5C85A

Crystal structure of the human brpf1 bromodomain in complex with seed1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5c85A00
4UYHA 5C7NA 2MJVB 3AADA 5ENIA 3UVWA 3Q2EA 5CQ5A 4YYNA 2YW5A 5BT4A 5HM0A 4UYEA 5CQTA 4LZRA 3UV5A 4YBSA 2DKWA 2RFJA 4QBMA 5I7YA 5FH7A 4QSSA 5KTXA 5F5ZA 4O71A 4NQMA 5E9MA 4ZW1A 5AD3A 4NUDA 5II2A 5EK9A 3UV2A 4J3IA 4YADA 5EWHA 3SVGA 4A9FA 2R10A 5E3DA 5DFCA 5CFWA 3JVMA 5JI8A 5H85A 3DWYA 2DVVA 4CFLA 4QUUA 4O7BA 4HBWA 4A9LA 3HMFA 4HXLA 5I86A 2YQDA 4QR3A 5DBMA 5A83A 3U5MA 4NUEA 5EISA 3U5OA 4QC3A 2G4AA 3DAIA 4QEWA 4QSUA 4YBTA 4C67A 4IR4A 4YC9A 3LJWA 4NR7A 4TTEA 5I29A 5F63A 3JVKA 5F2PA 5CUDA 3U5NA 4NYWA 4BJXA 4O70A 4A9NA 4Q0OA 4TS8A 5F1LA 3QZTA 5FE3A 4CL9A 4UYFA 5FG6A 4QSPA 4NR6A 4HBVA 5CUGA 4HXNA 5D26A 4UITA 3JVLA 5HELA 5EP7A 4UIUA 4LZ2A 2L84A 5F62A 3Q2FA 4Z1QA 5F60A 5A81A 5DX4A 4TT6A 4PTBA 5ENHA 5HEMA 5I7XA 4CUTA 5A5NA 4CUPA 3UVDA 4YBMA 4YYKA 3S92A 2YDWA 3IU5A 5EV9A 5KU3A 4A9HA 4YYMA 4Z93A 5IGLA 5EVAA 5I80A 2DVRA 4TYLA 4XUAA 4Z6HA 4CLBA 4LDFA 5D7XA 4N4IA 2E3KA 4LYSA 4YATA 5HFQA 3ZYUA 4QSRA 1EQFA 5AD2A 5KHMA 5FE1A 5CQ8A 3LQJA 5E9IA 5CUAA 5AMFA 4UYDA 3U5JA 5CUBA 5DLXA 5C87A 5FH6A 5DYAA 4HXOA 4BW2A 4PCIA 5LKTA 5FDZA 3U5PA 4QEVA 1JM4B 2I7KA 5E9KA 5E9VA 5LJ1A 5CGPA 5D0CA 5ACYA 5LJ0A 5FE6A 5LJ2A 3MB3A 5C85A 3TLPA 5F25A 1WUGA 3UVYA 3ONIA 4J0RA 5EICA 4AKNA 5G4SA 5F36A 5H1UA 5E74A 4KV1A 5AMEA 4XY8A 4QEUA 5FE5A 5DLZA 2I8NA 2NXBA 4IOOA 5I89A 4GPJA 4NRBA 4WIVA 5FE0A 4NXJA 5I1QA 5LUUA 5CPEA 4QNSA 3P1CA 2OO1A 4E96A 4O7AA 2YYNA 5A5RA 5IIDA 3G0JA 4UIVA 5LKUA 3FKMX 3P5OA 4IR6A 4LR6A 4MR5A 5FE8A 2RI7A 4YYIA 1JSPB 5ETDA 4UYGA 4WHWA 2LSPB 4HXRA 2GRCA 5DFBA 5EM3A 4CUSA 5L99A 5FFVA 5ENCA 5HENA 3U5KA 4XYAA 4NYVA 4YK0A 3O34A 4NRCA 4N4HA 3P1FA 2F6NA 2YELA 5D24A 1N72A 5HQ7A 5FE2A 5DYCA 3MXFA 5CY9A 5FFYA 4NYXA 5HQ5A 4A9MA 4BW1A 5EPSA 4QZSA 5C8GA 4HXSA 4DONA 5E73A 3SVFA 4Y03A 2R0YA 4YYGA 5BT3A 4A9JA 3O37A 5EA1A 5LVQA 5L96A 4TQNA 4YABA 5FFWA 4CFKA 4NS5A 4UIZA 5FG4A 4Q0NA 4N4FA 4IOQA 5D3TA 4NRAA 5IGKA 3JVJA 5CRMA 2YEMA 5JWMA 4TZ2A 4O72A 4O7FA 5ENEA 5FBXA 3GG3A 4O74A 4UIXA 5EI4A 4QYDA 5CZGA 3LQIA 4QB3A 5H1TA 4TT2A 5IGNA 4O78A 4YY4A 4XUBA 4C66A 5D25A 4A9IA 3D7CA 5E3GA 4TU6A 5L8TA 2WP2A 3RCWA 5DFDA 5F1HA 3LQHA 3MQMA 5EQ1A 4QSQA 4YH3A 5DKDA 5EPBA 5C4QA 3MUKA 4CUUA 2KTBB 5DKCA 4A9OA 5A5QA 5I83A 4MENA 5FE4A 4O75A 2RNXA 5L8UA 5CQ3A 5EWDA 4QSVA 4IORA 4CURA 4YYHA 5COIA 5A5SA 5ENGA 4O7CA 4OGJA 5FE9A 5HRWA 2OSSA 2OUOA 5G4RA 3O35A 5E7DA 4A9KA 5KTWA 4QSWA 4XY9A 4YYDA 5D3LA 5LVRA 2DVSA 5CP5A 4FLPA 5K29A 5ETBA 3MULA 5II1A 1E6IA 4MR4A 5TB6A 4QYLA 5F3AA 2F6JA 4PCEA 4O7EA 3MB4A 2WP1A 4Z1SA 4LYWA 4O76A 3P1DA 4QUTA 4PKLA 2D9EA 5DW2A 2E7OA 5EWWA 3QZVA 4O77A 5I88A 5D3RA 5FB1A 5CUEA 5KO4A 5F61A 5CTLA 4MEOA 4NR8A 5E9LA 4IR3A 4J1PA 3O33A 4WHUA 1F68A 4X2IA 5HRVA 5D3PA 1ZS5A 3UVXA 4LYIA 5FG5A 5KTUA 5IGMA 5HRXA 4UIYA 4F3IA 4TZ8A 4NUCA 4QR4A 2E7NA 4HXPA 2R0VA 3HMHA 5A82A 5A5PA 4PS5A 4MR6A 5E0RA 3K2JA 5E9YA 5A7CA 5CS8A 5CQAA 4N3WA 5BT5A 4HBXA 4YH4A 4HXKA 3UV4A 3S91A 4Z6IA 5A85A 5IG6A 5C89A 5LKXA 4NR9A 4QY4A 5ENFA 2D82A 2R0SA 5FH8A 2H60A 4NR4A 4NR5A 4MR3A 4LC2A 2RNYA 4HBYA 5CU8A 5L98A 5A5OA 2N9GA 5DW1A 4QC1A 2L85A 4MEQA 4KCXA 4ZQLA 4MEPA 3NXBA 4UYFB 5EPRA 4OUFA 5FE7A 1WUMA 2DVQA 5H1VA 5DYXA 4J0SA 4KV4A 4NQNA 4RVRA 4QSXA 2RO1A 5D3JA 3AQAA 5J0DA 5EGUA 5DY7A 5EU1A 5HJCA 5EWCA 5D3HA 2YEKA 3QZSA 5FB0A 5D3NA 5TCMA 5CQ7A 4CUQA 4YYJA 5DYUA 1X0JA 3G0LA 5L97A 3SVHA 4BW4A 2RNWA 5ENJA 3U5LA 2FSAA 5I40A 5CQ4A 4BW3A 4YAXA 4YY6A 5D3SA 4QR5A 4LZSA 5HQ6A 5CQ6A 4TU4A 4HXMA 5CUCA 4OGIA 3O36A 5IBNA 2L5EA 5CRZA 5HLSA 5DKHA 4TT4A 5EWVA 3HMEA 4QSTA 4A9EA 5HFRA 3UW9A 5ENBA 4ALGA 4ALHA 4UIWA 4IR5A 4LRGA 2RS9B 3P1EA 3I3JA 5LKZA 3IU6A 4ZC9A 4BHWA 3LXJA 4N4GA 2DWWA 2DATA 4PY6A 5HCLA
chains in the Genus database with same CATH superfamily
4UYHA 5C7NA 2MJVB 3AADA 5ENIA 3UVWA 3Q2EA 5CQ5A 4YYNA 2YW5A 5BT4A 5HM0A 4UYEA 5CQTA 4LZRA 3UV5A 4YBSA 2DKWA 2RFJA 4QBMA 5I7YA 5FH7A 4QSSA 5KTXA 5F5ZA 4O71A 4NQMA 5E9MA 4ZW1A 5AD3A 4NUDA 5II2A 5EK9A 3UV2A 4J3IA 4YADA 5EWHA 3SVGA 4A9FA 2R10A 5E3DA 5DFCA 5CFWA 3JVMA 5JI8A 5H85A 3DWYA 2DVVA 4CFLA 4QUUA 4O7BA 4HBWA 4A9LA 3HMFA 4HXLA 5I86A 2YQDA 4QR3A 5DBMA 5A83A 3U5MA 4NUEA 5EISA 3U5OA 4QC3A 2G4AA 3DAIA 4QEWA 4QSUA 4YBTA 4C67A 4IR4A 4YC9A 3LJWA 4NR7A 4TTEA 5I29A 5F63A 3JVKA 5F2PA 5CUDA 4AKIA 3U5NA 4NYWA 4BJXA 4O70A 4A9NA 4Q0OA 4TS8A 5F1LA 3QZTA 5FE3A 4CL9A 4UYFA 5FG6A 4QSPA 4NR6A 4HBVA 5CUGA 4HXNA 5D26A 4UITA 3JVLA 5HELA 5EP7A 4UIUA 4LZ2A 2L84A 5F62A 3Q2FA 4Z1QA 5F60A 5A81A 5DX4A 4TT6A 4PTBA 5ENHA 5HEMA 5I7XA 4CUTA 5A5NA 4CUPA 3UVDA 4YBMA 4YYKA 3S92A 2YDWA 3IU5A 5EV9A 5KU3A 4A9HA 4YYMA 4Z93A 5IGLA 5EVAA 5I80A 2DVRA 4TYLA 4XUAA 4Z6HA 4CLBA 4LDFA 5D7XA 4N4IA 2E3KA 4LYSA 4YATA 5HFQA 3ZYUA 4QSRA 1EQFA 5AD2A 5KHMA 5FE1A 5CQ8A 3LQJA 5E9IA 5CUAA 5AMFA 4UYDA 3U5JA 5CUBA 5DLXA 5C87A 5FH6A 5DYAA 4HXOA 4BW2A 4PCIA 1ZKRA 3VKGA 5LKTA 5FDZA 3U5PA 4QEVA 1JM4B 2I7KA 5E9KA 5E9VA 5LJ1A 5CGPA 5D0CA 5ACYA 5LJ0A 5FE6A 5LJ2A 3MB3A 5C85A 3TLPA 5F25A 1WUGA 3UVYA 3ONIA 4J0RA 5EICA 4AKNA 5G4SA 5F36A 5H1UA 5E74A 4KV1A 5AMEA 4XY8A 4QEUA 5FE5A 5DLZA 2I8NA 2NXBA 4IOOA 5I89A 4GPJA 4NRBA 4WIVA 5FE0A 4NXJA 5I1QA 5LUUA 5CPEA 4QNSA 3P1CA 2OO1A 4E96A 4O7AA 2YYNA 5A5RA 5IIDA 3G0JA 4UIVA 5LKUA 3FKMX 3P5OA 4IR6A 4LR6A 4MR5A 5FE8A 2RI7A 4YYIA 1JSPB 5ETDA 4UYGA 4WHWA 2LSPB 4HXRA 2GRCA 5DFBA 5EM3A 4CUSA 5L99A 5FFVA 5ENCA 5HENA 3U5KA 4XYAA 4NYVA 4YK0A 3O34A 4NRCA 4N4HA 3P1FA 2F6NA 2YELA 5D24A 1N72A 5HQ7A 5FE2A 5DYCA 3MXFA 5CY9A 5FFYA 4NYXA 5HQ5A 4A9MA 4BW1A 5EPSA 4QZSA 5C8GA 4HXSA 4DONA 5E73A 3SVFA 4Y03A 2R0YA 4YYGA 5BT3A 4A9JA 3O37A 5EA1A 5LVQA 5L96A 4TQNA 4YABA 5FFWA 4CFKA 4NS5A 4UIZA 5FG4A 4Q0NA 4N4FA 4IOQA 5D3TA 4NRAA 5IGKA 3JVJA 5CRMA 2YEMA 5JWMA 4TZ2A 4O72A 4O7FA 5ENEA 5FBXA 3GG3A 4O74A 1PUOA 4UIXA 5EI4A 4QYDA 5CZGA 3LQIA 4QB3A 5H1TA 4TT2A 5IGNA 4O78A 4YY4A 4XUBA 4C66A 5D25A 4A9IA 3D7CA 5E3GA 4TU6A 5L8TA 2WP2A 3RCWA 5DFDA 5F1HA 3LQHA 3MQMA 5EQ1A 4QSQA 4YH3A 5DKDA 4AKGA 5EPBA 5C4QA 3MUKA 4CUUA 2KTBB 5DKCA 4A9OA 5A5QA 5I83A 4MENA 5FE4A 4O75A 2RNXA 5L8UA 5CQ3A 5EWDA 4QSVA 4IORA 4CURA 4YYHA 5COIA 5A5SA 5ENGA 4O7CA 4OGJA 5FE9A 5HRWA 2OSSA 2OUOA 5G4RA 3O35A 5E7DA 4A9KA 5KTWA 3D1BA 4QSWA 4XY9A 4YYDA 5D3LA 5LVRA 2DVSA 5CP5A 4FLPA 5K29A 5ETBA 3MULA 5II1A 1E6IA 4MR4A 5TB6A 4QYLA 5F3AA 2F6JA 4PCEA 4O7EA 3MB4A 2WP1A 4Z1SA 4LYWA 4O76A 3P1DA 4QUTA 4PKLA 2D9EA 5DW2A 2E7OA 5EWWA 3QZVA 4O77A 5I88A 5D3RA 5FB1A 5CUEA 5KO4A 5F61A 5CTLA 4MEOA 4NR8A 5E9LA 4IR3A 4J1PA 3O33A 4WHUA 1F68A 4X2IA 5HRVA 5D3PA 1ZS5A 4AI6A 3UVXA 4LYIA 5FG5A 5KTUA 5IGMA 5HRXA 4UIYA 4F3IA 4TZ8A 4NUCA 4QR4A 2E7NA 4HXPA 2R0VA 3HMHA 5A82A 5A5PA 4PS5A 4MR6A 5E0RA 3K2JA 5E9YA 5A7CA 5CS8A 5CQAA 4N3WA 5BT5A 4HBXA 4YH4A 4HXKA 3UV4A 3S91A 4Z6IA 5A85A 5IG6A 5C89A 5LKXA 4NR9A 4QY4A 5ENFA 2D82A 2R0SA 5FH8A 2H60A 4NR4A 4NR5A 4MR3A 4LC2A 2RNYA 4HBYA 5CU8A 5L98A 5A5OA 2N9GA 5DW1A 4QC1A 2L85A 4MEQA 4KCXA 4ZQLA 4MEPA 3NXBA 4UYFB 5EPRA 4AKHA 4OUFA 5FE7A 3VKHA 1WUMA 2DVQA 5H1VA 5DYXA 4J0SA 4KV4A 4NQNA 4RVRA 4QSXA 3D1DA 2RO1A 5D3JA 3AQAA 5J0DA 5EGUA 5DY7A 5EU1A 5HJCA 5EWCA 5D3HA 2YEKA 3QZSA 5FB0A 5D3NA 5TCMA 5CQ7A 4CUQA 4YYJA 5DYUA 1X0JA 3G0LA 5L97A 3SVHA 4BW4A 2RNWA 5ENJA 3U5LA 2FSAA 5I40A 5CQ4A 4BW3A 4YAXA 4YY6A 5D3SA 4QR5A 4LZSA 5HQ6A 5CQ6A 4TU4A 4HXMA 5CUCA 4OGIA 3O36A 5IBNA 3ERRA 2L5EA 5CRZA 5HLSA 5DKHA 4TT4A 5EWVA 3HMEA 4QSTA 4A9EA 5HFRA 3UW9A 5ENBA 4ALGA 4ALHA 4UIWA 4IR5A 4LRGA 2RS9B 2EJNA 3P1EA 3I3JA 5LKZA 3IU6A 4ZC9A 4BHWA 3LXJA 4N4GA 2DWWA 2DATA 4PY6A 5HCLA
chains in the Genus database with same CATH topology
4UYHA 5C7NA 2MJVB 3AADA 5ENIA 3UVWA 3Q2EA 5CQ5A 4YYNA 2YW5A 5BT4A 5HM0A 4UYEA 5CQTA 4LZRA 3UV5A 4YBSA 2DKWA 2RFJA 4QBMA 5I7YA 5FH7A 4QSSA 5KTXA 5F5ZA 4O71A 4NQMA 5E9MA 4ZW1A 5AD3A 4NUDA 5II2A 5EK9A 3UV2A 4J3IA 4YADA 5EWHA 3SVGA 4A9FA 2R10A 5E3DA 5DFCA 5CFWA 3JVMA 5JI8A 5H85A 3DWYA 2DVVA 4CFLA 4QUUA 4O7BA 4HBWA 4A9LA 3HMFA 4HXLA 5I86A 2YQDA 4QR3A 5DBMA 5A83A 3U5MA 4NUEA 5EISA 3U5OA 4QC3A 2G4AA 3DAIA 4QEWA 4QSUA 4YBTA 4C67A 4IR4A 4YC9A 3LJWA 4NR7A 4TTEA 5I29A 5F63A 3JVKA 5F2PA 5CUDA 3U5NA 4NYWA 4BJXA 4O70A 4A9NA 4Q0OA 4TS8A 5F1LA 3QZTA 5FE3A 4CL9A 4UYFA 5FG6A 4QSPA 4NR6A 4HBVA 5CUGA 4HXNA 5D26A 4UITA 3JVLA 5HELA 5EP7A 4UIUA 4LZ2A 2L84A 5F62A 3Q2FA 4Z1QA 5F60A 5A81A 5DX4A 4TT6A 4PTBA 5ENHA 5HEMA 5I7XA 4CUTA 5A5NA 4CUPA 3UVDA 4YBMA 4YYKA 3S92A 2YDWA 3IU5A 5EV9A 5KU3A 4A9HA 4YYMA 4Z93A 5IGLA 5EVAA 5I80A 2DVRA 4TYLA 4XUAA 4Z6HA 4CLBA 4LDFA 5D7XA 4N4IA 2E3KA 4LYSA 4YATA 5HFQA 3ZYUA 4QSRA 1EQFA 5AD2A 5KHMA 5FE1A 5CQ8A 3LQJA 5E9IA 5CUAA 5AMFA 4UYDA 3U5JA 5CUBA 5DLXA 5C87A 5FH6A 5DYAA 4HXOA 4BW2A 4PCIA 5LKTA 5FDZA 3U5PA 4QEVA 1JM4B 2I7KA 5E9KA 5E9VA 5LJ1A 5CGPA 5D0CA 5ACYA 5LJ0A 5FE6A 5LJ2A 3MB3A 5C85A 3TLPA 5F25A 1WUGA 3UVYA 3ONIA 4J0RA 5EICA 4AKNA 5G4SA 5F36A 5H1UA 5E74A 4KV1A 5AMEA 4XY8A 4QEUA 5FE5A 5DLZA 2I8NA 2NXBA 4IOOA 5I89A 4GPJA 4NRBA 4WIVA 5FE0A 4NXJA 5I1QA 5LUUA 5CPEA 4QNSA 3P1CA 2OO1A 4E96A 4O7AA 2YYNA 5A5RA 5IIDA 3G0JA 4UIVA 5LKUA 3FKMX 3P5OA 4IR6A 4LR6A 4MR5A 5FE8A 2RI7A 4YYIA 1JSPB 5ETDA 4UYGA 4WHWA 2LSPB 4HXRA 2GRCA 5DFBA 5EM3A 4CUSA 5L99A 5FFVA 5ENCA 5HENA 3U5KA 4XYAA 4NYVA 4YK0A 3O34A 4NRCA 4N4HA 3P1FA 2F6NA 2YELA 5D24A 1N72A 5HQ7A 5FE2A 5DYCA 3MXFA 5CY9A 5FFYA 4NYXA 5HQ5A 4A9MA 4BW1A 5EPSA 4QZSA 5C8GA 4HXSA 4DONA 5E73A 3SVFA 4Y03A 2R0YA 4YYGA 5BT3A 4A9JA 3O37A 5EA1A 5LVQA 5L96A 4TQNA 4YABA 5FFWA 4CFKA 4NS5A 4UIZA 5FG4A 4Q0NA 4N4FA 4IOQA 5D3TA 4NRAA 5IGKA 3JVJA 5CRMA 2YEMA 5JWMA 4TZ2A 4O72A 4O7FA 5ENEA 5FBXA 3GG3A 4O74A 4UIXA 5EI4A 4QYDA 5CZGA 3LQIA 4QB3A 5H1TA 4TT2A 5IGNA 4O78A 4YY4A 4XUBA 4C66A 5D25A 4A9IA 3D7CA 5E3GA 4TU6A 5L8TA 2WP2A 3RCWA 5DFDA 5F1HA 3LQHA 3MQMA 5EQ1A 4QSQA 4YH3A 5DKDA 5EPBA 5C4QA 3MUKA 4CUUA 2KTBB 5DKCA 4A9OA 5A5QA 5I83A 4MENA 5FE4A 4O75A 2RNXA 5L8UA 5CQ3A 5EWDA 4QSVA 4IORA 4CURA 4YYHA 5COIA 5A5SA 5ENGA 4O7CA 4OGJA 5FE9A 5HRWA 2OSSA 2OUOA 5G4RA 3O35A 5E7DA 4A9KA 5KTWA 4QSWA 4XY9A 4YYDA 5D3LA 5LVRA 2DVSA 5CP5A 4FLPA 5K29A 5ETBA 3MULA 5II1A 1E6IA 4MR4A 5TB6A 4QYLA 5F3AA 2F6JA 4PCEA 4O7EA 3MB4A 2WP1A 4Z1SA 4LYWA 4O76A 3P1DA 4QUTA 4PKLA 2D9EA 5DW2A 2E7OA 5EWWA 3QZVA 4O77A 5I88A 5D3RA 5FB1A 5CUEA 5KO4A 5F61A 5CTLA 4MEOA 4NR8A 5E9LA 4IR3A 4J1PA 3O33A 4WHUA 1F68A 4X2IA 5HRVA 5D3PA 1ZS5A 3UVXA 4LYIA 5FG5A 5KTUA 5IGMA 5HRXA 4UIYA 4F3IA 4TZ8A 4NUCA 4QR4A 2E7NA 4HXPA 2R0VA 3HMHA 5A82A 5A5PA 4PS5A 4MR6A 5E0RA 3K2JA 5E9YA 5A7CA 5CS8A 5CQAA 4N3WA 5BT5A 4HBXA 4YH4A 4HXKA 3UV4A 3S91A 4Z6IA 5A85A 5IG6A 5C89A 5LKXA 4NR9A 4QY4A 5ENFA 2D82A 2R0SA 5FH8A 2H60A 4NR4A 4NR5A 4MR3A 4LC2A 2RNYA 4HBYA 5CU8A 5L98A 5A5OA 2N9GA 5DW1A 4QC1A 2L85A 4MEQA 4KCXA 4ZQLA 4MEPA 3NXBA 4UYFB 5EPRA 4OUFA 5FE7A 1WUMA 2DVQA 5H1VA 5DYXA 4J0SA 4KV4A 4NQNA 4RVRA 4QSXA 2RO1A 5D3JA 3AQAA 5J0DA 5EGUA 5DY7A 5EU1A 5HJCA 5EWCA 5D3HA 2YEKA 3QZSA 5FB0A 5D3NA 5TCMA 5CQ7A 4CUQA 4YYJA 5DYUA 1X0JA 3G0LA 5L97A 3SVHA 4BW4A 2RNWA 5ENJA 3U5LA 2FSAA 5I40A 5CQ4A 4BW3A 4YAXA 4YY6A 5D3SA 4QR5A 4LZSA 5HQ6A 5CQ6A 4TU4A 4HXMA 5CUCA 4OGIA 3O36A 5IBNA 2L5EA 5CRZA 5HLSA 5DKHA 4TT4A 5EWVA 3HMEA 4QSTA 4A9EA 5HFRA 3UW9A 5ENBA 4ALGA 4ALHA 4UIWA 4IR5A 4LRGA 2RS9B 3P1EA 3I3JA 5LKZA 3IU6A 4ZC9A 4BHWA 3LXJA 4N4GA 2DWWA 2DATA 4PY6A 5HCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UYH A;  5C7N A;  2MJV B;  3AAD A;  5ENI A;  3UVW A;  3Q2E A;  5CQ5 A;  4YYN A;  2YW5 A;  5BT4 A;  5HM0 A;  4UYE A;  5CQT A;  4LZR A;  3UV5 A;  4YBS A;  2DKW A;  2RFJ A;  4QBM A;  5I7Y A;  5FH7 A;  4QSS A;  5KTX A;  5F5Z A;  4O71 A;  4NQM A;  5E9M A;  4ZW1 A;  5AD3 A;  4NUD A;  5II2 A;  5EK9 A;  3UV2 A;  4J3I A;  4YAD A;  5EWH A;  3SVG A;  4A9F A;  2R10 A;  5E3D A;  5DFC A;  5CFW A;  3JVM A;  5JI8 A;  5H85 A;  3DWY A;  2DVV A;  4CFL A;  4QUU A;  4O7B A;  4HBW A;  4A9L A;  3HMF A;  4HXL A;  5I86 A;  2YQD A;  4QR3 A;  5DBM A;  5A83 A;  3U5M A;  4NUE A;  5EIS A;  3U5O A;  4QC3 A;  2G4A A;  3DAI A;  4QEW A;  4QSU A;  4YBT A;  4C67 A;  4IR4 A;  4YC9 A;  3LJW A;  4NR7 A;  4TTE A;  5I29 A;  5F63 A;  3JVK A;  5F2P A;  5CUD A;  3U5N A;  4NYW A;  4BJX A;  4O70 A;  4A9N A;  4Q0O A;  4TS8 A;  5F1L A;  3QZT A;  5FE3 A;  4CL9 A;  4UYF A;  5FG6 A;  4QSP A;  4NR6 A;  4HBV A;  5CUG A;  4HXN A;  5D26 A;  4UIT A;  3JVL A;  5HEL A;  5EP7 A;  4UIU A;  4LZ2 A;  2L84 A;  5F62 A;  3Q2F A;  4Z1Q A;  5F60 A;  5A81 A;  5DX4 A;  4TT6 A;  4PTB A;  5ENH A;  5HEM A;  5I7X A;  4CUT A;  5A5N A;  4CUP A;  3UVD A;  4YBM A;  4YYK A;  3S92 A;  2YDW A;  3IU5 A;  5EV9 A;  5KU3 A;  4A9H A;  4YYM A;  4Z93 A;  5IGL A;  5EVA A;  5I80 A;  2DVR A;  4TYL A;  4XUA A;  4Z6H A;  4CLB A;  4LDF A;  5D7X A;  4N4I A;  2E3K A;  4LYS A;  4YAT A;  5HFQ A;  3ZYU A;  4QSR A;  1EQF A;  5AD2 A;  5KHM A;  5FE1 A;  5CQ8 A;  3LQJ A;  5E9I A;  5CUA A;  5AMF A;  4UYD A;  3U5J A;  5CUB A;  5DLX A;  5C87 A;  5FH6 A;  5DYA A;  4HXO A;  4BW2 A;  4PCI A;  5LKT A;  5FDZ A;  3U5P A;  4QEV A;  1JM4 B;  2I7K A;  5E9K A;  5E9V A;  5LJ1 A;  5CGP A;  5D0C A;  5ACY A;  5LJ0 A;  5FE6 A;  5LJ2 A;  3MB3 A;  5C85 A;  3TLP A;  5F25 A;  1WUG A;  3UVY A;  3ONI A;  4J0R A;  5EIC A;  4AKN A;  5G4S A;  5F36 A;  5H1U A;  5E74 A;  4KV1 A;  5AME A;  4XY8 A;  4QEU A;  5FE5 A;  5DLZ A;  2I8N A;  2NXB A;  4IOO A;  5I89 A;  4GPJ A;  4NRB A;  4WIV A;  5FE0 A;  4NXJ A;  5I1Q A;  5LUU A;  5CPE A;  4QNS A;  3P1C A;  2OO1 A;  4E96 A;  4O7A A;  2YYN A;  5A5R A;  5IID A;  3G0J A;  4UIV A;  5LKU A;  3FKM X;  3P5O A;  4IR6 A;  4LR6 A;  4MR5 A;  5FE8 A;  2RI7 A;  4YYI A;  1JSP B;  5ETD A;  4UYG A;  4WHW A;  2LSP B;  4HXR A;  2GRC A;  5DFB A;  5EM3 A;  4CUS A;  5L99 A;  5FFV A;  5ENC A;  5HEN A;  3U5K A;  4XYA A;  4NYV A;  4YK0 A;  3O34 A;  4NRC A;  4N4H A;  3P1F A;  2F6N A;  2YEL A;  5D24 A;  1N72 A;  5HQ7 A;  5FE2 A;  5DYC A;  3MXF A;  5CY9 A;  5FFY A;  4NYX A;  5HQ5 A;  4A9M A;  4BW1 A;  5EPS A;  4QZS A;  5C8G A;  4HXS A;  4DON A;  5E73 A;  3SVF A;  4Y03 A;  2R0Y A;  4YYG A;  5BT3 A;  4A9J A;  3O37 A;  5EA1 A;  5LVQ A;  5L96 A;  4TQN A;  4YAB A;  5FFW A;  4CFK A;  4NS5 A;  4UIZ A;  5FG4 A;  4Q0N A;  4N4F A;  4IOQ A;  5D3T A;  4NRA A;  5IGK A;  3JVJ A;  5CRM A;  2YEM A;  5JWM A;  4TZ2 A;  4O72 A;  4O7F A;  5ENE A;  5FBX A;  3GG3 A;  4O74 A;  4UIX A;  5EI4 A;  4QYD A;  5CZG A;  3LQI A;  4QB3 A;  5H1T A;  4TT2 A;  5IGN A;  4O78 A;  4YY4 A;  4XUB A;  4C66 A;  5D25 A;  4A9I A;  3D7C A;  5E3G A;  4TU6 A;  5L8T A;  2WP2 A;  3RCW A;  5DFD A;  5F1H A;  3LQH A;  3MQM A;  5EQ1 A;  4QSQ A;  4YH3 A;  5DKD A;  5EPB A;  5C4Q A;  3MUK A;  4CUU A;  2KTB B;  5DKC A;  4A9O A;  5A5Q A;  5I83 A;  4MEN A;  5FE4 A;  4O75 A;  2RNX A;  5L8U A;  5CQ3 A;  5EWD A;  4QSV A;  4IOR A;  4CUR A;  4YYH A;  5COI A;  5A5S A;  5ENG A;  4O7C A;  4OGJ A;  5FE9 A;  5HRW A;  2OSS A;  2OUO A;  5G4R A;  3O35 A;  5E7D A;  4A9K A;  5KTW A;  4QSW A;  4XY9 A;  4YYD A;  5D3L A;  5LVR A;  2DVS A;  5CP5 A;  4FLP A;  5K29 A;  5ETB A;  3MUL A;  5II1 A;  1E6I A;  4MR4 A;  5TB6 A;  4QYL A;  5F3A A;  2F6J A;  4PCE A;  4O7E A;  3MB4 A;  2WP1 A;  4Z1S A;  4LYW A;  4O76 A;  3P1D A;  4QUT A;  4PKL A;  2D9E A;  5DW2 A;  2E7O A;  5EWW A;  3QZV A;  4O77 A;  5I88 A;  5D3R A;  5FB1 A;  5CUE A;  5KO4 A;  5F61 A;  5CTL A;  4MEO A;  4NR8 A;  5E9L A;  4IR3 A;  4J1P A;  3O33 A;  4WHU A;  1F68 A;  4X2I A;  5HRV A;  5D3P A;  1ZS5 A;  3UVX A;  4LYI A;  5FG5 A;  5KTU A;  5IGM A;  5HRX A;  4UIY A;  4F3I A;  4TZ8 A;  4NUC A;  4QR4 A;  2E7N A;  4HXP A;  2R0V A;  3HMH A;  5A82 A;  5A5P A;  4PS5 A;  4MR6 A;  5E0R A;  3K2J A;  5E9Y A;  5A7C A;  5CS8 A;  5CQA A;  4N3W A;  5BT5 A;  4HBX A;  4YH4 A;  4HXK A;  3UV4 A;  3S91 A;  4Z6I A;  5A85 A;  5IG6 A;  5C89 A;  5LKX A;  4NR9 A;  4QY4 A;  5ENF A;  2D82 A;  2R0S A;  5FH8 A;  2H60 A;  4NR4 A;  4NR5 A;  4MR3 A;  4LC2 A;  2RNY A;  4HBY A;  5CU8 A;  5L98 A;  5A5O A;  2N9G A;  5DW1 A;  4QC1 A;  2L85 A;  4MEQ A;  4KCX A;  4ZQL A;  4MEP A;  3NXB A;  4UYF B;  5EPR A;  4OUF A;  5FE7 A;  1WUM A;  2DVQ A;  5H1V A;  5DYX A;  4J0S A;  4KV4 A;  4NQN A;  4RVR A;  4QSX A;  2RO1 A;  5D3J A;  3AQA A;  5J0D A;  5EGU A;  5DY7 A;  5EU1 A;  5HJC A;  5EWC A;  5D3H A;  2YEK A;  3QZS A;  5FB0 A;  5D3N A;  5TCM A;  5CQ7 A;  4CUQ A;  4YYJ A;  5DYU A;  1X0J A;  3G0L A;  5L97 A;  3SVH A;  4BW4 A;  2RNW A;  5ENJ A;  3U5L A;  2FSA A;  5I40 A;  5CQ4 A;  4BW3 A;  4YAX A;  4YY6 A;  5D3S A;  4QR5 A;  4LZS A;  5HQ6 A;  5CQ6 A;  4TU4 A;  4HXM A;  5CUC A;  4OGI A;  3O36 A;  5IBN A;  2L5E A;  5CRZ A;  5HLS A;  5DKH A;  4TT4 A;  5EWV A;  3HME A;  4QST A;  4A9E A;  5HFR A;  3UW9 A;  5ENB A;  4ALG A;  4ALH A;  4UIW A;  4IR5 A;  4LRG A;  2RS9 B;  3P1E A;  3I3J A;  5LKZ A;  3IU6 A;  4ZC9 A;  4BHW A;  3LXJ A;  4N4G A;  2DWW A;  2DAT A;  4PY6 A;  5HCL A; 
#chains in the Genus database with same CATH topology
 4UYH A;  5C7N A;  2MJV B;  3AAD A;  5ENI A;  3UVW A;  3Q2E A;  5CQ5 A;  4YYN A;  2YW5 A;  5BT4 A;  5HM0 A;  4UYE A;  5CQT A;  4LZR A;  3UV5 A;  4YBS A;  2DKW A;  2RFJ A;  4QBM A;  5I7Y A;  5FH7 A;  4QSS A;  5KTX A;  5F5Z A;  4O71 A;  4NQM A;  5E9M A;  4ZW1 A;  5AD3 A;  4NUD A;  5II2 A;  5EK9 A;  3UV2 A;  4J3I A;  4YAD A;  5EWH A;  3SVG A;  4A9F A;  2R10 A;  5E3D A;  5DFC A;  5CFW A;  3JVM A;  5JI8 A;  5H85 A;  3DWY A;  2DVV A;  4CFL A;  4QUU A;  4O7B A;  4HBW A;  4A9L A;  3HMF A;  4HXL A;  5I86 A;  2YQD A;  4QR3 A;  5DBM A;  5A83 A;  3U5M A;  4NUE A;  5EIS A;  3U5O A;  4QC3 A;  2G4A A;  3DAI A;  4QEW A;  4QSU A;  4YBT A;  4C67 A;  4IR4 A;  4YC9 A;  3LJW A;  4NR7 A;  4TTE A;  5I29 A;  5F63 A;  3JVK A;  5F2P A;  5CUD A;  4AKI A;  3U5N A;  4NYW A;  4BJX A;  4O70 A;  4A9N A;  4Q0O A;  4TS8 A;  5F1L A;  3QZT A;  5FE3 A;  4CL9 A;  4UYF A;  5FG6 A;  4QSP A;  4NR6 A;  4HBV A;  5CUG A;  4HXN A;  5D26 A;  4UIT A;  3JVL A;  5HEL A;  5EP7 A;  4UIU A;  4LZ2 A;  2L84 A;  5F62 A;  3Q2F A;  4Z1Q A;  5F60 A;  5A81 A;  5DX4 A;  4TT6 A;  4PTB A;  5ENH A;  5HEM A;  5I7X A;  4CUT A;  5A5N A;  4CUP A;  3UVD A;  4YBM A;  4YYK A;  3S92 A;  2YDW A;  3IU5 A;  5EV9 A;  5KU3 A;  4A9H A;  4YYM A;  4Z93 A;  5IGL A;  5EVA A;  5I80 A;  2DVR A;  4TYL A;  4XUA A;  4Z6H A;  4CLB A;  4LDF A;  5D7X A;  4N4I A;  2E3K A;  4LYS A;  4YAT A;  5HFQ A;  3ZYU A;  4QSR A;  1EQF A;  5AD2 A;  5KHM A;  5FE1 A;  5CQ8 A;  3LQJ A;  5E9I A;  5CUA A;  5AMF A;  4UYD A;  3U5J A;  5CUB A;  5DLX A;  5C87 A;  5FH6 A;  5DYA A;  4HXO A;  4BW2 A;  4PCI A;  1ZKR A;  3VKG A;  5LKT A;  5FDZ A;  3U5P A;  4QEV A;  1JM4 B;  2I7K A;  5E9K A;  5E9V A;  5LJ1 A;  5CGP A;  5D0C A;  5ACY A;  5LJ0 A;  5FE6 A;  5LJ2 A;  3MB3 A;  5C85 A;  3TLP A;  5F25 A;  1WUG A;  3UVY A;  3ONI A;  4J0R A;  5EIC A;  4AKN A;  5G4S A;  5F36 A;  5H1U A;  5E74 A;  4KV1 A;  5AME A;  4XY8 A;  4QEU A;  5FE5 A;  5DLZ A;  2I8N A;  2NXB A;  4IOO A;  5I89 A;  4GPJ A;  4NRB A;  4WIV A;  5FE0 A;  4NXJ A;  5I1Q A;  5LUU A;  5CPE A;  4QNS A;  3P1C A;  2OO1 A;  4E96 A;  4O7A A;  2YYN A;  5A5R A;  5IID A;  3G0J A;  4UIV A;  5LKU A;  3FKM X;  3P5O A;  4IR6 A;  4LR6 A;  4MR5 A;  5FE8 A;  2RI7 A;  4YYI A;  1JSP B;  5ETD A;  4UYG A;  4WHW A;  2LSP B;  4HXR A;  2GRC A;  5DFB A;  5EM3 A;  4CUS A;  5L99 A;  5FFV A;  5ENC A;  5HEN A;  3U5K A;  4XYA A;  4NYV A;  4YK0 A;  3O34 A;  4NRC A;  4N4H A;  3P1F A;  2F6N A;  2YEL A;  5D24 A;  1N72 A;  5HQ7 A;  5FE2 A;  5DYC A;  3MXF A;  5CY9 A;  5FFY A;  4NYX A;  5HQ5 A;  4A9M A;  4BW1 A;  5EPS A;  4QZS A;  5C8G A;  4HXS A;  4DON A;  5E73 A;  3SVF A;  4Y03 A;  2R0Y A;  4YYG A;  5BT3 A;  4A9J A;  3O37 A;  5EA1 A;  5LVQ A;  5L96 A;  4TQN A;  4YAB A;  5FFW A;  4CFK A;  4NS5 A;  4UIZ A;  5FG4 A;  4Q0N A;  4N4F A;  4IOQ A;  5D3T A;  4NRA A;  5IGK A;  3JVJ A;  5CRM A;  2YEM A;  5JWM A;  4TZ2 A;  4O72 A;  4O7F A;  5ENE A;  5FBX A;  3GG3 A;  4O74 A;  1PUO A;  4UIX A;  5EI4 A;  4QYD A;  5CZG A;  3LQI A;  4QB3 A;  5H1T A;  4TT2 A;  5IGN A;  4O78 A;  4YY4 A;  4XUB A;  4C66 A;  5D25 A;  4A9I A;  3D7C A;  5E3G A;  4TU6 A;  5L8T A;  2WP2 A;  3RCW A;  5DFD A;  5F1H A;  3LQH A;  3MQM A;  5EQ1 A;  4QSQ A;  4YH3 A;  5DKD A;  4AKG A;  5EPB A;  5C4Q A;  3MUK A;  4CUU A;  2KTB B;  5DKC A;  4A9O A;  5A5Q A;  5I83 A;  4MEN A;  5FE4 A;  4O75 A;  2RNX A;  5L8U A;  5CQ3 A;  5EWD A;  4QSV A;  4IOR A;  4CUR A;  4YYH A;  5COI A;  5A5S A;  5ENG A;  4O7C A;  4OGJ A;  5FE9 A;  5HRW A;  2OSS A;  2OUO A;  5G4R A;  3O35 A;  5E7D A;  4A9K A;  5KTW A;  3D1B A;  4QSW A;  4XY9 A;  4YYD A;  5D3L A;  5LVR A;  2DVS A;  5CP5 A;  4FLP A;  5K29 A;  5ETB A;  3MUL A;  5II1 A;  1E6I A;  4MR4 A;  5TB6 A;  4QYL A;  5F3A A;  2F6J A;  4PCE A;  4O7E A;  3MB4 A;  2WP1 A;  4Z1S A;  4LYW A;  4O76 A;  3P1D A;  4QUT A;  4PKL A;  2D9E A;  5DW2 A;  2E7O A;  5EWW A;  3QZV A;  4O77 A;  5I88 A;  5D3R A;  5FB1 A;  5CUE A;  5KO4 A;  5F61 A;  5CTL A;  4MEO A;  4NR8 A;  5E9L A;  4IR3 A;  4J1P A;  3O33 A;  4WHU A;  1F68 A;  4X2I A;  5HRV A;  5D3P A;  1ZS5 A;  4AI6 A;  3UVX A;  4LYI A;  5FG5 A;  5KTU A;  5IGM A;  5HRX A;  4UIY A;  4F3I A;  4TZ8 A;  4NUC A;  4QR4 A;  2E7N A;  4HXP A;  2R0V A;  3HMH A;  5A82 A;  5A5P A;  4PS5 A;  4MR6 A;  5E0R A;  3K2J A;  5E9Y A;  5A7C A;  5CS8 A;  5CQA A;  4N3W A;  5BT5 A;  4HBX A;  4YH4 A;  4HXK A;  3UV4 A;  3S91 A;  4Z6I A;  5A85 A;  5IG6 A;  5C89 A;  5LKX A;  4NR9 A;  4QY4 A;  5ENF A;  2D82 A;  2R0S A;  5FH8 A;  2H60 A;  4NR4 A;  4NR5 A;  4MR3 A;  4LC2 A;  2RNY A;  4HBY A;  5CU8 A;  5L98 A;  5A5O A;  2N9G A;  5DW1 A;  4QC1 A;  2L85 A;  4MEQ A;  4KCX A;  4ZQL A;  4MEP A;  3NXB A;  4UYF B;  5EPR A;  4AKH A;  4OUF A;  5FE7 A;  3VKH A;  1WUM A;  2DVQ A;  5H1V A;  5DYX A;  4J0S A;  4KV4 A;  4NQN A;  4RVR A;  4QSX A;  3D1D A;  2RO1 A;  5D3J A;  3AQA A;  5J0D A;  5EGU A;  5DY7 A;  5EU1 A;  5HJC A;  5EWC A;  5D3H A;  2YEK A;  3QZS A;  5FB0 A;  5D3N A;  5TCM A;  5CQ7 A;  4CUQ A;  4YYJ A;  5DYU A;  1X0J A;  3G0L A;  5L97 A;  3SVH A;  4BW4 A;  2RNW A;  5ENJ A;  3U5L A;  2FSA A;  5I40 A;  5CQ4 A;  4BW3 A;  4YAX A;  4YY6 A;  5D3S A;  4QR5 A;  4LZS A;  5HQ6 A;  5CQ6 A;  4TU4 A;  4HXM A;  5CUC A;  4OGI A;  3O36 A;  5IBN A;  3ERR A;  2L5E A;  5CRZ A;  5HLS A;  5DKH A;  4TT4 A;  5EWV A;  3HME A;  4QST A;  4A9E A;  5HFR A;  3UW9 A;  5ENB A;  4ALG A;  4ALH A;  4UIW A;  4IR5 A;  4LRG A;  2RS9 B;  2EJN A;  3P1E A;  3I3J A;  5LKZ A;  3IU6 A;  4ZC9 A;  4BHW A;  3LXJ A;  4N4G A;  2DWW A;  2DAT A;  4PY6 A;  5HCL A; 
#chains in the Genus database with same CATH homology
 4UYH A;  5C7N A;  2MJV B;  3AAD A;  5ENI A;  3UVW A;  3Q2E A;  5CQ5 A;  4YYN A;  2YW5 A;  5BT4 A;  5HM0 A;  4UYE A;  5CQT A;  4LZR A;  3UV5 A;  4YBS A;  2DKW A;  2RFJ A;  4QBM A;  5I7Y A;  5FH7 A;  4QSS A;  5KTX A;  5F5Z A;  4O71 A;  4NQM A;  5E9M A;  4ZW1 A;  5AD3 A;  4NUD A;  5II2 A;  5EK9 A;  3UV2 A;  4J3I A;  4YAD A;  5EWH A;  3SVG A;  4A9F A;  2R10 A;  5E3D A;  5DFC A;  5CFW A;  3JVM A;  5JI8 A;  5H85 A;  3DWY A;  2DVV A;  4CFL A;  4QUU A;  4O7B A;  4HBW A;  4A9L A;  3HMF A;  4HXL A;  5I86 A;  2YQD A;  4QR3 A;  5DBM A;  5A83 A;  3U5M A;  4NUE A;  5EIS A;  3U5O A;  4QC3 A;  2G4A A;  3DAI A;  4QEW A;  4QSU A;  4YBT A;  4C67 A;  4IR4 A;  4YC9 A;  3LJW A;  4NR7 A;  4TTE A;  5I29 A;  5F63 A;  3JVK A;  5F2P A;  5CUD A;  3U5N A;  4NYW A;  4BJX A;  4O70 A;  4A9N A;  4Q0O A;  4TS8 A;  5F1L A;  3QZT A;  5FE3 A;  4CL9 A;  4UYF A;  5FG6 A;  4QSP A;  4NR6 A;  4HBV A;  5CUG A;  4HXN A;  5D26 A;  4UIT A;  3JVL A;  5HEL A;  5EP7 A;  4UIU A;  4LZ2 A;  2L84 A;  5F62 A;  3Q2F A;  4Z1Q A;  5F60 A;  5A81 A;  5DX4 A;  4TT6 A;  4PTB A;  5ENH A;  5HEM A;  5I7X A;  4CUT A;  5A5N A;  4CUP A;  3UVD A;  4YBM A;  4YYK A;  3S92 A;  2YDW A;  3IU5 A;  5EV9 A;  5KU3 A;  4A9H A;  4YYM A;  4Z93 A;  5IGL A;  5EVA A;  5I80 A;  2DVR A;  4TYL A;  4XUA A;  4Z6H A;  4CLB A;  4LDF A;  5D7X A;  4N4I A;  2E3K A;  4LYS A;  4YAT A;  5HFQ A;  3ZYU A;  4QSR A;  1EQF A;  5AD2 A;  5KHM A;  5FE1 A;  5CQ8 A;  3LQJ A;  5E9I A;  5CUA A;  5AMF A;  4UYD A;  3U5J A;  5CUB A;  5DLX A;  5C87 A;  5FH6 A;  5DYA A;  4HXO A;  4BW2 A;  4PCI A;  5LKT A;  5FDZ A;  3U5P A;  4QEV A;  1JM4 B;  2I7K A;  5E9K A;  5E9V A;  5LJ1 A;  5CGP A;  5D0C A;  5ACY A;  5LJ0 A;  5FE6 A;  5LJ2 A;  3MB3 A;  5C85 A;  3TLP A;  5F25 A;  1WUG A;  3UVY A;  3ONI A;  4J0R A;  5EIC A;  4AKN A;  5G4S A;  5F36 A;  5H1U A;  5E74 A;  4KV1 A;  5AME A;  4XY8 A;  4QEU A;  5FE5 A;  5DLZ A;  2I8N A;  2NXB A;  4IOO A;  5I89 A;  4GPJ A;  4NRB A;  4WIV A;  5FE0 A;  4NXJ A;  5I1Q A;  5LUU A;  5CPE A;  4QNS A;  3P1C A;  2OO1 A;  4E96 A;  4O7A A;  2YYN A;  5A5R A;  5IID A;  3G0J A;  4UIV A;  5LKU A;  3FKM X;  3P5O A;  4IR6 A;  4LR6 A;  4MR5 A;  5FE8 A;  2RI7 A;  4YYI A;  1JSP B;  5ETD A;  4UYG A;  4WHW A;  2LSP B;  4HXR A;  2GRC A;  5DFB A;  5EM3 A;  4CUS A;  5L99 A;  5FFV A;  5ENC A;  5HEN A;  3U5K A;  4XYA A;  4NYV A;  4YK0 A;  3O34 A;  4NRC A;  4N4H A;  3P1F A;  2F6N A;  2YEL A;  5D24 A;  1N72 A;  5HQ7 A;  5FE2 A;  5DYC A;  3MXF A;  5CY9 A;  5FFY A;  4NYX A;  5HQ5 A;  4A9M A;  4BW1 A;  5EPS A;  4QZS A;  5C8G A;  4HXS A;  4DON A;  5E73 A;  3SVF A;  4Y03 A;  2R0Y A;  4YYG A;  5BT3 A;  4A9J A;  3O37 A;  5EA1 A;  5LVQ A;  5L96 A;  4TQN A;  4YAB A;  5FFW A;  4CFK A;  4NS5 A;  4UIZ A;  5FG4 A;  4Q0N A;  4N4F A;  4IOQ A;  5D3T A;  4NRA A;  5IGK A;  3JVJ A;  5CRM A;  2YEM A;  5JWM A;  4TZ2 A;  4O72 A;  4O7F A;  5ENE A;  5FBX A;  3GG3 A;  4O74 A;  4UIX A;  5EI4 A;  4QYD A;  5CZG A;  3LQI A;  4QB3 A;  5H1T A;  4TT2 A;  5IGN A;  4O78 A;  4YY4 A;  4XUB A;  4C66 A;  5D25 A;  4A9I A;  3D7C A;  5E3G A;  4TU6 A;  5L8T A;  2WP2 A;  3RCW A;  5DFD A;  5F1H A;  3LQH A;  3MQM A;  5EQ1 A;  4QSQ A;  4YH3 A;  5DKD A;  5EPB A;  5C4Q A;  3MUK A;  4CUU A;  2KTB B;  5DKC A;  4A9O A;  5A5Q A;  5I83 A;  4MEN A;  5FE4 A;  4O75 A;  2RNX A;  5L8U A;  5CQ3 A;  5EWD A;  4QSV A;  4IOR A;  4CUR A;  4YYH A;  5COI A;  5A5S A;  5ENG A;  4O7C A;  4OGJ A;  5FE9 A;  5HRW A;  2OSS A;  2OUO A;  5G4R A;  3O35 A;  5E7D A;  4A9K A;  5KTW A;  4QSW A;  4XY9 A;  4YYD A;  5D3L A;  5LVR A;  2DVS A;  5CP5 A;  4FLP A;  5K29 A;  5ETB A;  3MUL A;  5II1 A;  1E6I A;  4MR4 A;  5TB6 A;  4QYL A;  5F3A A;  2F6J A;  4PCE A;  4O7E A;  3MB4 A;  2WP1 A;  4Z1S A;  4LYW A;  4O76 A;  3P1D A;  4QUT A;  4PKL A;  2D9E A;  5DW2 A;  2E7O A;  5EWW A;  3QZV A;  4O77 A;  5I88 A;  5D3R A;  5FB1 A;  5CUE A;  5KO4 A;  5F61 A;  5CTL A;  4MEO A;  4NR8 A;  5E9L A;  4IR3 A;  4J1P A;  3O33 A;  4WHU A;  1F68 A;  4X2I A;  5HRV A;  5D3P A;  1ZS5 A;  3UVX A;  4LYI A;  5FG5 A;  5KTU A;  5IGM A;  5HRX A;  4UIY A;  4F3I A;  4TZ8 A;  4NUC A;  4QR4 A;  2E7N A;  4HXP A;  2R0V A;  3HMH A;  5A82 A;  5A5P A;  4PS5 A;  4MR6 A;  5E0R A;  3K2J A;  5E9Y A;  5A7C A;  5CS8 A;  5CQA A;  4N3W A;  5BT5 A;  4HBX A;  4YH4 A;  4HXK A;  3UV4 A;  3S91 A;  4Z6I A;  5A85 A;  5IG6 A;  5C89 A;  5LKX A;  4NR9 A;  4QY4 A;  5ENF A;  2D82 A;  2R0S A;  5FH8 A;  2H60 A;  4NR4 A;  4NR5 A;  4MR3 A;  4LC2 A;  2RNY A;  4HBY A;  5CU8 A;  5L98 A;  5A5O A;  2N9G A;  5DW1 A;  4QC1 A;  2L85 A;  4MEQ A;  4KCX A;  4ZQL A;  4MEP A;  3NXB A;  4UYF B;  5EPR A;  4OUF A;  5FE7 A;  1WUM A;  2DVQ A;  5H1V A;  5DYX A;  4J0S A;  4KV4 A;  4NQN A;  4RVR A;  4QSX A;  2RO1 A;  5D3J A;  3AQA A;  5J0D A;  5EGU A;  5DY7 A;  5EU1 A;  5HJC A;  5EWC A;  5D3H A;  2YEK A;  3QZS A;  5FB0 A;  5D3N A;  5TCM A;  5CQ7 A;  4CUQ A;  4YYJ A;  5DYU A;  1X0J A;  3G0L A;  5L97 A;  3SVH A;  4BW4 A;  2RNW A;  5ENJ A;  3U5L A;  2FSA A;  5I40 A;  5CQ4 A;  4BW3 A;  4YAX A;  4YY6 A;  5D3S A;  4QR5 A;  4LZS A;  5HQ6 A;  5CQ6 A;  4TU4 A;  4HXM A;  5CUC A;  4OGI A;  3O36 A;  5IBN A;  2L5E A;  5CRZ A;  5HLS A;  5DKH A;  4TT4 A;  5EWV A;  3HME A;  4QST A;  4A9E A;  5HFR A;  3UW9 A;  5ENB A;  4ALG A;  4ALH A;  4UIW A;  4IR5 A;  4LRG A;  2RS9 B;  3P1E A;  3I3J A;  5LKZ A;  3IU6 A;  4ZC9 A;  4BHW A;  3LXJ A;  4N4G A;  2DWW A;  2DAT A;  4PY6 A;  5HCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...