5F61A 4N3WA 5HRXA 5CZGA 5FE3A 4BJXA 5FE0A 5HENA 4TT2A 5BT5A 4MR3A 5EPRA 5FE9A 3QZTA 4NUCA 5LKUA 4NYXA 4HBVA 3JVJA 2YEMA 5D3TA 2KTBB 3U5JA 4C67A 4Z93A 4UYFA 3P1DA 5EP7A 4O7BA 2WP1A 4XYAA 4LZSA 4MEPA 5FH8A 2FSAA 5A85A 4NR7A 4YC9A 3DAIA 5I7XA 2E7OA 4YYDA 5CUGA 5II1A 4BHWA 2D9EA 4HBYA 5CQ7A 2YDWA 4PCEA 4IOOA 2OUOA 2YEKA 4KCXA 2R10A 4YBSA 5I80A 5DW1A 4UIVA 5DFDA 4QSSA 4J1PA 4YYKA 2MJVB 5E9VA 3Q2EA 5I89A 4A9NA 4YY6A 5CQ8A 4TQNA 5LVRA 1WUGA 4HBWA 4J0SA 5D3HA 4HXNA 4QYDA 5FH7A 5E73A 5ACYA 5CRMA 2RFJA 4MR4A 4IR3A 5CQ5A 5A7CA 4UYFB 5ENBA 4QUTA 1JM4B 3GG3A 5L98A 4UYDA 5FE1A 3UVXA 4O78A 5IG6A 4QC3A 4HXKA 5EWVA 4KV1A 4LYSA 4PS5A 5D26A 4HXLA 3ONIA 4ZW1A 3UVYA 5FFWA 3P1EA 3U5LA 3LJWA 3SVHA 4CL9A 4TT6A 5DYCA 3AQAA 4YYMA 3IU5A 5E9YA 4YYIA 4QSRA 4X2IA 1WUMA 5CUEA 5DYAA 5IIDA 4TZ2A 5HLSA 4Q0OA 5EWCA 4QR3A 2F6JA 4Y03A 4XY8A 5G4SA 4CURA 4NYWA 4RVRA 4NR4A 2L84A 2E7NA 4O70A 3LQJA 5DKDA 4CFKA 5CQ3A 2DKWA 5FB0A 4LZRA 5E9MA 5EM3A 5IGLA 5H85A 4QSWA 5KU3A 4QR4A 4TZ8A 4N4HA 4XUBA 3SVGA 4UIZA 4A9MA 4YABA 5J0DA 5F36A 5HRVA 3TLPA 4NQNA 3K2JA 4MR6A 2L85A 4O71A 3P1FA 3G0JA 4NXJA 5C7NA 4NR5A 5F2PA 3AADA 5EWDA 3S92A 2YQDA 4XUAA 3UV5A 2I8NA 3Q2FA 5ENCA 5AD2A 5D3PA 5KTWA 3JVMA 4MEOA 5DY7A 4WHUA 4QY4A 5IGNA 5FE6A 4OGJA 5C89A 4ZC9A 5D3NA 5EVAA 4UYEA 5A83A 5LVQA 4HXSA 4YYJA 5LJ1A 5HFRA 5KO4A 4A9KA 5BT3A 5CFWA 4NRBA
chains in the Genus database with same CATH superfamily
4NUEA 3VKHA 4DONA 2WP2A 4NR6A 4BW4A 5ENEA 4O72A 3VKGA 4NS5A 5EI4A 5A5RA 5EQ1A 4BW1A 2H60A 5CQTA 5E9KA 5FB1A 4HXMA 4Z1QA 5FE2A 2R0YA 5FE7A 3U5OA 5G4RA 5BT4A 3HMHA 4TYLA 5E9LA 4AKNA 3LXJA 5L8UA 4PTBA 5DFCA 5E0RA 2LSPB 5CUBA 5I7YA 5EPBA 5E3DA 5C8GA 4OUFA 3MB4A 5ETDA 2YELA 5ENIA 5D0CA 5FDZA 5CGPA 5K29A 2YYNA 5FBXA 5EA1A 5F3AA 4Q0NA 5EGUA 5A5PA 4O7AA 5F1LA 5ENHA 4LR6A 4ZQLA 4IR6A 4Z6IA 5EWWA 3UV4A 3UW9A 5EWHA 3O34A 5F63A 3HMEA 5IBNA 4CUTA 4IR4A 4QSXA 3UV2A 5FE8A 5D7XA 4MR5A 4QUUA 3UVWA 4O74A 5DYXA 5C85A 3ZYUA 5A81A 2F6NA 5AMFA 5EU1A 4J3IA 4HXRA 3NXBA 3MULA 1E6IA 5DLZA 4ALHA 5E3GA 5I1QA 5HQ6A 2DATA 4QNSA 2GRCA 3G0LA 5FFVA 4NRCA 2RO1A 4A9LA 4AKHA 4O7EA 4BW3A 5L8TA 5ENGA 5E9IA 2DVRA 5I40A 4CUUA 3LQHA 2RS9B 4YAXA 4A9HA 4A9OA 5KTXA 4LRGA 4C66A 3DWYA 4IORA 4MENA 4YY4A 5CQ4A 4YYHA 2R0SA 2R0VA 4XY9A 2DVVA 4YYGA 4LC2A 4NR8A 4MEQA 5I83A 4LYIA 5CUDA 3D7CA 4Z1SA 5II2A 5D3LA 2YW5A 4IR5A 4KV4A 5CQAA 4FLPA 5KTUA 4QSUA 4N4IA 4TU6A 4A9EA 4UIUA 5L99A 5DKHA 5A82A 4HXPA 5CRZA 2RI7A 4QBMA 4CFLA 2RNXA 5HJCA 1X0JA 5DX4A 5HQ7A 5AD3A 4QEVA 4GPJA 1EQFA 5CS8A 5H1VA 4ALGA 4BW2A 4PKLA 5EPSA 5LUUA 4IOQA 4QEUA 3FKMX 5F5ZA 4UYGA 4OGIA 4LDFA 3MB3A 3JVKA 3QZVA 4O75A 3MUKA 4QZSA 5ETBA 1JSPB 4AI6A 5HELA 4WIVA 5HQ5A 2OO1A 4UIWA 1F68A 5HM0A 4E96A 2DVSA 5D3JA 5HEMA 4TU4A 4QSVA 4QYLA 5L96A 5IGMA 4PCIA 2E3KA 2RNYA 4CUSA 4CLBA 2D82A 5COIA 5H1UA 5TB6A 5LKXA 5HCLA 5F62A 1N72A 5CPEA 5LJ0A 5TCMA 4CUPA 4UITA 3O37A 5HFQA 4QC1A 5D25A 4QB3A 5A5QA 5DW2A 4YBMA 2EJNA 5CP5A 4NQMA 4TTEA 5CU8A 5ENJA 5A5NA 5D3SA 5A5SA 4N4FA 5I29A 3P5OA 5F25A 4LZ2A 5EK9A 5DBMA 5I86A 4QEWA 5HRWA 3MQMA 5LJ2A 4Z6HA 4NYVA 4TT4A 4QSQA 5FG4A 5JWMA 4A9JA 4F3IA 1ZKRA 5DLXA 3U5NA 5F1HA 4NUDA 5LKTA 5JI8A 4YBTA 5EISA 5KHMA 3S91A 4YH3A 3IU6A 3D1DA 5H1TA 3U5PA 4UYHA 5D24A 5C87A 5FH6A 5FE5A 4O7CA 5DFBA 4YK0A 4UIYA 2G4AA 5AMEA 4NRAA 3O36A 4YADA 3U5MA 4O7FA 3O35A 4HXOA 4LYWA 5E74A 5CQ6A 5A5OA 4YYNA 1ZS5A 3JVLA 2RNWA 2NXBA 5D3RA 5CY9A 4A9FA 5CUAA 2DWWA 4YH4A 4CUQA 3QZSA 5EV9A 5I88A 5CTLA 5EICA 5FFYA 3U5KA 4PY6A 4O77A 3UVDA 5E7DA 5FE4A 2OSSA 5FG5A 5ENFA 2L5EA 4QSTA 4QR5A 3RCWA 5FG6A 3I3JA 4QSPA 3HMFA 5LKZA 4NR9A 5F60A 5DYUA 4A9IA 3P1CA 5IGKA 3LQIA 4O76A 2DVQA 3MXFA 2N9GA 4N4GA 3SVFA 5CUCA 4WHWA 4UIXA 5L97A 4J0RA 5C4QA 4TS8A 2I7KA 4HBXA 4YATA 3O33A 5DKCA 5F61A 4N3WA 5HRXA 5CZGA 5FE3A 4BJXA 5FE0A 5HENA 4TT2A 5BT5A 4MR3A 5EPRA 5FE9A 3QZTA 4NUCA 5LKUA 4NYXA 4HBVA 3JVJA 2YEMA 5D3TA 2KTBB 3U5JA 4C67A 4Z93A 4UYFA 3P1DA 5EP7A 4O7BA 2WP1A 4XYAA 4LZSA 4MEPA 5FH8A 2FSAA 5A85A 4NR7A 4YC9A 3DAIA 5I7XA 2E7OA 3ERRA 4YYDA 5CUGA 5II1A 4BHWA 2D9EA 4HBYA 5CQ7A 2YDWA 4PCEA 4IOOA 2OUOA 2YEKA 4KCXA 2R10A 4YBSA 3D1BA 5I80A 5DW1A 4UIVA 5DFDA 4QSSA 4J1PA 4YYKA 2MJVB 5E9VA 3Q2EA 5I89A 4A9NA 4YY6A 5CQ8A 4TQNA 5LVRA 1WUGA 4HBWA 4J0SA 5D3HA 4HXNA 4QYDA 5FH7A 5E73A 5ACYA 5CRMA 2RFJA 4MR4A 4IR3A 5CQ5A 5A7CA 4UYFB 5ENBA 4QUTA 1JM4B 3GG3A 5L98A 4UYDA 5FE1A 3UVXA 4O78A 5IG6A 4QC3A 4HXKA 5EWVA 4KV1A 4LYSA 4PS5A 5D26A 4HXLA 3ONIA 4ZW1A 3UVYA 5FFWA 3P1EA 3U5LA 3LJWA 3SVHA 4CL9A 4TT6A 5DYCA 3AQAA 4YYMA 3IU5A 5E9YA 4YYIA 4QSRA 4X2IA 1WUMA 5CUEA 5DYAA 5IIDA 4TZ2A 5HLSA 4Q0OA 5EWCA 4QR3A 4AKGA 2F6JA 4Y03A 4XY8A 1PUOA 5G4SA 4CURA 4NYWA 4RVRA 4NR4A 2L84A 2E7NA 4O70A 3LQJA 5DKDA 4CFKA 5CQ3A 2DKWA 5FB0A 4LZRA 5E9MA 5EM3A 5IGLA 5H85A 4QSWA 5KU3A 4QR4A 4TZ8A 4N4HA 4XUBA 3SVGA 4UIZA 4A9MA 4YABA 5J0DA 5F36A 5HRVA 3TLPA 4NQNA 3K2JA 4MR6A 2L85A 4O71A 3P1FA 3G0JA 4NXJA 5C7NA 4NR5A 5F2PA 3AADA 5EWDA 3S92A 2YQDA 4XUAA 3UV5A 2I8NA 3Q2FA 5ENCA 5AD2A 5D3PA 5KTWA 3JVMA 4MEOA 5DY7A 4WHUA 4QY4A 5IGNA 5FE6A 4OGJA 5C89A 4AKIA 4ZC9A 5D3NA 5EVAA 4UYEA 5A83A 5LVQA 4HXSA 4YYJA 5LJ1A 5HFRA 5KO4A 4A9KA 5BT3A 5CFWA 4NRBA
chains in the Genus database with same CATH topology
4NUEA 4DONA 2WP2A 4NR6A 4BW4A 5ENEA 4O72A 4NS5A 5EI4A 5A5RA 5EQ1A 4BW1A 2H60A 5CQTA 5E9KA 5FB1A 4HXMA 4Z1QA 5FE2A 2R0YA 5FE7A 3U5OA 5G4RA 5BT4A 3HMHA 4TYLA 5E9LA 4AKNA 3LXJA 5L8UA 4PTBA 5DFCA 5E0RA 2LSPB 5CUBA 5I7YA 5EPBA 5E3DA 5C8GA 4OUFA 3MB4A 5ETDA 2YELA 5ENIA 5D0CA 5FDZA 5CGPA 5K29A 2YYNA 5FBXA 5EA1A 5F3AA 4Q0NA 5EGUA 5A5PA 4O7AA 5F1LA 5ENHA 4LR6A 4ZQLA 4IR6A 4Z6IA 5EWWA 3UV4A 3UW9A 5EWHA 3O34A 5F63A 3HMEA 5IBNA 4CUTA 4IR4A 4QSXA 3UV2A 5FE8A 5D7XA 4MR5A 4QUUA 3UVWA 4O74A 5DYXA 5C85A 3ZYUA 5A81A 2F6NA 5AMFA 5EU1A 4J3IA 4HXRA 3NXBA 3MULA 1E6IA 5DLZA 4ALHA 5E3GA 5I1QA 5HQ6A 2DATA 4QNSA 2GRCA 3G0LA 5FFVA 4NRCA 2RO1A 4A9LA 4O7EA 4BW3A 5L8TA 5ENGA 5E9IA 2DVRA 5I40A 4CUUA 3LQHA 2RS9B 4YAXA 4A9HA 4A9OA 5KTXA 4LRGA 4C66A 3DWYA 4IORA 4MENA 4YY4A 5CQ4A 4YYHA 2R0SA 2R0VA 4XY9A 2DVVA 4YYGA 4LC2A 4NR8A 4MEQA 5I83A 4LYIA 5CUDA 3D7CA 4Z1SA 5II2A 5D3LA 2YW5A 4IR5A 4KV4A 5CQAA 4FLPA 5KTUA 4QSUA 4N4IA 4TU6A 4A9EA 4UIUA 5L99A 5DKHA 5A82A 4HXPA 5CRZA 2RI7A 4QBMA 4CFLA 2RNXA 5HJCA 1X0JA 5DX4A 5HQ7A 5AD3A 4QEVA 4GPJA 1EQFA 5CS8A 5H1VA 4ALGA 4BW2A 4PKLA 5EPSA 5LUUA 4IOQA 4QEUA 3FKMX 5F5ZA 4UYGA 4OGIA 4LDFA 3MB3A 3JVKA 3QZVA 4O75A 3MUKA 4QZSA 5ETBA 1JSPB 5HELA 4WIVA 5HQ5A 2OO1A 4UIWA 1F68A 5HM0A 4E96A 2DVSA 5D3JA 5HEMA 4TU4A 4QSVA 4QYLA 5L96A 5IGMA 4PCIA 2E3KA 2RNYA 4CUSA 4CLBA 2D82A 5COIA 5H1UA 5TB6A 5LKXA 5HCLA 5F62A 1N72A 5CPEA 5LJ0A 5TCMA 4CUPA 4UITA 3O37A 5HFQA 4QC1A 5D25A 4QB3A 5A5QA 5DW2A 4YBMA 5CP5A 4NQMA 4TTEA 5CU8A 5ENJA 5A5NA 5D3SA 5A5SA 4N4FA 5I29A 3P5OA 5F25A 4LZ2A 5EK9A 5DBMA 5I86A 4QEWA 5HRWA 3MQMA 5LJ2A 4Z6HA 4NYVA 4TT4A 4QSQA 5FG4A 5JWMA 4A9JA 4F3IA 5DLXA 3U5NA 5F1HA 4NUDA 5LKTA 5JI8A 4YBTA 5EISA 5KHMA 3S91A 4YH3A 3IU6A 5H1TA 3U5PA 4UYHA 5D24A 5C87A 5FH6A 5FE5A 4O7CA 5DFBA 4YK0A 4UIYA 2G4AA 5AMEA 4NRAA 3O36A 4YADA 3U5MA 4O7FA 3O35A 4HXOA 4LYWA 5E74A 5CQ6A 5A5OA 4YYNA 1ZS5A 3JVLA 2RNWA 2NXBA 5D3RA 5CY9A 4A9FA 5CUAA 2DWWA 4YH4A 4CUQA 3QZSA 5EV9A 5I88A 5CTLA 5EICA 5FFYA 3U5KA 4PY6A 4O77A 3UVDA 5E7DA 5FE4A 2OSSA 5FG5A 5ENFA 2L5EA 4QSTA 4QR5A 3RCWA 5FG6A 3I3JA 4QSPA 3HMFA 5LKZA 4NR9A 5F60A 5DYUA 4A9IA 3P1CA 5IGKA 3LQIA 4O76A 2DVQA 3MXFA 2N9GA 4N4GA 3SVFA 5CUCA 4WHWA 4UIXA 5L97A 4J0RA 5C4QA 4TS8A 2I7KA 4HBXA 4YATA 3O33A 5DKCA 5F61A 4N3WA 5HRXA 5CZGA 5FE3A 4BJXA 5FE0A 5HENA 4TT2A 5BT5A 4MR3A 5EPRA 5FE9A 3QZTA 4NUCA 5LKUA 4NYXA 4HBVA 3JVJA 2YEMA 5D3TA 2KTBB 3U5JA 4C67A 4Z93A 4UYFA 3P1DA 5EP7A 4O7BA 2WP1A 4XYAA 4LZSA 4MEPA 5FH8A 2FSAA 5A85A 4NR7A 4YC9A 3DAIA 5I7XA 2E7OA 4YYDA 5CUGA 5II1A 4BHWA 2D9EA 4HBYA 5CQ7A 2YDWA 4PCEA 4IOOA 2OUOA 2YEKA 4KCXA 2R10A 4YBSA 5I80A 5DW1A 4UIVA 5DFDA 4QSSA 4J1PA 4YYKA 2MJVB 5E9VA 3Q2EA 5I89A 4A9NA 4YY6A 5CQ8A 4TQNA 5LVRA 1WUGA 4HBWA 4J0SA 5D3HA 4HXNA 4QYDA 5FH7A 5E73A 5ACYA 5CRMA 2RFJA 4MR4A 4IR3A 5CQ5A 5A7CA 4UYFB 5ENBA 4QUTA 1JM4B 3GG3A 5L98A 4UYDA 5FE1A 3UVXA 4O78A 5IG6A 4QC3A 4HXKA 5EWVA 4KV1A 4LYSA 4PS5A 5D26A 4HXLA 3ONIA 4ZW1A 3UVYA 5FFWA 3P1EA 3U5LA 3LJWA 3SVHA 4CL9A 4TT6A 5DYCA 3AQAA 4YYMA 3IU5A 5E9YA 4YYIA 4QSRA 4X2IA 1WUMA 5CUEA 5DYAA 5IIDA 4TZ2A 5HLSA 4Q0OA 5EWCA 4QR3A 2F6JA 4Y03A 4XY8A 5G4SA 4CURA 4NYWA 4RVRA 4NR4A 2L84A 2E7NA 4O70A 3LQJA 5DKDA 4CFKA 5CQ3A 2DKWA 5FB0A 4LZRA 5E9MA 5EM3A 5IGLA 5H85A 4QSWA 5KU3A 4QR4A 4TZ8A 4N4HA 4XUBA 3SVGA 4UIZA 4A9MA 4YABA 5J0DA 5F36A 5HRVA 3TLPA 4NQNA 3K2JA 4MR6A 2L85A 4O71A 3P1FA 3G0JA 4NXJA 5C7NA 4NR5A 5F2PA 3AADA 5EWDA 3S92A 2YQDA 4XUAA 3UV5A 2I8NA 3Q2FA 5ENCA 5AD2A 5D3PA 5KTWA 3JVMA 4MEOA 5DY7A 4WHUA 4QY4A 5IGNA 5FE6A 4OGJA 5C89A 4ZC9A 5D3NA 5EVAA 4UYEA 5A83A 5LVQA 4HXSA 4YYJA 5LJ1A 5HFRA 5KO4A 4A9KA 5BT3A 5CFWA 4NRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUE A;  4DON A;  2WP2 A;  4NR6 A;  4BW4 A;  5ENE A;  4O72 A;  4NS5 A;  5EI4 A;  5A5R A;  5EQ1 A;  4BW1 A;  2H60 A;  5CQT A;  5E9K A;  5FB1 A;  4HXM A;  4Z1Q A;  5FE2 A;  2R0Y A;  5FE7 A;  3U5O A;  5G4R A;  5BT4 A;  3HMH A;  4TYL A;  5E9L A;  4AKN A;  3LXJ A;  5L8U A;  4PTB A;  5DFC A;  5E0R A;  2LSP B;  5CUB A;  5I7Y A;  5EPB A;  5E3D A;  5C8G A;  4OUF A;  3MB4 A;  5ETD A;  2YEL A;  5ENI A;  5D0C A;  5FDZ A;  5CGP A;  5K29 A;  2YYN A;  5FBX A;  5EA1 A;  5F3A A;  4Q0N A;  5EGU A;  5A5P A;  4O7A A;  5F1L A;  5ENH A;  4LR6 A;  4ZQL A;  4IR6 A;  4Z6I A;  5EWW A;  3UV4 A;  3UW9 A;  5EWH A;  3O34 A;  5F63 A;  3HME A;  5IBN A;  4CUT A;  4IR4 A;  4QSX A;  3UV2 A;  5FE8 A;  5D7X A;  4MR5 A;  4QUU A;  3UVW A;  4O74 A;  5DYX A;  5C85 A;  3ZYU A;  5A81 A;  2F6N A;  5AMF A;  5EU1 A;  4J3I A;  4HXR A;  3NXB A;  3MUL A;  1E6I A;  5DLZ A;  4ALH A;  5E3G A;  5I1Q A;  5HQ6 A;  2DAT A;  4QNS A;  2GRC A;  3G0L A;  5FFV A;  4NRC A;  2RO1 A;  4A9L A;  4O7E A;  4BW3 A;  5L8T A;  5ENG A;  5E9I A;  2DVR A;  5I40 A;  4CUU A;  3LQH A;  2RS9 B;  4YAX A;  4A9H A;  4A9O A;  5KTX A;  4LRG A;  4C66 A;  3DWY A;  4IOR A;  4MEN A;  4YY4 A;  5CQ4 A;  4YYH A;  2R0S A;  2R0V A;  4XY9 A;  2DVV A;  4YYG A;  4LC2 A;  4NR8 A;  4MEQ A;  5I83 A;  4LYI A;  5CUD A;  3D7C A;  4Z1S A;  5II2 A;  5D3L A;  2YW5 A;  4IR5 A;  4KV4 A;  5CQA A;  4FLP A;  5KTU A;  4QSU A;  4N4I A;  4TU6 A;  4A9E A;  4UIU A;  5L99 A;  5DKH A;  5A82 A;  4HXP A;  5CRZ A;  2RI7 A;  4QBM A;  4CFL A;  2RNX A;  5HJC A;  1X0J A;  5DX4 A;  5HQ7 A;  5AD3 A;  4QEV A;  4GPJ A;  1EQF A;  5CS8 A;  5H1V A;  4ALG A;  4BW2 A;  4PKL A;  5EPS A;  5LUU A;  4IOQ A;  4QEU A;  3FKM X;  5F5Z A;  4UYG A;  4OGI A;  4LDF A;  3MB3 A;  3JVK A;  3QZV A;  4O75 A;  3MUK A;  4QZS A;  5ETB A;  1JSP B;  5HEL A;  4WIV A;  5HQ5 A;  2OO1 A;  4UIW A;  1F68 A;  5HM0 A;  4E96 A;  2DVS A;  5D3J A;  5HEM A;  4TU4 A;  4QSV A;  4QYL A;  5L96 A;  5IGM A;  4PCI A;  2E3K A;  2RNY A;  4CUS A;  4CLB A;  2D82 A;  5COI A;  5H1U A;  5TB6 A;  5LKX A;  5HCL A;  5F62 A;  1N72 A;  5CPE A;  5LJ0 A;  5TCM A;  4CUP A;  4UIT A;  3O37 A;  5HFQ A;  4QC1 A;  5D25 A;  4QB3 A;  5A5Q A;  5DW2 A;  4YBM A;  5CP5 A;  4NQM A;  4TTE A;  5CU8 A;  5ENJ A;  5A5N A;  5D3S A;  5A5S A;  4N4F A;  5I29 A;  3P5O A;  5F25 A;  4LZ2 A;  5EK9 A;  5DBM A;  5I86 A;  4QEW A;  5HRW A;  3MQM A;  5LJ2 A;  4Z6H A;  4NYV A;  4TT4 A;  4QSQ A;  5FG4 A;  5JWM A;  4A9J A;  4F3I A;  5DLX A;  3U5N A;  5F1H A;  4NUD A;  5LKT A;  5JI8 A;  4YBT A;  5EIS A;  5KHM A;  3S91 A;  4YH3 A;  3IU6 A;  5H1T A;  3U5P A;  4UYH A;  5D24 A;  5C87 A;  5FH6 A;  5FE5 A;  4O7C A;  5DFB A;  4YK0 A;  4UIY A;  2G4A A;  5AME A;  4NRA A;  3O36 A;  4YAD A;  3U5M A;  4O7F A;  3O35 A;  4HXO A;  4LYW A;  5E74 A;  5CQ6 A;  5A5O A;  4YYN A;  1ZS5 A;  3JVL A;  2RNW A;  2NXB A;  5D3R A;  5CY9 A;  4A9F A;  5CUA A;  2DWW A;  4YH4 A;  4CUQ A;  3QZS A;  5EV9 A;  5I88 A;  5CTL A;  5EIC A;  5FFY A;  3U5K A;  4PY6 A;  4O77 A;  3UVD A;  5E7D A;  5FE4 A;  2OSS A;  5FG5 A;  5ENF A;  2L5E A;  4QST A;  4QR5 A;  3RCW A;  5FG6 A;  3I3J A;  4QSP A;  3HMF A;  5LKZ A;  4NR9 A;  5F60 A;  5DYU A;  4A9I A;  3P1C A;  5IGK A;  3LQI A;  4O76 A;  2DVQ A;  3MXF A;  2N9G A;  4N4G A;  3SVF A;  5CUC A;  4WHW A;  4UIX A;  5L97 A;  4J0R A;  5C4Q A;  4TS8 A;  2I7K A;  4HBX A;  4YAT A;  3O33 A;  5DKC A;  5F61 A;  4N3W A;  5HRX A;  5CZG A;  5FE3 A;  4BJX A;  5FE0 A;  5HEN A;  4TT2 A;  5BT5 A;  4MR3 A;  5EPR A;  5FE9 A;  3QZT A;  4NUC A;  5LKU A;  4NYX A;  4HBV A;  3JVJ A;  2YEM A;  5D3T A;  2KTB B;  3U5J A;  4C67 A;  4Z93 A;  4UYF A;  3P1D A;  5EP7 A;  4O7B A;  2WP1 A;  4XYA A;  4LZS A;  4MEP A;  5FH8 A;  2FSA A;  5A85 A;  4NR7 A;  4YC9 A;  3DAI A;  5I7X A;  2E7O A;  4YYD A;  5CUG A;  5II1 A;  4BHW A;  2D9E A;  4HBY A;  5CQ7 A;  2YDW A;  4PCE A;  4IOO A;  2OUO A;  2YEK A;  4KCX A;  2R10 A;  4YBS A;  5I80 A;  5DW1 A;  4UIV A;  5DFD A;  4QSS A;  4J1P A;  4YYK A;  2MJV B;  5E9V A;  3Q2E A;  5I89 A;  4A9N A;  4YY6 A;  5CQ8 A;  4TQN A;  5LVR A;  1WUG A;  4HBW A;  4J0S A;  5D3H A;  4HXN A;  4QYD A;  5FH7 A;  5E73 A;  5ACY A;  5CRM A;  2RFJ A;  4MR4 A;  4IR3 A;  5CQ5 A;  5A7C A;  4UYF B;  5ENB A;  4QUT A;  1JM4 B;  3GG3 A;  5L98 A;  4UYD A;  5FE1 A;  3UVX A;  4O78 A;  5IG6 A;  4QC3 A;  4HXK A;  5EWV A;  4KV1 A;  4LYS A;  4PS5 A;  5D26 A;  4HXL A;  3ONI A;  4ZW1 A;  3UVY A;  5FFW A;  3P1E A;  3U5L A;  3LJW A;  3SVH A;  4CL9 A;  4TT6 A;  5DYC A;  3AQA A;  4YYM A;  3IU5 A;  5E9Y A;  4YYI A;  4QSR A;  4X2I A;  1WUM A;  5CUE A;  5DYA A;  5IID A;  4TZ2 A;  5HLS A;  4Q0O A;  5EWC A;  4QR3 A;  2F6J A;  4Y03 A;  4XY8 A;  5G4S A;  4CUR A;  4NYW A;  4RVR A;  4NR4 A;  2L84 A;  2E7N A;  4O70 A;  3LQJ A;  5DKD A;  4CFK A;  5CQ3 A;  2DKW A;  5FB0 A;  4LZR A;  5E9M A;  5EM3 A;  5IGL A;  5H85 A;  4QSW A;  5KU3 A;  4QR4 A;  4TZ8 A;  4N4H A;  4XUB A;  3SVG A;  4UIZ A;  4A9M A;  4YAB A;  5J0D A;  5F36 A;  5HRV A;  3TLP A;  4NQN A;  3K2J A;  4MR6 A;  2L85 A;  4O71 A;  3P1F A;  3G0J A;  4NXJ A;  5C7N A;  4NR5 A;  5F2P A;  3AAD A;  5EWD A;  3S92 A;  2YQD A;  4XUA A;  3UV5 A;  2I8N A;  3Q2F A;  5ENC A;  5AD2 A;  5D3P A;  5KTW A;  3JVM A;  4MEO A;  5DY7 A;  4WHU A;  4QY4 A;  5IGN A;  5FE6 A;  4OGJ A;  5C89 A;  4ZC9 A;  5D3N A;  5EVA A;  4UYE A;  5A83 A;  5LVQ A;  4HXS A;  4YYJ A;  5LJ1 A;  5HFR A;  5KO4 A;  4A9K A;  5BT3 A;  5CFW A;  4NRB A; 
#chains in the Genus database with same CATH topology
 4NUE A;  3VKH A;  4DON A;  2WP2 A;  4NR6 A;  4BW4 A;  5ENE A;  4O72 A;  3VKG A;  4NS5 A;  5EI4 A;  5A5R A;  5EQ1 A;  4BW1 A;  2H60 A;  5CQT A;  5E9K A;  5FB1 A;  4HXM A;  4Z1Q A;  5FE2 A;  2R0Y A;  5FE7 A;  3U5O A;  5G4R A;  5BT4 A;  3HMH A;  4TYL A;  5E9L A;  4AKN A;  3LXJ A;  5L8U A;  4PTB A;  5DFC A;  5E0R A;  2LSP B;  5CUB A;  5I7Y A;  5EPB A;  5E3D A;  5C8G A;  4OUF A;  3MB4 A;  5ETD A;  2YEL A;  5ENI A;  5D0C A;  5FDZ A;  5CGP A;  5K29 A;  2YYN A;  5FBX A;  5EA1 A;  5F3A A;  4Q0N A;  5EGU A;  5A5P A;  4O7A A;  5F1L A;  5ENH A;  4LR6 A;  4ZQL A;  4IR6 A;  4Z6I A;  5EWW A;  3UV4 A;  3UW9 A;  5EWH A;  3O34 A;  5F63 A;  3HME A;  5IBN A;  4CUT A;  4IR4 A;  4QSX A;  3UV2 A;  5FE8 A;  5D7X A;  4MR5 A;  4QUU A;  3UVW A;  4O74 A;  5DYX A;  5C85 A;  3ZYU A;  5A81 A;  2F6N A;  5AMF A;  5EU1 A;  4J3I A;  4HXR A;  3NXB A;  3MUL A;  1E6I A;  5DLZ A;  4ALH A;  5E3G A;  5I1Q A;  5HQ6 A;  2DAT A;  4QNS A;  2GRC A;  3G0L A;  5FFV A;  4NRC A;  2RO1 A;  4A9L A;  4AKH A;  4O7E A;  4BW3 A;  5L8T A;  5ENG A;  5E9I A;  2DVR A;  5I40 A;  4CUU A;  3LQH A;  2RS9 B;  4YAX A;  4A9H A;  4A9O A;  5KTX A;  4LRG A;  4C66 A;  3DWY A;  4IOR A;  4MEN A;  4YY4 A;  5CQ4 A;  4YYH A;  2R0S A;  2R0V A;  4XY9 A;  2DVV A;  4YYG A;  4LC2 A;  4NR8 A;  4MEQ A;  5I83 A;  4LYI A;  5CUD A;  3D7C A;  4Z1S A;  5II2 A;  5D3L A;  2YW5 A;  4IR5 A;  4KV4 A;  5CQA A;  4FLP A;  5KTU A;  4QSU A;  4N4I A;  4TU6 A;  4A9E A;  4UIU A;  5L99 A;  5DKH A;  5A82 A;  4HXP A;  5CRZ A;  2RI7 A;  4QBM A;  4CFL A;  2RNX A;  5HJC A;  1X0J A;  5DX4 A;  5HQ7 A;  5AD3 A;  4QEV A;  4GPJ A;  1EQF A;  5CS8 A;  5H1V A;  4ALG A;  4BW2 A;  4PKL A;  5EPS A;  5LUU A;  4IOQ A;  4QEU A;  3FKM X;  5F5Z A;  4UYG A;  4OGI A;  4LDF A;  3MB3 A;  3JVK A;  3QZV A;  4O75 A;  3MUK A;  4QZS A;  5ETB A;  1JSP B;  4AI6 A;  5HEL A;  4WIV A;  5HQ5 A;  2OO1 A;  4UIW A;  1F68 A;  5HM0 A;  4E96 A;  2DVS A;  5D3J A;  5HEM A;  4TU4 A;  4QSV A;  4QYL A;  5L96 A;  5IGM A;  4PCI A;  2E3K A;  2RNY A;  4CUS A;  4CLB A;  2D82 A;  5COI A;  5H1U A;  5TB6 A;  5LKX A;  5HCL A;  5F62 A;  1N72 A;  5CPE A;  5LJ0 A;  5TCM A;  4CUP A;  4UIT A;  3O37 A;  5HFQ A;  4QC1 A;  5D25 A;  4QB3 A;  5A5Q A;  5DW2 A;  4YBM A;  2EJN A;  5CP5 A;  4NQM A;  4TTE A;  5CU8 A;  5ENJ A;  5A5N A;  5D3S A;  5A5S A;  4N4F A;  5I29 A;  3P5O A;  5F25 A;  4LZ2 A;  5EK9 A;  5DBM A;  5I86 A;  4QEW A;  5HRW A;  3MQM A;  5LJ2 A;  4Z6H A;  4NYV A;  4TT4 A;  4QSQ A;  5FG4 A;  5JWM A;  4A9J A;  4F3I A;  1ZKR A;  5DLX A;  3U5N A;  5F1H A;  4NUD A;  5LKT A;  5JI8 A;  4YBT A;  5EIS A;  5KHM A;  3S91 A;  4YH3 A;  3IU6 A;  3D1D A;  5H1T A;  3U5P A;  4UYH A;  5D24 A;  5C87 A;  5FH6 A;  5FE5 A;  4O7C A;  5DFB A;  4YK0 A;  4UIY A;  2G4A A;  5AME A;  4NRA A;  3O36 A;  4YAD A;  3U5M A;  4O7F A;  3O35 A;  4HXO A;  4LYW A;  5E74 A;  5CQ6 A;  5A5O A;  4YYN A;  1ZS5 A;  3JVL A;  2RNW A;  2NXB A;  5D3R A;  5CY9 A;  4A9F A;  5CUA A;  2DWW A;  4YH4 A;  4CUQ A;  3QZS A;  5EV9 A;  5I88 A;  5CTL A;  5EIC A;  5FFY A;  3U5K A;  4PY6 A;  4O77 A;  3UVD A;  5E7D A;  5FE4 A;  2OSS A;  5FG5 A;  5ENF A;  2L5E A;  4QST A;  4QR5 A;  3RCW A;  5FG6 A;  3I3J A;  4QSP A;  3HMF A;  5LKZ A;  4NR9 A;  5F60 A;  5DYU A;  4A9I A;  3P1C A;  5IGK A;  3LQI A;  4O76 A;  2DVQ A;  3MXF A;  2N9G A;  4N4G A;  3SVF A;  5CUC A;  4WHW A;  4UIX A;  5L97 A;  4J0R A;  5C4Q A;  4TS8 A;  2I7K A;  4HBX A;  4YAT A;  3O33 A;  5DKC A;  5F61 A;  4N3W A;  5HRX A;  5CZG A;  5FE3 A;  4BJX A;  5FE0 A;  5HEN A;  4TT2 A;  5BT5 A;  4MR3 A;  5EPR A;  5FE9 A;  3QZT A;  4NUC A;  5LKU A;  4NYX A;  4HBV A;  3JVJ A;  2YEM A;  5D3T A;  2KTB B;  3U5J A;  4C67 A;  4Z93 A;  4UYF A;  3P1D A;  5EP7 A;  4O7B A;  2WP1 A;  4XYA A;  4LZS A;  4MEP A;  5FH8 A;  2FSA A;  5A85 A;  4NR7 A;  4YC9 A;  3DAI A;  5I7X A;  2E7O A;  3ERR A;  4YYD A;  5CUG A;  5II1 A;  4BHW A;  2D9E A;  4HBY A;  5CQ7 A;  2YDW A;  4PCE A;  4IOO A;  2OUO A;  2YEK A;  4KCX A;  2R10 A;  4YBS A;  3D1B A;  5I80 A;  5DW1 A;  4UIV A;  5DFD A;  4QSS A;  4J1P A;  4YYK A;  2MJV B;  5E9V A;  3Q2E A;  5I89 A;  4A9N A;  4YY6 A;  5CQ8 A;  4TQN A;  5LVR A;  1WUG A;  4HBW A;  4J0S A;  5D3H A;  4HXN A;  4QYD A;  5FH7 A;  5E73 A;  5ACY A;  5CRM A;  2RFJ A;  4MR4 A;  4IR3 A;  5CQ5 A;  5A7C A;  4UYF B;  5ENB A;  4QUT A;  1JM4 B;  3GG3 A;  5L98 A;  4UYD A;  5FE1 A;  3UVX A;  4O78 A;  5IG6 A;  4QC3 A;  4HXK A;  5EWV A;  4KV1 A;  4LYS A;  4PS5 A;  5D26 A;  4HXL A;  3ONI A;  4ZW1 A;  3UVY A;  5FFW A;  3P1E A;  3U5L A;  3LJW A;  3SVH A;  4CL9 A;  4TT6 A;  5DYC A;  3AQA A;  4YYM A;  3IU5 A;  5E9Y A;  4YYI A;  4QSR A;  4X2I A;  1WUM A;  5CUE A;  5DYA A;  5IID A;  4TZ2 A;  5HLS A;  4Q0O A;  5EWC A;  4QR3 A;  4AKG A;  2F6J A;  4Y03 A;  4XY8 A;  1PUO A;  5G4S A;  4CUR A;  4NYW A;  4RVR A;  4NR4 A;  2L84 A;  2E7N A;  4O70 A;  3LQJ A;  5DKD A;  4CFK A;  5CQ3 A;  2DKW A;  5FB0 A;  4LZR A;  5E9M A;  5EM3 A;  5IGL A;  5H85 A;  4QSW A;  5KU3 A;  4QR4 A;  4TZ8 A;  4N4H A;  4XUB A;  3SVG A;  4UIZ A;  4A9M A;  4YAB A;  5J0D A;  5F36 A;  5HRV A;  3TLP A;  4NQN A;  3K2J A;  4MR6 A;  2L85 A;  4O71 A;  3P1F A;  3G0J A;  4NXJ A;  5C7N A;  4NR5 A;  5F2P A;  3AAD A;  5EWD A;  3S92 A;  2YQD A;  4XUA A;  3UV5 A;  2I8N A;  3Q2F A;  5ENC A;  5AD2 A;  5D3P A;  5KTW A;  3JVM A;  4MEO A;  5DY7 A;  4WHU A;  4QY4 A;  5IGN A;  5FE6 A;  4OGJ A;  5C89 A;  4AKI A;  4ZC9 A;  5D3N A;  5EVA A;  4UYE A;  5A83 A;  5LVQ A;  4HXS A;  4YYJ A;  5LJ1 A;  5HFR A;  5KO4 A;  4A9K A;  5BT3 A;  5CFW A;  4NRB A; 
#chains in the Genus database with same CATH homology
 4NUE A;  4DON A;  2WP2 A;  4NR6 A;  4BW4 A;  5ENE A;  4O72 A;  4NS5 A;  5EI4 A;  5A5R A;  5EQ1 A;  4BW1 A;  2H60 A;  5CQT A;  5E9K A;  5FB1 A;  4HXM A;  4Z1Q A;  5FE2 A;  2R0Y A;  5FE7 A;  3U5O A;  5G4R A;  5BT4 A;  3HMH A;  4TYL A;  5E9L A;  4AKN A;  3LXJ A;  5L8U A;  4PTB A;  5DFC A;  5E0R A;  2LSP B;  5CUB A;  5I7Y A;  5EPB A;  5E3D A;  5C8G A;  4OUF A;  3MB4 A;  5ETD A;  2YEL A;  5ENI A;  5D0C A;  5FDZ A;  5CGP A;  5K29 A;  2YYN A;  5FBX A;  5EA1 A;  5F3A A;  4Q0N A;  5EGU A;  5A5P A;  4O7A A;  5F1L A;  5ENH A;  4LR6 A;  4ZQL A;  4IR6 A;  4Z6I A;  5EWW A;  3UV4 A;  3UW9 A;  5EWH A;  3O34 A;  5F63 A;  3HME A;  5IBN A;  4CUT A;  4IR4 A;  4QSX A;  3UV2 A;  5FE8 A;  5D7X A;  4MR5 A;  4QUU A;  3UVW A;  4O74 A;  5DYX A;  5C85 A;  3ZYU A;  5A81 A;  2F6N A;  5AMF A;  5EU1 A;  4J3I A;  4HXR A;  3NXB A;  3MUL A;  1E6I A;  5DLZ A;  4ALH A;  5E3G A;  5I1Q A;  5HQ6 A;  2DAT A;  4QNS A;  2GRC A;  3G0L A;  5FFV A;  4NRC A;  2RO1 A;  4A9L A;  4O7E A;  4BW3 A;  5L8T A;  5ENG A;  5E9I A;  2DVR A;  5I40 A;  4CUU A;  3LQH A;  2RS9 B;  4YAX A;  4A9H A;  4A9O A;  5KTX A;  4LRG A;  4C66 A;  3DWY A;  4IOR A;  4MEN A;  4YY4 A;  5CQ4 A;  4YYH A;  2R0S A;  2R0V A;  4XY9 A;  2DVV A;  4YYG A;  4LC2 A;  4NR8 A;  4MEQ A;  5I83 A;  4LYI A;  5CUD A;  3D7C A;  4Z1S A;  5II2 A;  5D3L A;  2YW5 A;  4IR5 A;  4KV4 A;  5CQA A;  4FLP A;  5KTU A;  4QSU A;  4N4I A;  4TU6 A;  4A9E A;  4UIU A;  5L99 A;  5DKH A;  5A82 A;  4HXP A;  5CRZ A;  2RI7 A;  4QBM A;  4CFL A;  2RNX A;  5HJC A;  1X0J A;  5DX4 A;  5HQ7 A;  5AD3 A;  4QEV A;  4GPJ A;  1EQF A;  5CS8 A;  5H1V A;  4ALG A;  4BW2 A;  4PKL A;  5EPS A;  5LUU A;  4IOQ A;  4QEU A;  3FKM X;  5F5Z A;  4UYG A;  4OGI A;  4LDF A;  3MB3 A;  3JVK A;  3QZV A;  4O75 A;  3MUK A;  4QZS A;  5ETB A;  1JSP B;  5HEL A;  4WIV A;  5HQ5 A;  2OO1 A;  4UIW A;  1F68 A;  5HM0 A;  4E96 A;  2DVS A;  5D3J A;  5HEM A;  4TU4 A;  4QSV A;  4QYL A;  5L96 A;  5IGM A;  4PCI A;  2E3K A;  2RNY A;  4CUS A;  4CLB A;  2D82 A;  5COI A;  5H1U A;  5TB6 A;  5LKX A;  5HCL A;  5F62 A;  1N72 A;  5CPE A;  5LJ0 A;  5TCM A;  4CUP A;  4UIT A;  3O37 A;  5HFQ A;  4QC1 A;  5D25 A;  4QB3 A;  5A5Q A;  5DW2 A;  4YBM A;  5CP5 A;  4NQM A;  4TTE A;  5CU8 A;  5ENJ A;  5A5N A;  5D3S A;  5A5S A;  4N4F A;  5I29 A;  3P5O A;  5F25 A;  4LZ2 A;  5EK9 A;  5DBM A;  5I86 A;  4QEW A;  5HRW A;  3MQM A;  5LJ2 A;  4Z6H A;  4NYV A;  4TT4 A;  4QSQ A;  5FG4 A;  5JWM A;  4A9J A;  4F3I A;  5DLX A;  3U5N A;  5F1H A;  4NUD A;  5LKT A;  5JI8 A;  4YBT A;  5EIS A;  5KHM A;  3S91 A;  4YH3 A;  3IU6 A;  5H1T A;  3U5P A;  4UYH A;  5D24 A;  5C87 A;  5FH6 A;  5FE5 A;  4O7C A;  5DFB A;  4YK0 A;  4UIY A;  2G4A A;  5AME A;  4NRA A;  3O36 A;  4YAD A;  3U5M A;  4O7F A;  3O35 A;  4HXO A;  4LYW A;  5E74 A;  5CQ6 A;  5A5O A;  4YYN A;  1ZS5 A;  3JVL A;  2RNW A;  2NXB A;  5D3R A;  5CY9 A;  4A9F A;  5CUA A;  2DWW A;  4YH4 A;  4CUQ A;  3QZS A;  5EV9 A;  5I88 A;  5CTL A;  5EIC A;  5FFY A;  3U5K A;  4PY6 A;  4O77 A;  3UVD A;  5E7D A;  5FE4 A;  2OSS A;  5FG5 A;  5ENF A;  2L5E A;  4QST A;  4QR5 A;  3RCW A;  5FG6 A;  3I3J A;  4QSP A;  3HMF A;  5LKZ A;  4NR9 A;  5F60 A;  5DYU A;  4A9I A;  3P1C A;  5IGK A;  3LQI A;  4O76 A;  2DVQ A;  3MXF A;  2N9G A;  4N4G A;  3SVF A;  5CUC A;  4WHW A;  4UIX A;  5L97 A;  4J0R A;  5C4Q A;  4TS8 A;  2I7K A;  4HBX A;  4YAT A;  3O33 A;  5DKC A;  5F61 A;  4N3W A;  5HRX A;  5CZG A;  5FE3 A;  4BJX A;  5FE0 A;  5HEN A;  4TT2 A;  5BT5 A;  4MR3 A;  5EPR A;  5FE9 A;  3QZT A;  4NUC A;  5LKU A;  4NYX A;  4HBV A;  3JVJ A;  2YEM A;  5D3T A;  2KTB B;  3U5J A;  4C67 A;  4Z93 A;  4UYF A;  3P1D A;  5EP7 A;  4O7B A;  2WP1 A;  4XYA A;  4LZS A;  4MEP A;  5FH8 A;  2FSA A;  5A85 A;  4NR7 A;  4YC9 A;  3DAI A;  5I7X A;  2E7O A;  4YYD A;  5CUG A;  5II1 A;  4BHW A;  2D9E A;  4HBY A;  5CQ7 A;  2YDW A;  4PCE A;  4IOO A;  2OUO A;  2YEK A;  4KCX A;  2R10 A;  4YBS A;  5I80 A;  5DW1 A;  4UIV A;  5DFD A;  4QSS A;  4J1P A;  4YYK A;  2MJV B;  5E9V A;  3Q2E A;  5I89 A;  4A9N A;  4YY6 A;  5CQ8 A;  4TQN A;  5LVR A;  1WUG A;  4HBW A;  4J0S A;  5D3H A;  4HXN A;  4QYD A;  5FH7 A;  5E73 A;  5ACY A;  5CRM A;  2RFJ A;  4MR4 A;  4IR3 A;  5CQ5 A;  5A7C A;  4UYF B;  5ENB A;  4QUT A;  1JM4 B;  3GG3 A;  5L98 A;  4UYD A;  5FE1 A;  3UVX A;  4O78 A;  5IG6 A;  4QC3 A;  4HXK A;  5EWV A;  4KV1 A;  4LYS A;  4PS5 A;  5D26 A;  4HXL A;  3ONI A;  4ZW1 A;  3UVY A;  5FFW A;  3P1E A;  3U5L A;  3LJW A;  3SVH A;  4CL9 A;  4TT6 A;  5DYC A;  3AQA A;  4YYM A;  3IU5 A;  5E9Y A;  4YYI A;  4QSR A;  4X2I A;  1WUM A;  5CUE A;  5DYA A;  5IID A;  4TZ2 A;  5HLS A;  4Q0O A;  5EWC A;  4QR3 A;  2F6J A;  4Y03 A;  4XY8 A;  5G4S A;  4CUR A;  4NYW A;  4RVR A;  4NR4 A;  2L84 A;  2E7N A;  4O70 A;  3LQJ A;  5DKD A;  4CFK A;  5CQ3 A;  2DKW A;  5FB0 A;  4LZR A;  5E9M A;  5EM3 A;  5IGL A;  5H85 A;  4QSW A;  5KU3 A;  4QR4 A;  4TZ8 A;  4N4H A;  4XUB A;  3SVG A;  4UIZ A;  4A9M A;  4YAB A;  5J0D A;  5F36 A;  5HRV A;  3TLP A;  4NQN A;  3K2J A;  4MR6 A;  2L85 A;  4O71 A;  3P1F A;  3G0J A;  4NXJ A;  5C7N A;  4NR5 A;  5F2P A;  3AAD A;  5EWD A;  3S92 A;  2YQD A;  4XUA A;  3UV5 A;  2I8N A;  3Q2F A;  5ENC A;  5AD2 A;  5D3P A;  5KTW A;  3JVM A;  4MEO A;  5DY7 A;  4WHU A;  4QY4 A;  5IGN A;  5FE6 A;  4OGJ A;  5C89 A;  4ZC9 A;  5D3N A;  5EVA A;  4UYE A;  5A83 A;  5LVQ A;  4HXS A;  4YYJ A;  5LJ1 A;  5HFR A;  5KO4 A;  4A9K A;  5BT3 A;  5CFW A;  4NRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...