4X2IA

Discovery of benzotriazolo diazepines as orally-active inhibitors of bet bromodomains: crystal structure of brd4 with cpi-13
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
126
structure length
126
Chain Sequence
GSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzotriazolo[4,3-d][1,4]diazepines as Orally Active Inhibitors of BET Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4x2iA01
4HXOA 3MULA 3O37A 5A5OA 1X0JA 4WIVA 5IGLA 3UV2A 5CUBA 3UV4A 3UVXA 5CTLA 4N4FA 4NRBA 5HEMA 2WP1A 4QB3A 5KU3A 5I83A 2MJVB 4A9HA 4J0SA 2H60A 5E9YA 4PKLA 5G4RA 3U5LA 4O7FA 4LRGA 5A85A 4NR8A 5DBMA 5DYAA 4AKNA 2YQDA 5FE3A 4UIUA 5I1QA 4QSWA 4KV4A 4UIZA 4HBYA 3O34A 1ZS5A 5FE2A 5TCMA 4YYNA 3P1FA 4YYKA 2D82A 5DYCA 4CL9A 5FB0A 5ENEA 4ALHA 5LVQA 5FE6A 5IGKA 3SVGA 5DLXA 4LR6A 3MQMA 5CQTA 2RNXA 4NUDA 3HMFA 5CQ7A 5H1VA 3HMHA 4CURA 4HXMA 4CUTA 4MR3A 4C66A 5ENJA 4QR4A 3SVFA 4O70A 4UIVA 5D7XA 3G0JA 2RO1A 4QBMA 2FSAA 5D3SA 4O72A 3LQJA 3U5OA 5DW1A 4NQMA 4QSRA 2I8NA 2LSPB 5I88A 2GRCA 4LYSA 3P1EA 5C85A 4CLBA 5I89A 5HRXA 4YAXA 2I7KA 4QNSA 5IGMA 4QSPA 5A5NA 3LJWA 4O77A 4GPJA 2RFJA 4QR3A 3UV5A 5KO4A 3MXFA 4UYEA 5I40A 3RCWA 5LKZA 5HQ7A 4LZRA 4NR9A 2DVQA 5EI4A 4N4HA 5A5PA 5H85A 4QSSA 2DVSA 4TZ2A 4BW4A 3Q2EA 5LKUA 5D3NA 4TT6A 2RI7A 2OSSA 2RS9B 5DYUA 5DKCA 4OGJA 3U5PA 4NUEA 5ENBA 3MB3A 4O74A 3S91A 4O7BA 4PY6A 4QR5A 4XUBA 5CZGA 4NRAA 4LZSA 5FDZA 5F3AA 3O35A 5DYXA 5D3HA 2N9GA 5IG6A 5F61A 5FG6A 5I86A 5E9VA 5BT4A 5LUUA 4YH3A 5LKTA 5L8UA 4QZSA 4UYGA 5HJCA 4IR6A 5EVAA 4TS8A 5ENFA 4PS5A 4CFLA 4A9NA 3NXBA 5JI8A 4QYLA 5COIA 5DKDA 4CUQA 5EISA 4MR6A 2OUOA 4HXNA 5AD2A 5BT5A 5EWDA 4YBTA 2YEKA 5CRZA 5E3DA 4NR7A 5F60A 4Z6HA 4UITA 5A5SA 4NR4A 4Z6IA 2L84A 4CUUA 3UVDA 4NYVA 5CP5A 5E73A 5CUAA 5E7DA 5CUDA 4LDFA 1E6IA 4ZQLA 5F1HA 4YBSA 5C89A 5KTXA 3S92A 4NRCA 5CQ4A 1F68A 4HXSA 3TLPA 5IGNA 4IOOA 5E9LA 5FB1A 5F1LA 4A9LA 4F3IA 3JVMA 3AQAA 5II1A 5FG5A 3O33A 4MENA 5DX4A 4PCIA 5HCLA 4QSXA 3ONIA 3HMEA 5EPBA 4QC3A 5CUGA 5K29A 4UYDA 4J1PA 5FH8A 3G0LA 4UYFB 5KHMA 4A9KA 1JSPB 4YBMA 5I80A 4OUFA 5A5RA 4TYLA 5LJ1A 4Y03A 4N3WA 4YYDA 5D3LA 4QYDA 5KTWA 5EM3A 2YELA 2R0YA 5FE5A 5CU8A 4O7CA 5ETDA 5CY9A 5EPSA 4O7AA 1EQFA 5LKXA 5EA1A 5IBNA 2R0SA 5DW2A 4YADA 2KTBB 4UYFA 5HQ5A 4IR3A 3MB4A 4IR4A 5DKHA 5FH6A 4YC9A 2DWWA 5H1TA 3JVLA 5HFQA 5FE7A 4QSUA 2L5EA 5DY7A 5I29A 4ZC9A 3AADA 5EWCA 5D3JA 4NYXA 5IIDA 5D3TA 4YABA 4MR5A 5D26A 5G4SA 5D0CA 4TQNA 4YYIA 4CUSA 3U5JA 5E0RA 5ENIA 5EK9A 4X2IA 5DFCA 4QUTA 3QZSA 4QSQA 3QZVA 3U5NA 4ALGA 4A9IA 3P1CA 5CRMA 5J0DA 3JVJA 5CQ8A 4Z1QA 5BT3A 2DATA 2YW5A 2E7NA 4HXPA 5FE4A 3ZYUA 4O71A 5F5ZA 1WUGA 5EWVA 4CUPA 2YEMA 5FBXA 2YDWA 4NR6A 5FE0A 3MUKA 4YY6A 5D25A 5H1UA 4LC2A 5D24A 5EICA 4QY4A 4N4GA 5LJ2A 4XYAA 2R10A 5DFDA 5II2A 4XUAA 4YYHA 4O76A 5EWWA 4A9JA 5D3RA 5HM0A 4KV1A 4QEVA 4DONA 5I7XA 4QEWA 5F25A 4Z93A 1WUMA 4PCEA 4Q0NA 4O7EA 4QUUA 5ENCA 4TTEA 4A9FA 5C8GA 3LQIA 3I3JA 4A9OA 5CUEA 3IU5A 5A81A 5ENGA 4E96A 4BHWA 5A83A 2WP2A 5CUCA 4TU6A 4HXLA 4HBWA 5C4QA 4YH4A 4ZW1A 4A9MA 4Q0OA 2DKWA 4YATA 4OGIA 4WHWA 4UIWA 4PTBA 5L98A 3FKMX 2NXBA 5A7CA 4XY8A 5A5QA 5E9MA 4LYIA 4BW2A 5I7YA 4YY4A 4TT2A 3LQHA 5DFBA 4QSTA 4NQNA 5HQ6A 5DLZA 5CPEA 3DWYA 3U5KA 4IR5A 3O36A 5EQ1A 2F6NA 4NS5A 4CFKA 5C7NA 5FG4A 4QSVA 4J3IA 5FE8A 5KTUA 5HFRA 2OO1A 5CFWA 5CQAA 4J0RA 4RVRA 4FLPA 2RNWA 5E74A 4N4IA 4O78A 5EV9A 3K2JA 4TU4A 3IU6A 5L99A 4BW3A 4UIYA 5E3GA 5HELA 2YYNA 4LYWA 3GG3A 5AD3A 4YYJA 3UVWA 4KCXA 5L96A 5EPRA 5FFWA 3SVHA 2F6JA 5FE9A 5CQ3A 4BW1A 5AMFA 5F63A 5F36A 4NXJA 4O75A 3UVYA 4HBVA 5EP7A 2G4AA 4C67A 5LVRA 4MEPA 5E9KA 4NUCA 5HRWA 2E7OA 4HXRA 5CQ5A 5E9IA 5ETBA 4BJXA 4HBXA 5AMEA 5EWHA 5HLSA 3Q2FA 2D9EA 2E3KA 4WHUA 3JVKA 4QC1A 5F2PA 2DVVA 4YK0A 3LXJA 5HRVA 5D3PA 4QEUA 5HENA 4YYMA 4NR5A 5CQ6A 4MR4A 5A82A 1JM4B 3DAIA 4TZ8A 1N72A 2DVRA 3QZTA 5ENHA 5CS8A 3UW9A 4Z1SA 5JWMA 5FE1A 5FFVA 4IORA 5L8TA 5FFYA 4MEQA 3U5MA 4A9EA 3D7CA 5TB6A 4TT4A 2L85A 4LZ2A 4MEOA 4NYWA 4XY9A 2RNYA 4UIXA 4UYHA 5EGUA 3P1DA 4HXKA 5C87A 5ACYA 3P5OA 5FH7A 4IOQA 2R0VA 5F62A 4YYGA 5EU1A 5CGPA 5L97A 5LJ0A
chains in the Genus database with same CATH superfamily
4HXOA 3MULA 3O37A 5A5OA 1X0JA 4WIVA 5IGLA 3UV2A 5CUBA 3UV4A 1PUOA 3UVXA 5CTLA 3D1BA 4N4FA 4NRBA 5HEMA 2WP1A 4QB3A 5KU3A 5I83A 2MJVB 4A9HA 4J0SA 2H60A 3VKHA 5E9YA 4PKLA 5G4RA 3U5LA 4O7FA 4LRGA 5A85A 4NR8A 5DBMA 5DYAA 4AKNA 2YQDA 5FE3A 4UIUA 5I1QA 4QSWA 4KV4A 4UIZA 4HBYA 3O34A 1ZS5A 5FE2A 5TCMA 4YYNA 3P1FA 4YYKA 2D82A 5DYCA 4CL9A 5FB0A 5ENEA 4ALHA 5LVQA 5FE6A 5IGKA 3SVGA 5DLXA 4LR6A 3MQMA 5CQTA 2RNXA 4NUDA 3HMFA 5CQ7A 5H1VA 3HMHA 4CURA 4HXMA 4CUTA 4MR3A 4C66A 5ENJA 4QR4A 3SVFA 4O70A 4UIVA 5D7XA 3G0JA 2RO1A 4QBMA 2FSAA 5D3SA 4O72A 3LQJA 3U5OA 5DW1A 4NQMA 4QSRA 2I8NA 2LSPB 5I88A 2GRCA 4LYSA 3P1EA 5C85A 4CLBA 5I89A 5HRXA 4YAXA 2I7KA 4QNSA 5IGMA 4QSPA 5A5NA 3LJWA 4O77A 4GPJA 2RFJA 4QR3A 3UV5A 5KO4A 3MXFA 4UYEA 5I40A 3RCWA 5LKZA 5HQ7A 4LZRA 4NR9A 2DVQA 5EI4A 4N4HA 5A5PA 5H85A 4QSSA 2DVSA 4TZ2A 4BW4A 3Q2EA 5LKUA 5D3NA 4TT6A 2RI7A 2OSSA 4AI6A 2RS9B 5DYUA 5DKCA 4OGJA 3U5PA 4NUEA 5ENBA 3MB3A 4O74A 3S91A 4O7BA 4PY6A 4QR5A 4XUBA 5CZGA 4NRAA 4LZSA 5FDZA 5F3AA 3O35A 5DYXA 5D3HA 2N9GA 5IG6A 5F61A 5FG6A 5I86A 3VKGA 5E9VA 5BT4A 5LUUA 4YH3A 5LKTA 5L8UA 4QZSA 4UYGA 5HJCA 4IR6A 5EVAA 4TS8A 5ENFA 4PS5A 4CFLA 4A9NA 3NXBA 5JI8A 4QYLA 5COIA 5DKDA 4CUQA 5EISA 4MR6A 2OUOA 4HXNA 5AD2A 5BT5A 5EWDA 4YBTA 2YEKA 5CRZA 5E3DA 4NR7A 5F60A 4Z6HA 4UITA 5A5SA 4NR4A 4Z6IA 2L84A 4CUUA 3UVDA 4NYVA 5CP5A 5E73A 5CUAA 5E7DA 5CUDA 4LDFA 1E6IA 4ZQLA 5F1HA 4YBSA 5C89A 5KTXA 3S92A 4NRCA 5CQ4A 1F68A 4HXSA 3TLPA 5IGNA 4IOOA 5E9LA 5FB1A 5F1LA 4A9LA 4F3IA 3JVMA 3AQAA 5II1A 5FG5A 3O33A 4MENA 5DX4A 4PCIA 5HCLA 4QSXA 3ONIA 3HMEA 5EPBA 4QC3A 5CUGA 5K29A 4UYDA 4J1PA 5FH8A 4AKHA 3G0LA 4UYFB 5KHMA 4A9KA 1JSPB 4YBMA 5I80A 4OUFA 5A5RA 4TYLA 5LJ1A 4Y03A 4N3WA 4YYDA 5D3LA 4QYDA 5KTWA 5EM3A 2YELA 2R0YA 5FE5A 5CU8A 4O7CA 5ETDA 5CY9A 5EPSA 4O7AA 1EQFA 5LKXA 5EA1A 5IBNA 2R0SA 5DW2A 4YADA 2KTBB 4UYFA 5HQ5A 4IR3A 3MB4A 4IR4A 5DKHA 5FH6A 4YC9A 2DWWA 5H1TA 3JVLA 5HFQA 5FE7A 4QSUA 2L5EA 5DY7A 5I29A 4ZC9A 3AADA 5EWCA 5D3JA 4NYXA 5IIDA 5D3TA 4YABA 4MR5A 5D26A 5G4SA 5D0CA 4TQNA 4YYIA 4CUSA 3U5JA 5E0RA 5ENIA 5EK9A 4X2IA 5DFCA 4QUTA 3QZSA 4QSQA 3QZVA 3U5NA 4ALGA 4A9IA 3P1CA 5CRMA 5J0DA 3JVJA 5CQ8A 4Z1QA 5BT3A 2DATA 2YW5A 2E7NA 4HXPA 5FE4A 3ZYUA 4O71A 5F5ZA 1WUGA 5EWVA 3D1DA 4CUPA 2YEMA 5FBXA 2YDWA 4NR6A 5FE0A 3MUKA 4YY6A 5D25A 5H1UA 4LC2A 5D24A 5EICA 4QY4A 4N4GA 5LJ2A 4XYAA 2R10A 5DFDA 5II2A 4XUAA 4YYHA 4O76A 5EWWA 4A9JA 5D3RA 5HM0A 4KV1A 4QEVA 4DONA 5I7XA 4QEWA 5F25A 4Z93A 1WUMA 4PCEA 4Q0NA 4O7EA 4QUUA 5ENCA 4TTEA 4A9FA 5C8GA 3LQIA 3I3JA 4A9OA 5CUEA 3IU5A 5A81A 5ENGA 4E96A 4BHWA 5A83A 2WP2A 5CUCA 4TU6A 4HXLA 4HBWA 5C4QA 4YH4A 4ZW1A 4A9MA 4Q0OA 2DKWA 4YATA 4OGIA 4WHWA 4UIWA 4PTBA 5L98A 3FKMX 2NXBA 5A7CA 4XY8A 5A5QA 5E9MA 4LYIA 4BW2A 5I7YA 4YY4A 4TT2A 3LQHA 5DFBA 4QSTA 4NQNA 5HQ6A 5DLZA 5CPEA 3DWYA 3U5KA 4IR5A 3O36A 5EQ1A 2F6NA 4NS5A 4CFKA 5C7NA 5FG4A 4QSVA 4J3IA 5FE8A 5KTUA 5HFRA 2OO1A 5CFWA 5CQAA 4J0RA 4RVRA 4FLPA 2RNWA 5E74A 4N4IA 4O78A 5EV9A 3K2JA 4TU4A 3IU6A 1ZKRA 4AKIA 5L99A 4BW3A 4UIYA 5E3GA 5HELA 2YYNA 4LYWA 3GG3A 5AD3A 4YYJA 2EJNA 3UVWA 4KCXA 5L96A 5EPRA 5FFWA 3SVHA 2F6JA 5FE9A 5CQ3A 4BW1A 5AMFA 5F63A 5F36A 4NXJA 4O75A 3UVYA 4HBVA 5EP7A 2G4AA 4C67A 4AKGA 5LVRA 4MEPA 5E9KA 4NUCA 5HRWA 2E7OA 4HXRA 5CQ5A 5E9IA 5ETBA 4BJXA 4HBXA 5AMEA 5EWHA 5HLSA 3Q2FA 2D9EA 2E3KA 4WHUA 3JVKA 4QC1A 5F2PA 2DVVA 4YK0A 3LXJA 5HRVA 5D3PA 4QEUA 5HENA 4YYMA 4NR5A 5CQ6A 4MR4A 5A82A 1JM4B 3DAIA 4TZ8A 1N72A 2DVRA 3QZTA 5ENHA 5CS8A 3UW9A 4Z1SA 5JWMA 5FE1A 5FFVA 4IORA 5L8TA 5FFYA 4MEQA 3U5MA 4A9EA 3D7CA 3ERRA 5TB6A 4TT4A 2L85A 4LZ2A 4MEOA 4NYWA 4XY9A 2RNYA 4UIXA 4UYHA 5EGUA 3P1DA 4HXKA 5C87A 5ACYA 3P5OA 5FH7A 4IOQA 2R0VA 5F62A 4YYGA 5EU1A 5CGPA 5L97A 5LJ0A
chains in the Genus database with same CATH topology
4HXOA 3MULA 3O37A 5A5OA 1X0JA 4WIVA 5IGLA 3UV2A 5CUBA 3UV4A 3UVXA 5CTLA 4N4FA 4NRBA 5HEMA 2WP1A 4QB3A 5KU3A 5I83A 2MJVB 4A9HA 4J0SA 2H60A 5E9YA 4PKLA 5G4RA 3U5LA 4O7FA 4LRGA 5A85A 4NR8A 5DBMA 5DYAA 4AKNA 2YQDA 5FE3A 4UIUA 5I1QA 4QSWA 4KV4A 4UIZA 4HBYA 3O34A 1ZS5A 5FE2A 5TCMA 4YYNA 3P1FA 4YYKA 2D82A 5DYCA 4CL9A 5FB0A 5ENEA 4ALHA 5LVQA 5FE6A 5IGKA 3SVGA 5DLXA 4LR6A 3MQMA 5CQTA 2RNXA 4NUDA 3HMFA 5CQ7A 5H1VA 3HMHA 4CURA 4HXMA 4CUTA 4MR3A 4C66A 5ENJA 4QR4A 3SVFA 4O70A 4UIVA 5D7XA 3G0JA 2RO1A 4QBMA 2FSAA 5D3SA 4O72A 3LQJA 3U5OA 5DW1A 4NQMA 4QSRA 2I8NA 2LSPB 5I88A 2GRCA 4LYSA 3P1EA 5C85A 4CLBA 5I89A 5HRXA 4YAXA 2I7KA 4QNSA 5IGMA 4QSPA 5A5NA 3LJWA 4O77A 4GPJA 2RFJA 4QR3A 3UV5A 5KO4A 3MXFA 4UYEA 5I40A 3RCWA 5LKZA 5HQ7A 4LZRA 4NR9A 2DVQA 5EI4A 4N4HA 5A5PA 5H85A 4QSSA 2DVSA 4TZ2A 4BW4A 3Q2EA 5LKUA 5D3NA 4TT6A 2RI7A 2OSSA 2RS9B 5DYUA 5DKCA 4OGJA 3U5PA 4NUEA 5ENBA 3MB3A 4O74A 3S91A 4O7BA 4PY6A 4QR5A 4XUBA 5CZGA 4NRAA 4LZSA 5FDZA 5F3AA 3O35A 5DYXA 5D3HA 2N9GA 5IG6A 5F61A 5FG6A 5I86A 5E9VA 5BT4A 5LUUA 4YH3A 5LKTA 5L8UA 4QZSA 4UYGA 5HJCA 4IR6A 5EVAA 4TS8A 5ENFA 4PS5A 4CFLA 4A9NA 3NXBA 5JI8A 4QYLA 5COIA 5DKDA 4CUQA 5EISA 4MR6A 2OUOA 4HXNA 5AD2A 5BT5A 5EWDA 4YBTA 2YEKA 5CRZA 5E3DA 4NR7A 5F60A 4Z6HA 4UITA 5A5SA 4NR4A 4Z6IA 2L84A 4CUUA 3UVDA 4NYVA 5CP5A 5E73A 5CUAA 5E7DA 5CUDA 4LDFA 1E6IA 4ZQLA 5F1HA 4YBSA 5C89A 5KTXA 3S92A 4NRCA 5CQ4A 1F68A 4HXSA 3TLPA 5IGNA 4IOOA 5E9LA 5FB1A 5F1LA 4A9LA 4F3IA 3JVMA 3AQAA 5II1A 5FG5A 3O33A 4MENA 5DX4A 4PCIA 5HCLA 4QSXA 3ONIA 3HMEA 5EPBA 4QC3A 5CUGA 5K29A 4UYDA 4J1PA 5FH8A 3G0LA 4UYFB 5KHMA 4A9KA 1JSPB 4YBMA 5I80A 4OUFA 5A5RA 4TYLA 5LJ1A 4Y03A 4N3WA 4YYDA 5D3LA 4QYDA 5KTWA 5EM3A 2YELA 2R0YA 5FE5A 5CU8A 4O7CA 5ETDA 5CY9A 5EPSA 4O7AA 1EQFA 5LKXA 5EA1A 5IBNA 2R0SA 5DW2A 4YADA 2KTBB 4UYFA 5HQ5A 4IR3A 3MB4A 4IR4A 5DKHA 5FH6A 4YC9A 2DWWA 5H1TA 3JVLA 5HFQA 5FE7A 4QSUA 2L5EA 5DY7A 5I29A 4ZC9A 3AADA 5EWCA 5D3JA 4NYXA 5IIDA 5D3TA 4YABA 4MR5A 5D26A 5G4SA 5D0CA 4TQNA 4YYIA 4CUSA 3U5JA 5E0RA 5ENIA 5EK9A 4X2IA 5DFCA 4QUTA 3QZSA 4QSQA 3QZVA 3U5NA 4ALGA 4A9IA 3P1CA 5CRMA 5J0DA 3JVJA 5CQ8A 4Z1QA 5BT3A 2DATA 2YW5A 2E7NA 4HXPA 5FE4A 3ZYUA 4O71A 5F5ZA 1WUGA 5EWVA 4CUPA 2YEMA 5FBXA 2YDWA 4NR6A 5FE0A 3MUKA 4YY6A 5D25A 5H1UA 4LC2A 5D24A 5EICA 4QY4A 4N4GA 5LJ2A 4XYAA 2R10A 5DFDA 5II2A 4XUAA 4YYHA 4O76A 5EWWA 4A9JA 5D3RA 5HM0A 4KV1A 4QEVA 4DONA 5I7XA 4QEWA 5F25A 4Z93A 1WUMA 4PCEA 4Q0NA 4O7EA 4QUUA 5ENCA 4TTEA 4A9FA 5C8GA 3LQIA 3I3JA 4A9OA 5CUEA 3IU5A 5A81A 5ENGA 4E96A 4BHWA 5A83A 2WP2A 5CUCA 4TU6A 4HXLA 4HBWA 5C4QA 4YH4A 4ZW1A 4A9MA 4Q0OA 2DKWA 4YATA 4OGIA 4WHWA 4UIWA 4PTBA 5L98A 3FKMX 2NXBA 5A7CA 4XY8A 5A5QA 5E9MA 4LYIA 4BW2A 5I7YA 4YY4A 4TT2A 3LQHA 5DFBA 4QSTA 4NQNA 5HQ6A 5DLZA 5CPEA 3DWYA 3U5KA 4IR5A 3O36A 5EQ1A 2F6NA 4NS5A 4CFKA 5C7NA 5FG4A 4QSVA 4J3IA 5FE8A 5KTUA 5HFRA 2OO1A 5CFWA 5CQAA 4J0RA 4RVRA 4FLPA 2RNWA 5E74A 4N4IA 4O78A 5EV9A 3K2JA 4TU4A 3IU6A 5L99A 4BW3A 4UIYA 5E3GA 5HELA 2YYNA 4LYWA 3GG3A 5AD3A 4YYJA 3UVWA 4KCXA 5L96A 5EPRA 5FFWA 3SVHA 2F6JA 5FE9A 5CQ3A 4BW1A 5AMFA 5F63A 5F36A 4NXJA 4O75A 3UVYA 4HBVA 5EP7A 2G4AA 4C67A 5LVRA 4MEPA 5E9KA 4NUCA 5HRWA 2E7OA 4HXRA 5CQ5A 5E9IA 5ETBA 4BJXA 4HBXA 5AMEA 5EWHA 5HLSA 3Q2FA 2D9EA 2E3KA 4WHUA 3JVKA 4QC1A 5F2PA 2DVVA 4YK0A 3LXJA 5HRVA 5D3PA 4QEUA 5HENA 4YYMA 4NR5A 5CQ6A 4MR4A 5A82A 1JM4B 3DAIA 4TZ8A 1N72A 2DVRA 3QZTA 5ENHA 5CS8A 3UW9A 4Z1SA 5JWMA 5FE1A 5FFVA 4IORA 5L8TA 5FFYA 4MEQA 3U5MA 4A9EA 3D7CA 5TB6A 4TT4A 2L85A 4LZ2A 4MEOA 4NYWA 4XY9A 2RNYA 4UIXA 4UYHA 5EGUA 3P1DA 4HXKA 5C87A 5ACYA 3P5OA 5FH7A 4IOQA 2R0VA 5F62A 4YYGA 5EU1A 5CGPA 5L97A 5LJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXO A;  3MUL A;  3O37 A;  5A5O A;  1X0J A;  4WIV A;  5IGL A;  3UV2 A;  5CUB A;  3UV4 A;  3UVX A;  5CTL A;  4N4F A;  4NRB A;  5HEM A;  2WP1 A;  4QB3 A;  5KU3 A;  5I83 A;  2MJV B;  4A9H A;  4J0S A;  2H60 A;  5E9Y A;  4PKL A;  5G4R A;  3U5L A;  4O7F A;  4LRG A;  5A85 A;  4NR8 A;  5DBM A;  5DYA A;  4AKN A;  2YQD A;  5FE3 A;  4UIU A;  5I1Q A;  4QSW A;  4KV4 A;  4UIZ A;  4HBY A;  3O34 A;  1ZS5 A;  5FE2 A;  5TCM A;  4YYN A;  3P1F A;  4YYK A;  2D82 A;  5DYC A;  4CL9 A;  5FB0 A;  5ENE A;  4ALH A;  5LVQ A;  5FE6 A;  5IGK A;  3SVG A;  5DLX A;  4LR6 A;  3MQM A;  5CQT A;  2RNX A;  4NUD A;  3HMF A;  5CQ7 A;  5H1V A;  3HMH A;  4CUR A;  4HXM A;  4CUT A;  4MR3 A;  4C66 A;  5ENJ A;  4QR4 A;  3SVF A;  4O70 A;  4UIV A;  5D7X A;  3G0J A;  2RO1 A;  4QBM A;  2FSA A;  5D3S A;  4O72 A;  3LQJ A;  3U5O A;  5DW1 A;  4NQM A;  4QSR A;  2I8N A;  2LSP B;  5I88 A;  2GRC A;  4LYS A;  3P1E A;  5C85 A;  4CLB A;  5I89 A;  5HRX A;  4YAX A;  2I7K A;  4QNS A;  5IGM A;  4QSP A;  5A5N A;  3LJW A;  4O77 A;  4GPJ A;  2RFJ A;  4QR3 A;  3UV5 A;  5KO4 A;  3MXF A;  4UYE A;  5I40 A;  3RCW A;  5LKZ A;  5HQ7 A;  4LZR A;  4NR9 A;  2DVQ A;  5EI4 A;  4N4H A;  5A5P A;  5H85 A;  4QSS A;  2DVS A;  4TZ2 A;  4BW4 A;  3Q2E A;  5LKU A;  5D3N A;  4TT6 A;  2RI7 A;  2OSS A;  2RS9 B;  5DYU A;  5DKC A;  4OGJ A;  3U5P A;  4NUE A;  5ENB A;  3MB3 A;  4O74 A;  3S91 A;  4O7B A;  4PY6 A;  4QR5 A;  4XUB A;  5CZG A;  4NRA A;  4LZS A;  5FDZ A;  5F3A A;  3O35 A;  5DYX A;  5D3H A;  2N9G A;  5IG6 A;  5F61 A;  5FG6 A;  5I86 A;  5E9V A;  5BT4 A;  5LUU A;  4YH3 A;  5LKT A;  5L8U A;  4QZS A;  4UYG A;  5HJC A;  4IR6 A;  5EVA A;  4TS8 A;  5ENF A;  4PS5 A;  4CFL A;  4A9N A;  3NXB A;  5JI8 A;  4QYL A;  5COI A;  5DKD A;  4CUQ A;  5EIS A;  4MR6 A;  2OUO A;  4HXN A;  5AD2 A;  5BT5 A;  5EWD A;  4YBT A;  2YEK A;  5CRZ A;  5E3D A;  4NR7 A;  5F60 A;  4Z6H A;  4UIT A;  5A5S A;  4NR4 A;  4Z6I A;  2L84 A;  4CUU A;  3UVD A;  4NYV A;  5CP5 A;  5E73 A;  5CUA A;  5E7D A;  5CUD A;  4LDF A;  1E6I A;  4ZQL A;  5F1H A;  4YBS A;  5C89 A;  5KTX A;  3S92 A;  4NRC A;  5CQ4 A;  1F68 A;  4HXS A;  3TLP A;  5IGN A;  4IOO A;  5E9L A;  5FB1 A;  5F1L A;  4A9L A;  4F3I A;  3JVM A;  3AQA A;  5II1 A;  5FG5 A;  3O33 A;  4MEN A;  5DX4 A;  4PCI A;  5HCL A;  4QSX A;  3ONI A;  3HME A;  5EPB A;  4QC3 A;  5CUG A;  5K29 A;  4UYD A;  4J1P A;  5FH8 A;  3G0L A;  4UYF B;  5KHM A;  4A9K A;  1JSP B;  4YBM A;  5I80 A;  4OUF A;  5A5R A;  4TYL A;  5LJ1 A;  4Y03 A;  4N3W A;  4YYD A;  5D3L A;  4QYD A;  5KTW A;  5EM3 A;  2YEL A;  2R0Y A;  5FE5 A;  5CU8 A;  4O7C A;  5ETD A;  5CY9 A;  5EPS A;  4O7A A;  1EQF A;  5LKX A;  5EA1 A;  5IBN A;  2R0S A;  5DW2 A;  4YAD A;  2KTB B;  4UYF A;  5HQ5 A;  4IR3 A;  3MB4 A;  4IR4 A;  5DKH A;  5FH6 A;  4YC9 A;  2DWW A;  5H1T A;  3JVL A;  5HFQ A;  5FE7 A;  4QSU A;  2L5E A;  5DY7 A;  5I29 A;  4ZC9 A;  3AAD A;  5EWC A;  5D3J A;  4NYX A;  5IID A;  5D3T A;  4YAB A;  4MR5 A;  5D26 A;  5G4S A;  5D0C A;  4TQN A;  4YYI A;  4CUS A;  3U5J A;  5E0R A;  5ENI A;  5EK9 A;  4X2I A;  5DFC A;  4QUT A;  3QZS A;  4QSQ A;  3QZV A;  3U5N A;  4ALG A;  4A9I A;  3P1C A;  5CRM A;  5J0D A;  3JVJ A;  5CQ8 A;  4Z1Q A;  5BT3 A;  2DAT A;  2YW5 A;  2E7N A;  4HXP A;  5FE4 A;  3ZYU A;  4O71 A;  5F5Z A;  1WUG A;  5EWV A;  4CUP A;  2YEM A;  5FBX A;  2YDW A;  4NR6 A;  5FE0 A;  3MUK A;  4YY6 A;  5D25 A;  5H1U A;  4LC2 A;  5D24 A;  5EIC A;  4QY4 A;  4N4G A;  5LJ2 A;  4XYA A;  2R10 A;  5DFD A;  5II2 A;  4XUA A;  4YYH A;  4O76 A;  5EWW A;  4A9J A;  5D3R A;  5HM0 A;  4KV1 A;  4QEV A;  4DON A;  5I7X A;  4QEW A;  5F25 A;  4Z93 A;  1WUM A;  4PCE A;  4Q0N A;  4O7E A;  4QUU A;  5ENC A;  4TTE A;  4A9F A;  5C8G A;  3LQI A;  3I3J A;  4A9O A;  5CUE A;  3IU5 A;  5A81 A;  5ENG A;  4E96 A;  4BHW A;  5A83 A;  2WP2 A;  5CUC A;  4TU6 A;  4HXL A;  4HBW A;  5C4Q A;  4YH4 A;  4ZW1 A;  4A9M A;  4Q0O A;  2DKW A;  4YAT A;  4OGI A;  4WHW A;  4UIW A;  4PTB A;  5L98 A;  3FKM X;  2NXB A;  5A7C A;  4XY8 A;  5A5Q A;  5E9M A;  4LYI A;  4BW2 A;  5I7Y A;  4YY4 A;  4TT2 A;  3LQH A;  5DFB A;  4QST A;  4NQN A;  5HQ6 A;  5DLZ A;  5CPE A;  3DWY A;  3U5K A;  4IR5 A;  3O36 A;  5EQ1 A;  2F6N A;  4NS5 A;  4CFK A;  5C7N A;  5FG4 A;  4QSV A;  4J3I A;  5FE8 A;  5KTU A;  5HFR A;  2OO1 A;  5CFW A;  5CQA A;  4J0R A;  4RVR A;  4FLP A;  2RNW A;  5E74 A;  4N4I A;  4O78 A;  5EV9 A;  3K2J A;  4TU4 A;  3IU6 A;  5L99 A;  4BW3 A;  4UIY A;  5E3G A;  5HEL A;  2YYN A;  4LYW A;  3GG3 A;  5AD3 A;  4YYJ A;  3UVW A;  4KCX A;  5L96 A;  5EPR A;  5FFW A;  3SVH A;  2F6J A;  5FE9 A;  5CQ3 A;  4BW1 A;  5AMF A;  5F63 A;  5F36 A;  4NXJ A;  4O75 A;  3UVY A;  4HBV A;  5EP7 A;  2G4A A;  4C67 A;  5LVR A;  4MEP A;  5E9K A;  4NUC A;  5HRW A;  2E7O A;  4HXR A;  5CQ5 A;  5E9I A;  5ETB A;  4BJX A;  4HBX A;  5AME A;  5EWH A;  5HLS A;  3Q2F A;  2D9E A;  2E3K A;  4WHU A;  3JVK A;  4QC1 A;  5F2P A;  2DVV A;  4YK0 A;  3LXJ A;  5HRV A;  5D3P A;  4QEU A;  5HEN A;  4YYM A;  4NR5 A;  5CQ6 A;  4MR4 A;  5A82 A;  1JM4 B;  3DAI A;  4TZ8 A;  1N72 A;  2DVR A;  3QZT A;  5ENH A;  5CS8 A;  3UW9 A;  4Z1S A;  5JWM A;  5FE1 A;  5FFV A;  4IOR A;  5L8T A;  5FFY A;  4MEQ A;  3U5M A;  4A9E A;  3D7C A;  5TB6 A;  4TT4 A;  2L85 A;  4LZ2 A;  4MEO A;  4NYW A;  4XY9 A;  2RNY A;  4UIX A;  4UYH A;  5EGU A;  3P1D A;  4HXK A;  5C87 A;  5ACY A;  3P5O A;  5FH7 A;  4IOQ A;  2R0V A;  5F62 A;  4YYG A;  5EU1 A;  5CGP A;  5L97 A;  5LJ0 A; 
#chains in the Genus database with same CATH topology
 4HXO A;  3MUL A;  3O37 A;  5A5O A;  1X0J A;  4WIV A;  5IGL A;  3UV2 A;  5CUB A;  3UV4 A;  1PUO A;  3UVX A;  5CTL A;  3D1B A;  4N4F A;  4NRB A;  5HEM A;  2WP1 A;  4QB3 A;  5KU3 A;  5I83 A;  2MJV B;  4A9H A;  4J0S A;  2H60 A;  3VKH A;  5E9Y A;  4PKL A;  5G4R A;  3U5L A;  4O7F A;  4LRG A;  5A85 A;  4NR8 A;  5DBM A;  5DYA A;  4AKN A;  2YQD A;  5FE3 A;  4UIU A;  5I1Q A;  4QSW A;  4KV4 A;  4UIZ A;  4HBY A;  3O34 A;  1ZS5 A;  5FE2 A;  5TCM A;  4YYN A;  3P1F A;  4YYK A;  2D82 A;  5DYC A;  4CL9 A;  5FB0 A;  5ENE A;  4ALH A;  5LVQ A;  5FE6 A;  5IGK A;  3SVG A;  5DLX A;  4LR6 A;  3MQM A;  5CQT A;  2RNX A;  4NUD A;  3HMF A;  5CQ7 A;  5H1V A;  3HMH A;  4CUR A;  4HXM A;  4CUT A;  4MR3 A;  4C66 A;  5ENJ A;  4QR4 A;  3SVF A;  4O70 A;  4UIV A;  5D7X A;  3G0J A;  2RO1 A;  4QBM A;  2FSA A;  5D3S A;  4O72 A;  3LQJ A;  3U5O A;  5DW1 A;  4NQM A;  4QSR A;  2I8N A;  2LSP B;  5I88 A;  2GRC A;  4LYS A;  3P1E A;  5C85 A;  4CLB A;  5I89 A;  5HRX A;  4YAX A;  2I7K A;  4QNS A;  5IGM A;  4QSP A;  5A5N A;  3LJW A;  4O77 A;  4GPJ A;  2RFJ A;  4QR3 A;  3UV5 A;  5KO4 A;  3MXF A;  4UYE A;  5I40 A;  3RCW A;  5LKZ A;  5HQ7 A;  4LZR A;  4NR9 A;  2DVQ A;  5EI4 A;  4N4H A;  5A5P A;  5H85 A;  4QSS A;  2DVS A;  4TZ2 A;  4BW4 A;  3Q2E A;  5LKU A;  5D3N A;  4TT6 A;  2RI7 A;  2OSS A;  4AI6 A;  2RS9 B;  5DYU A;  5DKC A;  4OGJ A;  3U5P A;  4NUE A;  5ENB A;  3MB3 A;  4O74 A;  3S91 A;  4O7B A;  4PY6 A;  4QR5 A;  4XUB A;  5CZG A;  4NRA A;  4LZS A;  5FDZ A;  5F3A A;  3O35 A;  5DYX A;  5D3H A;  2N9G A;  5IG6 A;  5F61 A;  5FG6 A;  5I86 A;  3VKG A;  5E9V A;  5BT4 A;  5LUU A;  4YH3 A;  5LKT A;  5L8U A;  4QZS A;  4UYG A;  5HJC A;  4IR6 A;  5EVA A;  4TS8 A;  5ENF A;  4PS5 A;  4CFL A;  4A9N A;  3NXB A;  5JI8 A;  4QYL A;  5COI A;  5DKD A;  4CUQ A;  5EIS A;  4MR6 A;  2OUO A;  4HXN A;  5AD2 A;  5BT5 A;  5EWD A;  4YBT A;  2YEK A;  5CRZ A;  5E3D A;  4NR7 A;  5F60 A;  4Z6H A;  4UIT A;  5A5S A;  4NR4 A;  4Z6I A;  2L84 A;  4CUU A;  3UVD A;  4NYV A;  5CP5 A;  5E73 A;  5CUA A;  5E7D A;  5CUD A;  4LDF A;  1E6I A;  4ZQL A;  5F1H A;  4YBS A;  5C89 A;  5KTX A;  3S92 A;  4NRC A;  5CQ4 A;  1F68 A;  4HXS A;  3TLP A;  5IGN A;  4IOO A;  5E9L A;  5FB1 A;  5F1L A;  4A9L A;  4F3I A;  3JVM A;  3AQA A;  5II1 A;  5FG5 A;  3O33 A;  4MEN A;  5DX4 A;  4PCI A;  5HCL A;  4QSX A;  3ONI A;  3HME A;  5EPB A;  4QC3 A;  5CUG A;  5K29 A;  4UYD A;  4J1P A;  5FH8 A;  4AKH A;  3G0L A;  4UYF B;  5KHM A;  4A9K A;  1JSP B;  4YBM A;  5I80 A;  4OUF A;  5A5R A;  4TYL A;  5LJ1 A;  4Y03 A;  4N3W A;  4YYD A;  5D3L A;  4QYD A;  5KTW A;  5EM3 A;  2YEL A;  2R0Y A;  5FE5 A;  5CU8 A;  4O7C A;  5ETD A;  5CY9 A;  5EPS A;  4O7A A;  1EQF A;  5LKX A;  5EA1 A;  5IBN A;  2R0S A;  5DW2 A;  4YAD A;  2KTB B;  4UYF A;  5HQ5 A;  4IR3 A;  3MB4 A;  4IR4 A;  5DKH A;  5FH6 A;  4YC9 A;  2DWW A;  5H1T A;  3JVL A;  5HFQ A;  5FE7 A;  4QSU A;  2L5E A;  5DY7 A;  5I29 A;  4ZC9 A;  3AAD A;  5EWC A;  5D3J A;  4NYX A;  5IID A;  5D3T A;  4YAB A;  4MR5 A;  5D26 A;  5G4S A;  5D0C A;  4TQN A;  4YYI A;  4CUS A;  3U5J A;  5E0R A;  5ENI A;  5EK9 A;  4X2I A;  5DFC A;  4QUT A;  3QZS A;  4QSQ A;  3QZV A;  3U5N A;  4ALG A;  4A9I A;  3P1C A;  5CRM A;  5J0D A;  3JVJ A;  5CQ8 A;  4Z1Q A;  5BT3 A;  2DAT A;  2YW5 A;  2E7N A;  4HXP A;  5FE4 A;  3ZYU A;  4O71 A;  5F5Z A;  1WUG A;  5EWV A;  3D1D A;  4CUP A;  2YEM A;  5FBX A;  2YDW A;  4NR6 A;  5FE0 A;  3MUK A;  4YY6 A;  5D25 A;  5H1U A;  4LC2 A;  5D24 A;  5EIC A;  4QY4 A;  4N4G A;  5LJ2 A;  4XYA A;  2R10 A;  5DFD A;  5II2 A;  4XUA A;  4YYH A;  4O76 A;  5EWW A;  4A9J A;  5D3R A;  5HM0 A;  4KV1 A;  4QEV A;  4DON A;  5I7X A;  4QEW A;  5F25 A;  4Z93 A;  1WUM A;  4PCE A;  4Q0N A;  4O7E A;  4QUU A;  5ENC A;  4TTE A;  4A9F A;  5C8G A;  3LQI A;  3I3J A;  4A9O A;  5CUE A;  3IU5 A;  5A81 A;  5ENG A;  4E96 A;  4BHW A;  5A83 A;  2WP2 A;  5CUC A;  4TU6 A;  4HXL A;  4HBW A;  5C4Q A;  4YH4 A;  4ZW1 A;  4A9M A;  4Q0O A;  2DKW A;  4YAT A;  4OGI A;  4WHW A;  4UIW A;  4PTB A;  5L98 A;  3FKM X;  2NXB A;  5A7C A;  4XY8 A;  5A5Q A;  5E9M A;  4LYI A;  4BW2 A;  5I7Y A;  4YY4 A;  4TT2 A;  3LQH A;  5DFB A;  4QST A;  4NQN A;  5HQ6 A;  5DLZ A;  5CPE A;  3DWY A;  3U5K A;  4IR5 A;  3O36 A;  5EQ1 A;  2F6N A;  4NS5 A;  4CFK A;  5C7N A;  5FG4 A;  4QSV A;  4J3I A;  5FE8 A;  5KTU A;  5HFR A;  2OO1 A;  5CFW A;  5CQA A;  4J0R A;  4RVR A;  4FLP A;  2RNW A;  5E74 A;  4N4I A;  4O78 A;  5EV9 A;  3K2J A;  4TU4 A;  3IU6 A;  1ZKR A;  4AKI A;  5L99 A;  4BW3 A;  4UIY A;  5E3G A;  5HEL A;  2YYN A;  4LYW A;  3GG3 A;  5AD3 A;  4YYJ A;  2EJN A;  3UVW A;  4KCX A;  5L96 A;  5EPR A;  5FFW A;  3SVH A;  2F6J A;  5FE9 A;  5CQ3 A;  4BW1 A;  5AMF A;  5F63 A;  5F36 A;  4NXJ A;  4O75 A;  3UVY A;  4HBV A;  5EP7 A;  2G4A A;  4C67 A;  4AKG A;  5LVR A;  4MEP A;  5E9K A;  4NUC A;  5HRW A;  2E7O A;  4HXR A;  5CQ5 A;  5E9I A;  5ETB A;  4BJX A;  4HBX A;  5AME A;  5EWH A;  5HLS A;  3Q2F A;  2D9E A;  2E3K A;  4WHU A;  3JVK A;  4QC1 A;  5F2P A;  2DVV A;  4YK0 A;  3LXJ A;  5HRV A;  5D3P A;  4QEU A;  5HEN A;  4YYM A;  4NR5 A;  5CQ6 A;  4MR4 A;  5A82 A;  1JM4 B;  3DAI A;  4TZ8 A;  1N72 A;  2DVR A;  3QZT A;  5ENH A;  5CS8 A;  3UW9 A;  4Z1S A;  5JWM A;  5FE1 A;  5FFV A;  4IOR A;  5L8T A;  5FFY A;  4MEQ A;  3U5M A;  4A9E A;  3D7C A;  3ERR A;  5TB6 A;  4TT4 A;  2L85 A;  4LZ2 A;  4MEO A;  4NYW A;  4XY9 A;  2RNY A;  4UIX A;  4UYH A;  5EGU A;  3P1D A;  4HXK A;  5C87 A;  5ACY A;  3P5O A;  5FH7 A;  4IOQ A;  2R0V A;  5F62 A;  4YYG A;  5EU1 A;  5CGP A;  5L97 A;  5LJ0 A; 
#chains in the Genus database with same CATH homology
 4HXO A;  3MUL A;  3O37 A;  5A5O A;  1X0J A;  4WIV A;  5IGL A;  3UV2 A;  5CUB A;  3UV4 A;  3UVX A;  5CTL A;  4N4F A;  4NRB A;  5HEM A;  2WP1 A;  4QB3 A;  5KU3 A;  5I83 A;  2MJV B;  4A9H A;  4J0S A;  2H60 A;  5E9Y A;  4PKL A;  5G4R A;  3U5L A;  4O7F A;  4LRG A;  5A85 A;  4NR8 A;  5DBM A;  5DYA A;  4AKN A;  2YQD A;  5FE3 A;  4UIU A;  5I1Q A;  4QSW A;  4KV4 A;  4UIZ A;  4HBY A;  3O34 A;  1ZS5 A;  5FE2 A;  5TCM A;  4YYN A;  3P1F A;  4YYK A;  2D82 A;  5DYC A;  4CL9 A;  5FB0 A;  5ENE A;  4ALH A;  5LVQ A;  5FE6 A;  5IGK A;  3SVG A;  5DLX A;  4LR6 A;  3MQM A;  5CQT A;  2RNX A;  4NUD A;  3HMF A;  5CQ7 A;  5H1V A;  3HMH A;  4CUR A;  4HXM A;  4CUT A;  4MR3 A;  4C66 A;  5ENJ A;  4QR4 A;  3SVF A;  4O70 A;  4UIV A;  5D7X A;  3G0J A;  2RO1 A;  4QBM A;  2FSA A;  5D3S A;  4O72 A;  3LQJ A;  3U5O A;  5DW1 A;  4NQM A;  4QSR A;  2I8N A;  2LSP B;  5I88 A;  2GRC A;  4LYS A;  3P1E A;  5C85 A;  4CLB A;  5I89 A;  5HRX A;  4YAX A;  2I7K A;  4QNS A;  5IGM A;  4QSP A;  5A5N A;  3LJW A;  4O77 A;  4GPJ A;  2RFJ A;  4QR3 A;  3UV5 A;  5KO4 A;  3MXF A;  4UYE A;  5I40 A;  3RCW A;  5LKZ A;  5HQ7 A;  4LZR A;  4NR9 A;  2DVQ A;  5EI4 A;  4N4H A;  5A5P A;  5H85 A;  4QSS A;  2DVS A;  4TZ2 A;  4BW4 A;  3Q2E A;  5LKU A;  5D3N A;  4TT6 A;  2RI7 A;  2OSS A;  2RS9 B;  5DYU A;  5DKC A;  4OGJ A;  3U5P A;  4NUE A;  5ENB A;  3MB3 A;  4O74 A;  3S91 A;  4O7B A;  4PY6 A;  4QR5 A;  4XUB A;  5CZG A;  4NRA A;  4LZS A;  5FDZ A;  5F3A A;  3O35 A;  5DYX A;  5D3H A;  2N9G A;  5IG6 A;  5F61 A;  5FG6 A;  5I86 A;  5E9V A;  5BT4 A;  5LUU A;  4YH3 A;  5LKT A;  5L8U A;  4QZS A;  4UYG A;  5HJC A;  4IR6 A;  5EVA A;  4TS8 A;  5ENF A;  4PS5 A;  4CFL A;  4A9N A;  3NXB A;  5JI8 A;  4QYL A;  5COI A;  5DKD A;  4CUQ A;  5EIS A;  4MR6 A;  2OUO A;  4HXN A;  5AD2 A;  5BT5 A;  5EWD A;  4YBT A;  2YEK A;  5CRZ A;  5E3D A;  4NR7 A;  5F60 A;  4Z6H A;  4UIT A;  5A5S A;  4NR4 A;  4Z6I A;  2L84 A;  4CUU A;  3UVD A;  4NYV A;  5CP5 A;  5E73 A;  5CUA A;  5E7D A;  5CUD A;  4LDF A;  1E6I A;  4ZQL A;  5F1H A;  4YBS A;  5C89 A;  5KTX A;  3S92 A;  4NRC A;  5CQ4 A;  1F68 A;  4HXS A;  3TLP A;  5IGN A;  4IOO A;  5E9L A;  5FB1 A;  5F1L A;  4A9L A;  4F3I A;  3JVM A;  3AQA A;  5II1 A;  5FG5 A;  3O33 A;  4MEN A;  5DX4 A;  4PCI A;  5HCL A;  4QSX A;  3ONI A;  3HME A;  5EPB A;  4QC3 A;  5CUG A;  5K29 A;  4UYD A;  4J1P A;  5FH8 A;  3G0L A;  4UYF B;  5KHM A;  4A9K A;  1JSP B;  4YBM A;  5I80 A;  4OUF A;  5A5R A;  4TYL A;  5LJ1 A;  4Y03 A;  4N3W A;  4YYD A;  5D3L A;  4QYD A;  5KTW A;  5EM3 A;  2YEL A;  2R0Y A;  5FE5 A;  5CU8 A;  4O7C A;  5ETD A;  5CY9 A;  5EPS A;  4O7A A;  1EQF A;  5LKX A;  5EA1 A;  5IBN A;  2R0S A;  5DW2 A;  4YAD A;  2KTB B;  4UYF A;  5HQ5 A;  4IR3 A;  3MB4 A;  4IR4 A;  5DKH A;  5FH6 A;  4YC9 A;  2DWW A;  5H1T A;  3JVL A;  5HFQ A;  5FE7 A;  4QSU A;  2L5E A;  5DY7 A;  5I29 A;  4ZC9 A;  3AAD A;  5EWC A;  5D3J A;  4NYX A;  5IID A;  5D3T A;  4YAB A;  4MR5 A;  5D26 A;  5G4S A;  5D0C A;  4TQN A;  4YYI A;  4CUS A;  3U5J A;  5E0R A;  5ENI A;  5EK9 A;  4X2I A;  5DFC A;  4QUT A;  3QZS A;  4QSQ A;  3QZV A;  3U5N A;  4ALG A;  4A9I A;  3P1C A;  5CRM A;  5J0D A;  3JVJ A;  5CQ8 A;  4Z1Q A;  5BT3 A;  2DAT A;  2YW5 A;  2E7N A;  4HXP A;  5FE4 A;  3ZYU A;  4O71 A;  5F5Z A;  1WUG A;  5EWV A;  4CUP A;  2YEM A;  5FBX A;  2YDW A;  4NR6 A;  5FE0 A;  3MUK A;  4YY6 A;  5D25 A;  5H1U A;  4LC2 A;  5D24 A;  5EIC A;  4QY4 A;  4N4G A;  5LJ2 A;  4XYA A;  2R10 A;  5DFD A;  5II2 A;  4XUA A;  4YYH A;  4O76 A;  5EWW A;  4A9J A;  5D3R A;  5HM0 A;  4KV1 A;  4QEV A;  4DON A;  5I7X A;  4QEW A;  5F25 A;  4Z93 A;  1WUM A;  4PCE A;  4Q0N A;  4O7E A;  4QUU A;  5ENC A;  4TTE A;  4A9F A;  5C8G A;  3LQI A;  3I3J A;  4A9O A;  5CUE A;  3IU5 A;  5A81 A;  5ENG A;  4E96 A;  4BHW A;  5A83 A;  2WP2 A;  5CUC A;  4TU6 A;  4HXL A;  4HBW A;  5C4Q A;  4YH4 A;  4ZW1 A;  4A9M A;  4Q0O A;  2DKW A;  4YAT A;  4OGI A;  4WHW A;  4UIW A;  4PTB A;  5L98 A;  3FKM X;  2NXB A;  5A7C A;  4XY8 A;  5A5Q A;  5E9M A;  4LYI A;  4BW2 A;  5I7Y A;  4YY4 A;  4TT2 A;  3LQH A;  5DFB A;  4QST A;  4NQN A;  5HQ6 A;  5DLZ A;  5CPE A;  3DWY A;  3U5K A;  4IR5 A;  3O36 A;  5EQ1 A;  2F6N A;  4NS5 A;  4CFK A;  5C7N A;  5FG4 A;  4QSV A;  4J3I A;  5FE8 A;  5KTU A;  5HFR A;  2OO1 A;  5CFW A;  5CQA A;  4J0R A;  4RVR A;  4FLP A;  2RNW A;  5E74 A;  4N4I A;  4O78 A;  5EV9 A;  3K2J A;  4TU4 A;  3IU6 A;  5L99 A;  4BW3 A;  4UIY A;  5E3G A;  5HEL A;  2YYN A;  4LYW A;  3GG3 A;  5AD3 A;  4YYJ A;  3UVW A;  4KCX A;  5L96 A;  5EPR A;  5FFW A;  3SVH A;  2F6J A;  5FE9 A;  5CQ3 A;  4BW1 A;  5AMF A;  5F63 A;  5F36 A;  4NXJ A;  4O75 A;  3UVY A;  4HBV A;  5EP7 A;  2G4A A;  4C67 A;  5LVR A;  4MEP A;  5E9K A;  4NUC A;  5HRW A;  2E7O A;  4HXR A;  5CQ5 A;  5E9I A;  5ETB A;  4BJX A;  4HBX A;  5AME A;  5EWH A;  5HLS A;  3Q2F A;  2D9E A;  2E3K A;  4WHU A;  3JVK A;  4QC1 A;  5F2P A;  2DVV A;  4YK0 A;  3LXJ A;  5HRV A;  5D3P A;  4QEU A;  5HEN A;  4YYM A;  4NR5 A;  5CQ6 A;  4MR4 A;  5A82 A;  1JM4 B;  3DAI A;  4TZ8 A;  1N72 A;  2DVR A;  3QZT A;  5ENH A;  5CS8 A;  3UW9 A;  4Z1S A;  5JWM A;  5FE1 A;  5FFV A;  4IOR A;  5L8T A;  5FFY A;  4MEQ A;  3U5M A;  4A9E A;  3D7C A;  5TB6 A;  4TT4 A;  2L85 A;  4LZ2 A;  4MEO A;  4NYW A;  4XY9 A;  2RNY A;  4UIX A;  4UYH A;  5EGU A;  3P1D A;  4HXK A;  5C87 A;  5ACY A;  3P5O A;  5FH7 A;  4IOQ A;  2R0V A;  5F62 A;  4YYG A;  5EU1 A;  5CGP A;  5L97 A;  5LJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...