5HENA

Crystal structure of the n-terminus r100l bromodomain mutant of human brd2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
109
structure length
109
Chain Sequence
VTNQLQYLHKVVMKALWKHQFAWPFLQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 2
publication title Crystal structure of the N-terminus R100L bromodomain mutant of human BRD2
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 37
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5henA00
4WHWA 5DYUA 5CQ8A 5D3NA 5EWWA 4Z1QA 5FE5A 5E9LA 4UYFB 4C66A 4YYJA 4KV1A 4QSTA 2YELA 3U5PA 4WIVA 3LQIA 2L84A 3P1EA 3LQJA 4XY9A 4E96A 5HFQA 3JVKA 5L99A 4LZ2A 3HMFA 5DW1A 5FE0A 4YYDA 5D3TA 5D0CA 3UV5A 4O7EA 5K29A 3UVDA 4Q0NA 4IR4A 3O37A 4A9EA 4NR6A 5H1VA 5C4QA 4IR6A 5I1QA 3FKMX 5H85A 5EWCA 3MB3A 2YYNA 5FFWA 4O77A 3P5OA 4LRGA 5ACYA 4UYDA 2WP1A 4C67A 4CUQA 5HFRA 5A5SA 2R0VA 5E0RA 5I89A 5E9IA 5II1A 4NQNA 4CUTA 4QEUA 4QZSA 5G4RA 4N4HA 4LZRA 5IGLA 4TS8A 5FB1A 5E9YA 4OGIA 5E73A 2GRCA 5HQ5A 5E9KA 1JSPB 5ENFA 2DVRA 2RI7A 4OGJA 5I7YA 2YW5A 4HXLA 3UW9A 2WP2A 5F36A 5KO4A 5G4SA 5D3PA 5EK9A 4DONA 4LYIA 2L5EA 2RNYA 4YABA 5D7XA 5D3SA 4UITA 4TT6A 5EU1A 5D3HA 4QB3A 5A5OA 4O72A 4RVRA 2RO1A 5LJ0A 3ZYUA 4O7CA 2E7OA 5CU8A 4UYFA 3S91A 5EP7A 3MUKA 4QR4A 2OSSA 5ENBA 4O71A 5LJ2A 4HXMA 4YY6A 5L96A 5D25A 5BT5A 3Q2FA 4MEPA 2H60A 5IGKA 3U5KA 5CUEA 4MR4A 2L85A 4PTBA 5IG6A 2MJVB 4X2IA 5DLXA 4LR6A 4PCEA 4YY4A 4NYXA 4NYVA 4NRBA 4J1PA 5EA1A 3MXFA 3RCWA 5A83A 5KU3A 5L8TA 4XY8A 5HRWA 4N4IA 5A5NA 4TZ8A 5DKCA 4XUBA 4J3IA 4N4FA 1N72A 4NQMA 5HELA 4TTEA 3AADA 3UVYA 5KTWA 5C8GA 2YDWA 5E3GA 3P1DA 3HMEA 3O35A 2RNWA 4Q0OA 3K2JA 3Q2EA 2N9GA 3LXJA 5FE6A 4A9NA 3I3JA 5A5RA 5IGNA 1F68A 4BW3A 3LQHA 3UVXA 4KCXA 5J0DA 2FSAA 5E9VA 5CY9A 4PCIA 4ZC9A 3JVMA 4TT2A 5DYCA 5EI4A 4KV4A 2LSPB 2RFJA 5EPSA 4YYHA 5FE4A 3SVFA 2I8NA 5FFYA 5DLZA 5BT3A 5I7XA 1E6IA 4QEWA 5EISA 2E7NA 3ONIA 5LJ1A 2DVSA 3QZSA 4F3IA 2OUOA 2RS9B 5FE1A 4BHWA 5LVRA 5JWMA 4NRAA 5DFDA 4OUFA 5CZGA 4QEVA 4PKLA 5ETDA 5FE8A 4MENA 5CQ3A 5FE9A 1EQFA 4IOOA 2R10A 4O7AA 5CRMA 3LJWA 4A9KA 5CUGA 5E74A 5CS8A 4TQNA 4NUCA 2YEKA 4YBMA 5I80A 4YBTA 3JVLA 4HXKA 4HXRA 4TYLA 5CUBA 4NXJA 5HEMA 5CQ6A 5FE2A 5KHMA 4MEOA 4O76A 4QYDA 5BT4A 2YEMA 3NXBA 5F3AA 4MR5A 5I86A 5F61A 4CLBA 4N3WA 4NR9A 2D82A 5HJCA 5C87A 5CUAA 4A9OA 5F5ZA 4A9FA 4J0RA 5HENA 5D24A 3P1CA 5CPEA 4QC1A 5FB0A 4UIUA 5EGUA 5H1UA 3DWYA 4QYLA 5KTUA 5FH6A 4QC3A 4QNSA 5EVAA 3HMHA 4YATA 4UYGA 3O36A 5LVQA 4XUAA 5FG6A 5COIA 4FLPA 4IOQA 4QR5A 4BJXA 5CTLA 5EV9A 4O78A 4UIZA 4TU6A 4NRCA 4O70A 4LYSA 5CQ7A 3SVGA 4LC2A 4QUUA 5FFVA 4O74A 3U5OA 4QSUA 4A9LA 4J0SA 2R0SA 4Z6HA 3UV4A 1WUMA 5D3RA 5DW2A 5C89A 5FH7A 3MULA 5II2A 5F62A 5HQ7A 5LUUA 4CUPA 3MQMA 5CUDA 4QSRA 5EPRA 5AMEA 5EWHA 5ENJA 4LZSA 4QSWA 4NUEA 2R0YA 4NYWA 4CUSA 4QSSA 5FBXA 4YH4A 5E9MA 5HCLA 4LDFA 4QSXA 5FG5A 3S92A 5I29A 5AMFA 5F1LA 5CGPA 4YAXA 4N4GA 4PY6A 5AD2A 2F6NA 4UYEA 5EQ1A 5IBNA 5TB6A 2YQDA 4NS5A 4QSVA 5F25A 3O34A 5HLSA 2D9EA 2F6JA 5E3DA 4QY4A 5DX4A 4CURA 2RNXA 5IGMA 4PS5A 4MR3A 3O33A 4CUUA 5C85A 5FE3A 2DVVA 2I7KA 4YK0A 5DYAA 5AD3A 5LKUA 5DY7A 4YYKA 2DATA 4NR4A 5ETBA 2DKWA 3P1FA 5EICA 4YH3A 5L8UA 4YYMA 3JVJA 4NR5A 4MR6A 5I40A 5F60A 3U5LA 5A7CA 5CQ4A 4QBMA 5L97A 4Z6IA 5DKHA 4QUTA 2DVQA 5ENGA 4Z1SA 3MB4A 5JI8A 3IU6A 2DWWA 4TU4A 5F2PA 5HQ6A 5HM0A 4Y03A 4CL9A 4YC9A 4QSQA 5ENIA 4BW1A 4YYGA 3G0JA 4O7FA 3IU5A 5F63A 3GG3A 4YADA 1JM4B 5CQ5A 3U5MA 4O75A 4HBWA 2KTBB 5ENHA 4QSPA 4QR3A 4CFKA 5D26A 4NR8A 4NUDA 4MEQA 3UV2A 4YYIA 4HBYA 4CFLA 5CQTA 4HXNA 5CUCA 4HBVA 4YBSA 5TCMA 3TLPA 5DYXA 5A81A 4HXOA 4A9HA 4ALGA 3DAIA 1X0JA 5F1HA 5ENEA 5CFWA 3SVHA 4ZW1A 2NXBA 4IR5A 5CP5A 5IIDA 4NR7A 5FG4A 5I83A 5DKDA 5I88A 5DFBA 4WHUA 5EM3A 4TT4A 2E3KA 4IORA 4A9MA 3QZTA 5FE7A 5A85A 4HXSA 5DBMA 5C7NA 5HRVA 4Z93A 5A5QA 5EPBA 3G0LA 5EWDA 5KTXA 5HRXA 5LKTA 5EWVA 1WUGA 5CRZA 4IR3A 5DFCA 4UIYA 3UVWA 5FDZA 4A9JA 4UYHA 4A9IA 2G4AA 3U5NA 5L98A 5E7DA 5D3LA 4O7BA 5LKXA 4ZQLA 3U5JA 3AQAA 4ALHA 4HXPA 4BW4A 4TZ2A 3D7CA 4LYWA 4UIVA 4UIWA 4HBXA 4UIXA 5ENCA 2OO1A 5D3JA 4GPJA 4XYAA 5A82A 5FH8A 4AKNA 5A5PA 4YYNA 5H1TA 3QZVA 5CQAA 5LKZA 1ZS5A 4BW2A
chains in the Genus database with same CATH superfamily
4WHWA 5DYUA 5CQ8A 5D3NA 5EWWA 4Z1QA 5FE5A 5E9LA 4UYFB 4C66A 4YYJA 4KV1A 4QSTA 2YELA 3U5PA 4WIVA 3LQIA 2L84A 3P1EA 3LQJA 4XY9A 4E96A 5HFQA 3JVKA 5L99A 4LZ2A 3HMFA 5DW1A 5FE0A 4YYDA 5D3TA 5D0CA 3UV5A 4O7EA 5K29A 3UVDA 4Q0NA 4IR4A 3O37A 4A9EA 4NR6A 5H1VA 5C4QA 4IR6A 5I1QA 3FKMX 5H85A 5EWCA 3MB3A 2YYNA 5FFWA 4O77A 3P5OA 4LRGA 5ACYA 4UYDA 2WP1A 4C67A 4CUQA 5HFRA 5A5SA 2R0VA 5E0RA 4AI6A 5I89A 5E9IA 5II1A 4NQNA 4CUTA 4QEUA 4QZSA 5G4RA 4N4HA 4LZRA 5IGLA 4TS8A 5FB1A 5E9YA 4OGIA 4AKHA 5E73A 2GRCA 5HQ5A 5E9KA 1JSPB 5ENFA 2DVRA 2RI7A 4OGJA 5I7YA 2YW5A 4HXLA 3UW9A 2WP2A 5F36A 5KO4A 5G4SA 5D3PA 5EK9A 4DONA 4LYIA 2L5EA 2RNYA 4YABA 5D7XA 5D3SA 4UITA 4TT6A 5EU1A 5D3HA 4QB3A 5A5OA 4O72A 4RVRA 2RO1A 5LJ0A 3ZYUA 5CU8A 2E7OA 4O7CA 4UYFA 3S91A 5EP7A 3MUKA 4QR4A 2OSSA 5ENBA 4O71A 5LJ2A 4HXMA 4YY6A 5L96A 5D25A 5BT5A 3Q2FA 4MEPA 2H60A 5IGKA 3U5KA 5CUEA 4MR4A 2L85A 4PTBA 5IG6A 2MJVB 4X2IA 5DLXA 4LR6A 4PCEA 4YY4A 1ZKRA 4NYXA 4NYVA 4NRBA 4J1PA 5EA1A 3MXFA 3RCWA 5A83A 5KU3A 5L8TA 4XY8A 5HRWA 4N4IA 5A5NA 4TZ8A 5DKCA 4XUBA 4J3IA 4N4FA 1N72A 4NQMA 5HELA 3ERRA 4TTEA 3AADA 3UVYA 5KTWA 5C8GA 2YDWA 5E3GA 3P1DA 3HMEA 3O35A 2RNWA 4Q0OA 3K2JA 3Q2EA 2N9GA 3LXJA 5FE6A 4A9NA 3I3JA 5A5RA 5IGNA 1F68A 4BW3A 3LQHA 3UVXA 4KCXA 5J0DA 2FSAA 5E9VA 5CY9A 4PCIA 4ZC9A 3JVMA 4TT2A 5DYCA 5EI4A 4KV4A 2LSPB 2RFJA 5EPSA 4YYHA 5FE4A 3SVFA 2I8NA 5FFYA 5DLZA 5BT3A 5I7XA 1E6IA 4QEWA 5EISA 2E7NA 3ONIA 5LJ1A 2DVSA 3QZSA 4F3IA 2OUOA 2RS9B 5FE1A 4BHWA 5LVRA 5JWMA 4NRAA 3D1BA 5DFDA 4OUFA 5CZGA 4QEVA 4PKLA 5ETDA 5FE8A 4MENA 5CQ3A 5FE9A 1EQFA 4IOOA 2R10A 4O7AA 5CRMA 3LJWA 4A9KA 5CUGA 5E74A 5CS8A 4TQNA 4NUCA 4AKIA 2YEKA 4YBMA 5I80A 4YBTA 3JVLA 4HXKA 4HXRA 4TYLA 5CUBA 4NXJA 5HEMA 5CQ6A 5FE2A 5KHMA 4MEOA 4O76A 4QYDA 5BT4A 2YEMA 3NXBA 5F3AA 4MR5A 5I86A 5F61A 4CLBA 4N3WA 4NR9A 2D82A 5HJCA 5C87A 5CUAA 4A9OA 5F5ZA 4A9FA 4J0RA 5HENA 5D24A 3P1CA 5CPEA 4QC1A 5FB0A 4UIUA 5EGUA 5H1UA 3DWYA 4QYLA 5KTUA 5FH6A 4QC3A 4QNSA 5EVAA 3HMHA 4YATA 4UYGA 3O36A 5LVQA 4XUAA 5FG6A 5COIA 4AKGA 4FLPA 4IOQA 4QR5A 4BJXA 5CTLA 5EV9A 4O78A 4UIZA 4TU6A 4NRCA 4O70A 4LYSA 5CQ7A 3SVGA 4LC2A 4QUUA 5FFVA 4O74A 3U5OA 4QSUA 4A9LA 4J0SA 2R0SA 4Z6HA 3UV4A 1WUMA 5D3RA 5DW2A 5C89A 5FH7A 3MULA 5II2A 5F62A 5HQ7A 5LUUA 4CUPA 3MQMA 5CUDA 4QSRA 5EPRA 5AMEA 5EWHA 5ENJA 4LZSA 4QSWA 4NUEA 2R0YA 4NYWA 4CUSA 4QSSA 5FBXA 4YH4A 5E9MA 5HCLA 4LDFA 4QSXA 5FG5A 3S92A 5I29A 5AMFA 5F1LA 5CGPA 4YAXA 4N4GA 4PY6A 5AD2A 2F6NA 4UYEA 5EQ1A 5IBNA 5TB6A 2YQDA 4NS5A 4QSVA 5F25A 3O34A 5HLSA 2D9EA 2F6JA 5E3DA 4QY4A 3D1DA 5DX4A 4CURA 2RNXA 5IGMA 4PS5A 4MR3A 3O33A 4CUUA 5C85A 5FE3A 2DVVA 2I7KA 4YK0A 5DYAA 5AD3A 5LKUA 5DY7A 4YYKA 2DATA 4NR4A 5ETBA 2DKWA 1PUOA 3P1FA 5EICA 4YH3A 5L8UA 4YYMA 3JVJA 4NR5A 4MR6A 5I40A 5F60A 3U5LA 5A7CA 5CQ4A 4QBMA 5L97A 4Z6IA 5DKHA 4QUTA 2DVQA 5ENGA 4Z1SA 3MB4A 5JI8A 3IU6A 2DWWA 4TU4A 5F2PA 5HQ6A 5HM0A 4Y03A 4CL9A 4YC9A 4QSQA 5ENIA 4BW1A 4YYGA 3G0JA 4O7FA 3IU5A 5F63A 3GG3A 4YADA 1JM4B 5CQ5A 3U5MA 4O75A 4HBWA 2KTBB 5ENHA 4QSPA 4QR3A 4CFKA 5D26A 4NR8A 4NUDA 4MEQA 3UV2A 4YYIA 4HBYA 4CFLA 5CQTA 4HXNA 5CUCA 4HBVA 4YBSA 5TCMA 3TLPA 5DYXA 5A81A 4HXOA 4A9HA 4ALGA 3DAIA 1X0JA 3VKGA 5F1HA 5ENEA 5CFWA 3SVHA 4ZW1A 2NXBA 4IR5A 5CP5A 5IIDA 4NR7A 5FG4A 5I83A 5DKDA 5I88A 5DFBA 4WHUA 5EM3A 4TT4A 2E3KA 4IORA 4A9MA 3QZTA 5FE7A 5A85A 4HXSA 5DBMA 5C7NA 5HRVA 4Z93A 3VKHA 5A5QA 5EPBA 3G0LA 5EWDA 5KTXA 5HRXA 5LKTA 5EWVA 1WUGA 5CRZA 4IR3A 5DFCA 4UIYA 3UVWA 5FDZA 4A9JA 4UYHA 4A9IA 2G4AA 3U5NA 5L98A 5E7DA 5D3LA 4O7BA 5LKXA 4ZQLA 3U5JA 3AQAA 4ALHA 4HXPA 4BW4A 2EJNA 4TZ2A 3D7CA 4LYWA 4UIVA 4UIWA 4HBXA 4UIXA 5ENCA 2OO1A 5D3JA 4GPJA 4XYAA 5A82A 5FH8A 4AKNA 5A5PA 4YYNA 5H1TA 3QZVA 5CQAA 5LKZA 1ZS5A 4BW2A
chains in the Genus database with same CATH topology
4WHWA 5DYUA 5CQ8A 5D3NA 5EWWA 4Z1QA 5FE5A 5E9LA 4UYFB 4C66A 4YYJA 4KV1A 4QSTA 2YELA 3U5PA 4WIVA 3LQIA 2L84A 3P1EA 3LQJA 4XY9A 4E96A 5HFQA 3JVKA 5L99A 4LZ2A 3HMFA 5DW1A 5FE0A 4YYDA 5D3TA 5D0CA 3UV5A 4O7EA 5K29A 3UVDA 4Q0NA 4IR4A 3O37A 4A9EA 4NR6A 5H1VA 5C4QA 4IR6A 5I1QA 3FKMX 5H85A 5EWCA 3MB3A 2YYNA 5FFWA 4O77A 3P5OA 4LRGA 5ACYA 4UYDA 2WP1A 4C67A 4CUQA 5HFRA 5A5SA 2R0VA 5E0RA 5I89A 5E9IA 5II1A 4NQNA 4CUTA 4QEUA 4QZSA 5G4RA 4N4HA 4LZRA 5IGLA 4TS8A 5FB1A 5E9YA 4OGIA 5E73A 2GRCA 5HQ5A 5E9KA 1JSPB 5ENFA 2DVRA 2RI7A 4OGJA 5I7YA 2YW5A 4HXLA 3UW9A 2WP2A 5F36A 5KO4A 5G4SA 5D3PA 5EK9A 4DONA 4LYIA 2L5EA 2RNYA 4YABA 5D7XA 5D3SA 4UITA 4TT6A 5EU1A 5D3HA 4QB3A 5A5OA 4O72A 4RVRA 2RO1A 5LJ0A 3ZYUA 4O7CA 2E7OA 5CU8A 4UYFA 3S91A 5EP7A 3MUKA 4QR4A 2OSSA 5ENBA 4O71A 5LJ2A 4HXMA 4YY6A 5L96A 5D25A 5BT5A 3Q2FA 4MEPA 2H60A 5IGKA 3U5KA 5CUEA 4MR4A 2L85A 4PTBA 5IG6A 2MJVB 4X2IA 5DLXA 4LR6A 4PCEA 4YY4A 4NYXA 4NYVA 4NRBA 4J1PA 5EA1A 3MXFA 3RCWA 5A83A 5KU3A 5L8TA 4XY8A 5HRWA 4N4IA 5A5NA 4TZ8A 5DKCA 4XUBA 4J3IA 4N4FA 1N72A 4NQMA 5HELA 4TTEA 3AADA 3UVYA 5KTWA 5C8GA 2YDWA 5E3GA 3P1DA 3HMEA 3O35A 2RNWA 4Q0OA 3K2JA 3Q2EA 2N9GA 3LXJA 5FE6A 4A9NA 3I3JA 5A5RA 5IGNA 1F68A 4BW3A 3LQHA 3UVXA 4KCXA 5J0DA 2FSAA 5E9VA 5CY9A 4PCIA 4ZC9A 3JVMA 4TT2A 5DYCA 5EI4A 4KV4A 2LSPB 2RFJA 5EPSA 4YYHA 5FE4A 3SVFA 2I8NA 5FFYA 5DLZA 5BT3A 5I7XA 1E6IA 4QEWA 5EISA 2E7NA 3ONIA 5LJ1A 2DVSA 3QZSA 4F3IA 2OUOA 2RS9B 5FE1A 4BHWA 5LVRA 5JWMA 4NRAA 5DFDA 4OUFA 5CZGA 4QEVA 4PKLA 5ETDA 5FE8A 4MENA 5CQ3A 5FE9A 1EQFA 4IOOA 2R10A 4O7AA 5CRMA 3LJWA 4A9KA 5CUGA 5E74A 5CS8A 4TQNA 4NUCA 2YEKA 4YBMA 5I80A 4YBTA 3JVLA 4HXKA 4HXRA 4TYLA 5CUBA 4NXJA 5HEMA 5CQ6A 5FE2A 5KHMA 4MEOA 4O76A 4QYDA 5BT4A 2YEMA 3NXBA 5F3AA 4MR5A 5I86A 5F61A 4CLBA 4N3WA 4NR9A 2D82A 5HJCA 5C87A 5CUAA 4A9OA 5F5ZA 4A9FA 4J0RA 5HENA 5D24A 3P1CA 5CPEA 4QC1A 5FB0A 4UIUA 5EGUA 5H1UA 3DWYA 4QYLA 5KTUA 5FH6A 4QC3A 4QNSA 5EVAA 3HMHA 4YATA 4UYGA 3O36A 5LVQA 4XUAA 5FG6A 5COIA 4FLPA 4IOQA 4QR5A 4BJXA 5CTLA 5EV9A 4O78A 4UIZA 4TU6A 4NRCA 4O70A 4LYSA 5CQ7A 3SVGA 4LC2A 4QUUA 5FFVA 4O74A 3U5OA 4QSUA 4A9LA 4J0SA 2R0SA 4Z6HA 3UV4A 1WUMA 5D3RA 5DW2A 5C89A 5FH7A 3MULA 5II2A 5F62A 5HQ7A 5LUUA 4CUPA 3MQMA 5CUDA 4QSRA 5EPRA 5AMEA 5EWHA 5ENJA 4LZSA 4QSWA 4NUEA 2R0YA 4NYWA 4CUSA 4QSSA 5FBXA 4YH4A 5E9MA 5HCLA 4LDFA 4QSXA 5FG5A 3S92A 5I29A 5AMFA 5F1LA 5CGPA 4YAXA 4N4GA 4PY6A 5AD2A 2F6NA 4UYEA 5EQ1A 5IBNA 5TB6A 2YQDA 4NS5A 4QSVA 5F25A 3O34A 5HLSA 2D9EA 2F6JA 5E3DA 4QY4A 5DX4A 4CURA 2RNXA 5IGMA 4PS5A 4MR3A 3O33A 4CUUA 5C85A 5FE3A 2DVVA 2I7KA 4YK0A 5DYAA 5AD3A 5LKUA 5DY7A 4YYKA 2DATA 4NR4A 5ETBA 2DKWA 3P1FA 5EICA 4YH3A 5L8UA 4YYMA 3JVJA 4NR5A 4MR6A 5I40A 5F60A 3U5LA 5A7CA 5CQ4A 4QBMA 5L97A 4Z6IA 5DKHA 4QUTA 2DVQA 5ENGA 4Z1SA 3MB4A 5JI8A 3IU6A 2DWWA 4TU4A 5F2PA 5HQ6A 5HM0A 4Y03A 4CL9A 4YC9A 4QSQA 5ENIA 4BW1A 4YYGA 3G0JA 4O7FA 3IU5A 5F63A 3GG3A 4YADA 1JM4B 5CQ5A 3U5MA 4O75A 4HBWA 2KTBB 5ENHA 4QSPA 4QR3A 4CFKA 5D26A 4NR8A 4NUDA 4MEQA 3UV2A 4YYIA 4HBYA 4CFLA 5CQTA 4HXNA 5CUCA 4HBVA 4YBSA 5TCMA 3TLPA 5DYXA 5A81A 4HXOA 4A9HA 4ALGA 3DAIA 1X0JA 5F1HA 5ENEA 5CFWA 3SVHA 4ZW1A 2NXBA 4IR5A 5CP5A 5IIDA 4NR7A 5FG4A 5I83A 5DKDA 5I88A 5DFBA 4WHUA 5EM3A 4TT4A 2E3KA 4IORA 4A9MA 3QZTA 5FE7A 5A85A 4HXSA 5DBMA 5C7NA 5HRVA 4Z93A 5A5QA 5EPBA 3G0LA 5EWDA 5KTXA 5HRXA 5LKTA 5EWVA 1WUGA 5CRZA 4IR3A 5DFCA 4UIYA 3UVWA 5FDZA 4A9JA 4UYHA 4A9IA 2G4AA 3U5NA 5L98A 5E7DA 5D3LA 4O7BA 5LKXA 4ZQLA 3U5JA 3AQAA 4ALHA 4HXPA 4BW4A 4TZ2A 3D7CA 4LYWA 4UIVA 4UIWA 4HBXA 4UIXA 5ENCA 2OO1A 5D3JA 4GPJA 4XYAA 5A82A 5FH8A 4AKNA 5A5PA 4YYNA 5H1TA 3QZVA 5CQAA 5LKZA 1ZS5A 4BW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WHW A;  5DYU A;  5CQ8 A;  5D3N A;  5EWW A;  4Z1Q A;  5FE5 A;  5E9L A;  4UYF B;  4C66 A;  4YYJ A;  4KV1 A;  4QST A;  2YEL A;  3U5P A;  4WIV A;  3LQI A;  2L84 A;  3P1E A;  3LQJ A;  4XY9 A;  4E96 A;  5HFQ A;  3JVK A;  5L99 A;  4LZ2 A;  3HMF A;  5DW1 A;  5FE0 A;  4YYD A;  5D3T A;  5D0C A;  3UV5 A;  4O7E A;  5K29 A;  3UVD A;  4Q0N A;  4IR4 A;  3O37 A;  4A9E A;  4NR6 A;  5H1V A;  5C4Q A;  4IR6 A;  5I1Q A;  3FKM X;  5H85 A;  5EWC A;  3MB3 A;  2YYN A;  5FFW A;  4O77 A;  3P5O A;  4LRG A;  5ACY A;  4UYD A;  2WP1 A;  4C67 A;  4CUQ A;  5HFR A;  5A5S A;  2R0V A;  5E0R A;  5I89 A;  5E9I A;  5II1 A;  4NQN A;  4CUT A;  4QEU A;  4QZS A;  5G4R A;  4N4H A;  4LZR A;  5IGL A;  4TS8 A;  5FB1 A;  5E9Y A;  4OGI A;  5E73 A;  2GRC A;  5HQ5 A;  5E9K A;  1JSP B;  5ENF A;  2DVR A;  2RI7 A;  4OGJ A;  5I7Y A;  2YW5 A;  4HXL A;  3UW9 A;  2WP2 A;  5F36 A;  5KO4 A;  5G4S A;  5D3P A;  5EK9 A;  4DON A;  4LYI A;  2L5E A;  2RNY A;  4YAB A;  5D7X A;  5D3S A;  4UIT A;  4TT6 A;  5EU1 A;  5D3H A;  4QB3 A;  5A5O A;  4O72 A;  4RVR A;  2RO1 A;  5LJ0 A;  3ZYU A;  4O7C A;  2E7O A;  5CU8 A;  4UYF A;  3S91 A;  5EP7 A;  3MUK A;  4QR4 A;  2OSS A;  5ENB A;  4O71 A;  5LJ2 A;  4HXM A;  4YY6 A;  5L96 A;  5D25 A;  5BT5 A;  3Q2F A;  4MEP A;  2H60 A;  5IGK A;  3U5K A;  5CUE A;  4MR4 A;  2L85 A;  4PTB A;  5IG6 A;  2MJV B;  4X2I A;  5DLX A;  4LR6 A;  4PCE A;  4YY4 A;  4NYX A;  4NYV A;  4NRB A;  4J1P A;  5EA1 A;  3MXF A;  3RCW A;  5A83 A;  5KU3 A;  5L8T A;  4XY8 A;  5HRW A;  4N4I A;  5A5N A;  4TZ8 A;  5DKC A;  4XUB A;  4J3I A;  4N4F A;  1N72 A;  4NQM A;  5HEL A;  4TTE A;  3AAD A;  3UVY A;  5KTW A;  5C8G A;  2YDW A;  5E3G A;  3P1D A;  3HME A;  3O35 A;  2RNW A;  4Q0O A;  3K2J A;  3Q2E A;  2N9G A;  3LXJ A;  5FE6 A;  4A9N A;  3I3J A;  5A5R A;  5IGN A;  1F68 A;  4BW3 A;  3LQH A;  3UVX A;  4KCX A;  5J0D A;  2FSA A;  5E9V A;  5CY9 A;  4PCI A;  4ZC9 A;  3JVM A;  4TT2 A;  5DYC A;  5EI4 A;  4KV4 A;  2LSP B;  2RFJ A;  5EPS A;  4YYH A;  5FE4 A;  3SVF A;  2I8N A;  5FFY A;  5DLZ A;  5BT3 A;  5I7X A;  1E6I A;  4QEW A;  5EIS A;  2E7N A;  3ONI A;  5LJ1 A;  2DVS A;  3QZS A;  4F3I A;  2OUO A;  2RS9 B;  5FE1 A;  4BHW A;  5LVR A;  5JWM A;  4NRA A;  5DFD A;  4OUF A;  5CZG A;  4QEV A;  4PKL A;  5ETD A;  5FE8 A;  4MEN A;  5CQ3 A;  5FE9 A;  1EQF A;  4IOO A;  2R10 A;  4O7A A;  5CRM A;  3LJW A;  4A9K A;  5CUG A;  5E74 A;  5CS8 A;  4TQN A;  4NUC A;  2YEK A;  4YBM A;  5I80 A;  4YBT A;  3JVL A;  4HXK A;  4HXR A;  4TYL A;  5CUB A;  4NXJ A;  5HEM A;  5CQ6 A;  5FE2 A;  5KHM A;  4MEO A;  4O76 A;  4QYD A;  5BT4 A;  2YEM A;  3NXB A;  5F3A A;  4MR5 A;  5I86 A;  5F61 A;  4CLB A;  4N3W A;  4NR9 A;  2D82 A;  5HJC A;  5C87 A;  5CUA A;  4A9O A;  5F5Z A;  4A9F A;  4J0R A;  5HEN A;  5D24 A;  3P1C A;  5CPE A;  4QC1 A;  5FB0 A;  4UIU A;  5EGU A;  5H1U A;  3DWY A;  4QYL A;  5KTU A;  5FH6 A;  4QC3 A;  4QNS A;  5EVA A;  3HMH A;  4YAT A;  4UYG A;  3O36 A;  5LVQ A;  4XUA A;  5FG6 A;  5COI A;  4FLP A;  4IOQ A;  4QR5 A;  4BJX A;  5CTL A;  5EV9 A;  4O78 A;  4UIZ A;  4TU6 A;  4NRC A;  4O70 A;  4LYS A;  5CQ7 A;  3SVG A;  4LC2 A;  4QUU A;  5FFV A;  4O74 A;  3U5O A;  4QSU A;  4A9L A;  4J0S A;  2R0S A;  4Z6H A;  3UV4 A;  1WUM A;  5D3R A;  5DW2 A;  5C89 A;  5FH7 A;  3MUL A;  5II2 A;  5F62 A;  5HQ7 A;  5LUU A;  4CUP A;  3MQM A;  5CUD A;  4QSR A;  5EPR A;  5AME A;  5EWH A;  5ENJ A;  4LZS A;  4QSW A;  4NUE A;  2R0Y A;  4NYW A;  4CUS A;  4QSS A;  5FBX A;  4YH4 A;  5E9M A;  5HCL A;  4LDF A;  4QSX A;  5FG5 A;  3S92 A;  5I29 A;  5AMF A;  5F1L A;  5CGP A;  4YAX A;  4N4G A;  4PY6 A;  5AD2 A;  2F6N A;  4UYE A;  5EQ1 A;  5IBN A;  5TB6 A;  2YQD A;  4NS5 A;  4QSV A;  5F25 A;  3O34 A;  5HLS A;  2D9E A;  2F6J A;  5E3D A;  4QY4 A;  5DX4 A;  4CUR A;  2RNX A;  5IGM A;  4PS5 A;  4MR3 A;  3O33 A;  4CUU A;  5C85 A;  5FE3 A;  2DVV A;  2I7K A;  4YK0 A;  5DYA A;  5AD3 A;  5LKU A;  5DY7 A;  4YYK A;  2DAT A;  4NR4 A;  5ETB A;  2DKW A;  3P1F A;  5EIC A;  4YH3 A;  5L8U A;  4YYM A;  3JVJ A;  4NR5 A;  4MR6 A;  5I40 A;  5F60 A;  3U5L A;  5A7C A;  5CQ4 A;  4QBM A;  5L97 A;  4Z6I A;  5DKH A;  4QUT A;  2DVQ A;  5ENG A;  4Z1S A;  3MB4 A;  5JI8 A;  3IU6 A;  2DWW A;  4TU4 A;  5F2P A;  5HQ6 A;  5HM0 A;  4Y03 A;  4CL9 A;  4YC9 A;  4QSQ A;  5ENI A;  4BW1 A;  4YYG A;  3G0J A;  4O7F A;  3IU5 A;  5F63 A;  3GG3 A;  4YAD A;  1JM4 B;  5CQ5 A;  3U5M A;  4O75 A;  4HBW A;  2KTB B;  5ENH A;  4QSP A;  4QR3 A;  4CFK A;  5D26 A;  4NR8 A;  4NUD A;  4MEQ A;  3UV2 A;  4YYI A;  4HBY A;  4CFL A;  5CQT A;  4HXN A;  5CUC A;  4HBV A;  4YBS A;  5TCM A;  3TLP A;  5DYX A;  5A81 A;  4HXO A;  4A9H A;  4ALG A;  3DAI A;  1X0J A;  5F1H A;  5ENE A;  5CFW A;  3SVH A;  4ZW1 A;  2NXB A;  4IR5 A;  5CP5 A;  5IID A;  4NR7 A;  5FG4 A;  5I83 A;  5DKD A;  5I88 A;  5DFB A;  4WHU A;  5EM3 A;  4TT4 A;  2E3K A;  4IOR A;  4A9M A;  3QZT A;  5FE7 A;  5A85 A;  4HXS A;  5DBM A;  5C7N A;  5HRV A;  4Z93 A;  5A5Q A;  5EPB A;  3G0L A;  5EWD A;  5KTX A;  5HRX A;  5LKT A;  5EWV A;  1WUG A;  5CRZ A;  4IR3 A;  5DFC A;  4UIY A;  3UVW A;  5FDZ A;  4A9J A;  4UYH A;  4A9I A;  2G4A A;  3U5N A;  5L98 A;  5E7D A;  5D3L A;  4O7B A;  5LKX A;  4ZQL A;  3U5J A;  3AQA A;  4ALH A;  4HXP A;  4BW4 A;  4TZ2 A;  3D7C A;  4LYW A;  4UIV A;  4UIW A;  4HBX A;  4UIX A;  5ENC A;  2OO1 A;  5D3J A;  4GPJ A;  4XYA A;  5A82 A;  5FH8 A;  4AKN A;  5A5P A;  4YYN A;  5H1T A;  3QZV A;  5CQA A;  5LKZ A;  1ZS5 A;  4BW2 A; 
#chains in the Genus database with same CATH topology
 4WHW A;  5DYU A;  5CQ8 A;  5D3N A;  5EWW A;  4Z1Q A;  5FE5 A;  5E9L A;  4UYF B;  4C66 A;  4YYJ A;  4KV1 A;  4QST A;  2YEL A;  3U5P A;  4WIV A;  3LQI A;  2L84 A;  3P1E A;  3LQJ A;  4XY9 A;  4E96 A;  5HFQ A;  3JVK A;  5L99 A;  4LZ2 A;  3HMF A;  5DW1 A;  5FE0 A;  4YYD A;  5D3T A;  5D0C A;  3UV5 A;  4O7E A;  5K29 A;  3UVD A;  4Q0N A;  4IR4 A;  3O37 A;  4A9E A;  4NR6 A;  5H1V A;  5C4Q A;  4IR6 A;  5I1Q A;  3FKM X;  5H85 A;  5EWC A;  3MB3 A;  2YYN A;  5FFW A;  4O77 A;  3P5O A;  4LRG A;  5ACY A;  4UYD A;  2WP1 A;  4C67 A;  4CUQ A;  5HFR A;  5A5S A;  2R0V A;  5E0R A;  4AI6 A;  5I89 A;  5E9I A;  5II1 A;  4NQN A;  4CUT A;  4QEU A;  4QZS A;  5G4R A;  4N4H A;  4LZR A;  5IGL A;  4TS8 A;  5FB1 A;  5E9Y A;  4OGI A;  4AKH A;  5E73 A;  2GRC A;  5HQ5 A;  5E9K A;  1JSP B;  5ENF A;  2DVR A;  2RI7 A;  4OGJ A;  5I7Y A;  2YW5 A;  4HXL A;  3UW9 A;  2WP2 A;  5F36 A;  5KO4 A;  5G4S A;  5D3P A;  5EK9 A;  4DON A;  4LYI A;  2L5E A;  2RNY A;  4YAB A;  5D7X A;  5D3S A;  4UIT A;  4TT6 A;  5EU1 A;  5D3H A;  4QB3 A;  5A5O A;  4O72 A;  4RVR A;  2RO1 A;  5LJ0 A;  3ZYU A;  5CU8 A;  2E7O A;  4O7C A;  4UYF A;  3S91 A;  5EP7 A;  3MUK A;  4QR4 A;  2OSS A;  5ENB A;  4O71 A;  5LJ2 A;  4HXM A;  4YY6 A;  5L96 A;  5D25 A;  5BT5 A;  3Q2F A;  4MEP A;  2H60 A;  5IGK A;  3U5K A;  5CUE A;  4MR4 A;  2L85 A;  4PTB A;  5IG6 A;  2MJV B;  4X2I A;  5DLX A;  4LR6 A;  4PCE A;  4YY4 A;  1ZKR A;  4NYX A;  4NYV A;  4NRB A;  4J1P A;  5EA1 A;  3MXF A;  3RCW A;  5A83 A;  5KU3 A;  5L8T A;  4XY8 A;  5HRW A;  4N4I A;  5A5N A;  4TZ8 A;  5DKC A;  4XUB A;  4J3I A;  4N4F A;  1N72 A;  4NQM A;  5HEL A;  3ERR A;  4TTE A;  3AAD A;  3UVY A;  5KTW A;  5C8G A;  2YDW A;  5E3G A;  3P1D A;  3HME A;  3O35 A;  2RNW A;  4Q0O A;  3K2J A;  3Q2E A;  2N9G A;  3LXJ A;  5FE6 A;  4A9N A;  3I3J A;  5A5R A;  5IGN A;  1F68 A;  4BW3 A;  3LQH A;  3UVX A;  4KCX A;  5J0D A;  2FSA A;  5E9V A;  5CY9 A;  4PCI A;  4ZC9 A;  3JVM A;  4TT2 A;  5DYC A;  5EI4 A;  4KV4 A;  2LSP B;  2RFJ A;  5EPS A;  4YYH A;  5FE4 A;  3SVF A;  2I8N A;  5FFY A;  5DLZ A;  5BT3 A;  5I7X A;  1E6I A;  4QEW A;  5EIS A;  2E7N A;  3ONI A;  5LJ1 A;  2DVS A;  3QZS A;  4F3I A;  2OUO A;  2RS9 B;  5FE1 A;  4BHW A;  5LVR A;  5JWM A;  4NRA A;  3D1B A;  5DFD A;  4OUF A;  5CZG A;  4QEV A;  4PKL A;  5ETD A;  5FE8 A;  4MEN A;  5CQ3 A;  5FE9 A;  1EQF A;  4IOO A;  2R10 A;  4O7A A;  5CRM A;  3LJW A;  4A9K A;  5CUG A;  5E74 A;  5CS8 A;  4TQN A;  4NUC A;  4AKI A;  2YEK A;  4YBM A;  5I80 A;  4YBT A;  3JVL A;  4HXK A;  4HXR A;  4TYL A;  5CUB A;  4NXJ A;  5HEM A;  5CQ6 A;  5FE2 A;  5KHM A;  4MEO A;  4O76 A;  4QYD A;  5BT4 A;  2YEM A;  3NXB A;  5F3A A;  4MR5 A;  5I86 A;  5F61 A;  4CLB A;  4N3W A;  4NR9 A;  2D82 A;  5HJC A;  5C87 A;  5CUA A;  4A9O A;  5F5Z A;  4A9F A;  4J0R A;  5HEN A;  5D24 A;  3P1C A;  5CPE A;  4QC1 A;  5FB0 A;  4UIU A;  5EGU A;  5H1U A;  3DWY A;  4QYL A;  5KTU A;  5FH6 A;  4QC3 A;  4QNS A;  5EVA A;  3HMH A;  4YAT A;  4UYG A;  3O36 A;  5LVQ A;  4XUA A;  5FG6 A;  5COI A;  4AKG A;  4FLP A;  4IOQ A;  4QR5 A;  4BJX A;  5CTL A;  5EV9 A;  4O78 A;  4UIZ A;  4TU6 A;  4NRC A;  4O70 A;  4LYS A;  5CQ7 A;  3SVG A;  4LC2 A;  4QUU A;  5FFV A;  4O74 A;  3U5O A;  4QSU A;  4A9L A;  4J0S A;  2R0S A;  4Z6H A;  3UV4 A;  1WUM A;  5D3R A;  5DW2 A;  5C89 A;  5FH7 A;  3MUL A;  5II2 A;  5F62 A;  5HQ7 A;  5LUU A;  4CUP A;  3MQM A;  5CUD A;  4QSR A;  5EPR A;  5AME A;  5EWH A;  5ENJ A;  4LZS A;  4QSW A;  4NUE A;  2R0Y A;  4NYW A;  4CUS A;  4QSS A;  5FBX A;  4YH4 A;  5E9M A;  5HCL A;  4LDF A;  4QSX A;  5FG5 A;  3S92 A;  5I29 A;  5AMF A;  5F1L A;  5CGP A;  4YAX A;  4N4G A;  4PY6 A;  5AD2 A;  2F6N A;  4UYE A;  5EQ1 A;  5IBN A;  5TB6 A;  2YQD A;  4NS5 A;  4QSV A;  5F25 A;  3O34 A;  5HLS A;  2D9E A;  2F6J A;  5E3D A;  4QY4 A;  3D1D A;  5DX4 A;  4CUR A;  2RNX A;  5IGM A;  4PS5 A;  4MR3 A;  3O33 A;  4CUU A;  5C85 A;  5FE3 A;  2DVV A;  2I7K A;  4YK0 A;  5DYA A;  5AD3 A;  5LKU A;  5DY7 A;  4YYK A;  2DAT A;  4NR4 A;  5ETB A;  2DKW A;  1PUO A;  3P1F A;  5EIC A;  4YH3 A;  5L8U A;  4YYM A;  3JVJ A;  4NR5 A;  4MR6 A;  5I40 A;  5F60 A;  3U5L A;  5A7C A;  5CQ4 A;  4QBM A;  5L97 A;  4Z6I A;  5DKH A;  4QUT A;  2DVQ A;  5ENG A;  4Z1S A;  3MB4 A;  5JI8 A;  3IU6 A;  2DWW A;  4TU4 A;  5F2P A;  5HQ6 A;  5HM0 A;  4Y03 A;  4CL9 A;  4YC9 A;  4QSQ A;  5ENI A;  4BW1 A;  4YYG A;  3G0J A;  4O7F A;  3IU5 A;  5F63 A;  3GG3 A;  4YAD A;  1JM4 B;  5CQ5 A;  3U5M A;  4O75 A;  4HBW A;  2KTB B;  5ENH A;  4QSP A;  4QR3 A;  4CFK A;  5D26 A;  4NR8 A;  4NUD A;  4MEQ A;  3UV2 A;  4YYI A;  4HBY A;  4CFL A;  5CQT A;  4HXN A;  5CUC A;  4HBV A;  4YBS A;  5TCM A;  3TLP A;  5DYX A;  5A81 A;  4HXO A;  4A9H A;  4ALG A;  3DAI A;  1X0J A;  3VKG A;  5F1H A;  5ENE A;  5CFW A;  3SVH A;  4ZW1 A;  2NXB A;  4IR5 A;  5CP5 A;  5IID A;  4NR7 A;  5FG4 A;  5I83 A;  5DKD A;  5I88 A;  5DFB A;  4WHU A;  5EM3 A;  4TT4 A;  2E3K A;  4IOR A;  4A9M A;  3QZT A;  5FE7 A;  5A85 A;  4HXS A;  5DBM A;  5C7N A;  5HRV A;  4Z93 A;  3VKH A;  5A5Q A;  5EPB A;  3G0L A;  5EWD A;  5KTX A;  5HRX A;  5LKT A;  5EWV A;  1WUG A;  5CRZ A;  4IR3 A;  5DFC A;  4UIY A;  3UVW A;  5FDZ A;  4A9J A;  4UYH A;  4A9I A;  2G4A A;  3U5N A;  5L98 A;  5E7D A;  5D3L A;  4O7B A;  5LKX A;  4ZQL A;  3U5J A;  3AQA A;  4ALH A;  4HXP A;  4BW4 A;  2EJN A;  4TZ2 A;  3D7C A;  4LYW A;  4UIV A;  4UIW A;  4HBX A;  4UIX A;  5ENC A;  2OO1 A;  5D3J A;  4GPJ A;  4XYA A;  5A82 A;  5FH8 A;  4AKN A;  5A5P A;  4YYN A;  5H1T A;  3QZV A;  5CQA A;  5LKZ A;  1ZS5 A;  4BW2 A; 
#chains in the Genus database with same CATH homology
 4WHW A;  5DYU A;  5CQ8 A;  5D3N A;  5EWW A;  4Z1Q A;  5FE5 A;  5E9L A;  4UYF B;  4C66 A;  4YYJ A;  4KV1 A;  4QST A;  2YEL A;  3U5P A;  4WIV A;  3LQI A;  2L84 A;  3P1E A;  3LQJ A;  4XY9 A;  4E96 A;  5HFQ A;  3JVK A;  5L99 A;  4LZ2 A;  3HMF A;  5DW1 A;  5FE0 A;  4YYD A;  5D3T A;  5D0C A;  3UV5 A;  4O7E A;  5K29 A;  3UVD A;  4Q0N A;  4IR4 A;  3O37 A;  4A9E A;  4NR6 A;  5H1V A;  5C4Q A;  4IR6 A;  5I1Q A;  3FKM X;  5H85 A;  5EWC A;  3MB3 A;  2YYN A;  5FFW A;  4O77 A;  3P5O A;  4LRG A;  5ACY A;  4UYD A;  2WP1 A;  4C67 A;  4CUQ A;  5HFR A;  5A5S A;  2R0V A;  5E0R A;  5I89 A;  5E9I A;  5II1 A;  4NQN A;  4CUT A;  4QEU A;  4QZS A;  5G4R A;  4N4H A;  4LZR A;  5IGL A;  4TS8 A;  5FB1 A;  5E9Y A;  4OGI A;  5E73 A;  2GRC A;  5HQ5 A;  5E9K A;  1JSP B;  5ENF A;  2DVR A;  2RI7 A;  4OGJ A;  5I7Y A;  2YW5 A;  4HXL A;  3UW9 A;  2WP2 A;  5F36 A;  5KO4 A;  5G4S A;  5D3P A;  5EK9 A;  4DON A;  4LYI A;  2L5E A;  2RNY A;  4YAB A;  5D7X A;  5D3S A;  4UIT A;  4TT6 A;  5EU1 A;  5D3H A;  4QB3 A;  5A5O A;  4O72 A;  4RVR A;  2RO1 A;  5LJ0 A;  3ZYU A;  4O7C A;  2E7O A;  5CU8 A;  4UYF A;  3S91 A;  5EP7 A;  3MUK A;  4QR4 A;  2OSS A;  5ENB A;  4O71 A;  5LJ2 A;  4HXM A;  4YY6 A;  5L96 A;  5D25 A;  5BT5 A;  3Q2F A;  4MEP A;  2H60 A;  5IGK A;  3U5K A;  5CUE A;  4MR4 A;  2L85 A;  4PTB A;  5IG6 A;  2MJV B;  4X2I A;  5DLX A;  4LR6 A;  4PCE A;  4YY4 A;  4NYX A;  4NYV A;  4NRB A;  4J1P A;  5EA1 A;  3MXF A;  3RCW A;  5A83 A;  5KU3 A;  5L8T A;  4XY8 A;  5HRW A;  4N4I A;  5A5N A;  4TZ8 A;  5DKC A;  4XUB A;  4J3I A;  4N4F A;  1N72 A;  4NQM A;  5HEL A;  4TTE A;  3AAD A;  3UVY A;  5KTW A;  5C8G A;  2YDW A;  5E3G A;  3P1D A;  3HME A;  3O35 A;  2RNW A;  4Q0O A;  3K2J A;  3Q2E A;  2N9G A;  3LXJ A;  5FE6 A;  4A9N A;  3I3J A;  5A5R A;  5IGN A;  1F68 A;  4BW3 A;  3LQH A;  3UVX A;  4KCX A;  5J0D A;  2FSA A;  5E9V A;  5CY9 A;  4PCI A;  4ZC9 A;  3JVM A;  4TT2 A;  5DYC A;  5EI4 A;  4KV4 A;  2LSP B;  2RFJ A;  5EPS A;  4YYH A;  5FE4 A;  3SVF A;  2I8N A;  5FFY A;  5DLZ A;  5BT3 A;  5I7X A;  1E6I A;  4QEW A;  5EIS A;  2E7N A;  3ONI A;  5LJ1 A;  2DVS A;  3QZS A;  4F3I A;  2OUO A;  2RS9 B;  5FE1 A;  4BHW A;  5LVR A;  5JWM A;  4NRA A;  5DFD A;  4OUF A;  5CZG A;  4QEV A;  4PKL A;  5ETD A;  5FE8 A;  4MEN A;  5CQ3 A;  5FE9 A;  1EQF A;  4IOO A;  2R10 A;  4O7A A;  5CRM A;  3LJW A;  4A9K A;  5CUG A;  5E74 A;  5CS8 A;  4TQN A;  4NUC A;  2YEK A;  4YBM A;  5I80 A;  4YBT A;  3JVL A;  4HXK A;  4HXR A;  4TYL A;  5CUB A;  4NXJ A;  5HEM A;  5CQ6 A;  5FE2 A;  5KHM A;  4MEO A;  4O76 A;  4QYD A;  5BT4 A;  2YEM A;  3NXB A;  5F3A A;  4MR5 A;  5I86 A;  5F61 A;  4CLB A;  4N3W A;  4NR9 A;  2D82 A;  5HJC A;  5C87 A;  5CUA A;  4A9O A;  5F5Z A;  4A9F A;  4J0R A;  5HEN A;  5D24 A;  3P1C A;  5CPE A;  4QC1 A;  5FB0 A;  4UIU A;  5EGU A;  5H1U A;  3DWY A;  4QYL A;  5KTU A;  5FH6 A;  4QC3 A;  4QNS A;  5EVA A;  3HMH A;  4YAT A;  4UYG A;  3O36 A;  5LVQ A;  4XUA A;  5FG6 A;  5COI A;  4FLP A;  4IOQ A;  4QR5 A;  4BJX A;  5CTL A;  5EV9 A;  4O78 A;  4UIZ A;  4TU6 A;  4NRC A;  4O70 A;  4LYS A;  5CQ7 A;  3SVG A;  4LC2 A;  4QUU A;  5FFV A;  4O74 A;  3U5O A;  4QSU A;  4A9L A;  4J0S A;  2R0S A;  4Z6H A;  3UV4 A;  1WUM A;  5D3R A;  5DW2 A;  5C89 A;  5FH7 A;  3MUL A;  5II2 A;  5F62 A;  5HQ7 A;  5LUU A;  4CUP A;  3MQM A;  5CUD A;  4QSR A;  5EPR A;  5AME A;  5EWH A;  5ENJ A;  4LZS A;  4QSW A;  4NUE A;  2R0Y A;  4NYW A;  4CUS A;  4QSS A;  5FBX A;  4YH4 A;  5E9M A;  5HCL A;  4LDF A;  4QSX A;  5FG5 A;  3S92 A;  5I29 A;  5AMF A;  5F1L A;  5CGP A;  4YAX A;  4N4G A;  4PY6 A;  5AD2 A;  2F6N A;  4UYE A;  5EQ1 A;  5IBN A;  5TB6 A;  2YQD A;  4NS5 A;  4QSV A;  5F25 A;  3O34 A;  5HLS A;  2D9E A;  2F6J A;  5E3D A;  4QY4 A;  5DX4 A;  4CUR A;  2RNX A;  5IGM A;  4PS5 A;  4MR3 A;  3O33 A;  4CUU A;  5C85 A;  5FE3 A;  2DVV A;  2I7K A;  4YK0 A;  5DYA A;  5AD3 A;  5LKU A;  5DY7 A;  4YYK A;  2DAT A;  4NR4 A;  5ETB A;  2DKW A;  3P1F A;  5EIC A;  4YH3 A;  5L8U A;  4YYM A;  3JVJ A;  4NR5 A;  4MR6 A;  5I40 A;  5F60 A;  3U5L A;  5A7C A;  5CQ4 A;  4QBM A;  5L97 A;  4Z6I A;  5DKH A;  4QUT A;  2DVQ A;  5ENG A;  4Z1S A;  3MB4 A;  5JI8 A;  3IU6 A;  2DWW A;  4TU4 A;  5F2P A;  5HQ6 A;  5HM0 A;  4Y03 A;  4CL9 A;  4YC9 A;  4QSQ A;  5ENI A;  4BW1 A;  4YYG A;  3G0J A;  4O7F A;  3IU5 A;  5F63 A;  3GG3 A;  4YAD A;  1JM4 B;  5CQ5 A;  3U5M A;  4O75 A;  4HBW A;  2KTB B;  5ENH A;  4QSP A;  4QR3 A;  4CFK A;  5D26 A;  4NR8 A;  4NUD A;  4MEQ A;  3UV2 A;  4YYI A;  4HBY A;  4CFL A;  5CQT A;  4HXN A;  5CUC A;  4HBV A;  4YBS A;  5TCM A;  3TLP A;  5DYX A;  5A81 A;  4HXO A;  4A9H A;  4ALG A;  3DAI A;  1X0J A;  5F1H A;  5ENE A;  5CFW A;  3SVH A;  4ZW1 A;  2NXB A;  4IR5 A;  5CP5 A;  5IID A;  4NR7 A;  5FG4 A;  5I83 A;  5DKD A;  5I88 A;  5DFB A;  4WHU A;  5EM3 A;  4TT4 A;  2E3K A;  4IOR A;  4A9M A;  3QZT A;  5FE7 A;  5A85 A;  4HXS A;  5DBM A;  5C7N A;  5HRV A;  4Z93 A;  5A5Q A;  5EPB A;  3G0L A;  5EWD A;  5KTX A;  5HRX A;  5LKT A;  5EWV A;  1WUG A;  5CRZ A;  4IR3 A;  5DFC A;  4UIY A;  3UVW A;  5FDZ A;  4A9J A;  4UYH A;  4A9I A;  2G4A A;  3U5N A;  5L98 A;  5E7D A;  5D3L A;  4O7B A;  5LKX A;  4ZQL A;  3U5J A;  3AQA A;  4ALH A;  4HXP A;  4BW4 A;  4TZ2 A;  3D7C A;  4LYW A;  4UIV A;  4UIW A;  4HBX A;  4UIX A;  5ENC A;  2OO1 A;  5D3J A;  4GPJ A;  4XYA A;  5A82 A;  5FH8 A;  4AKN A;  5A5P A;  4YYN A;  5H1T A;  3QZV A;  5CQA A;  5LKZ A;  1ZS5 A;  4BW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...