5EWHA

Crystal structure of the human brpf1 bromodomain in complex with seed19
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ewhA00
5C4QA 5HQ6A 4PTBA 4IOQA 2L5EA 5CUEA 2R10A 4YH4A 5IG6A 5L96A 5FG6A 4YK0A 5I1QA 2RFJA 5EWCA 2R0YA 4O72A 4IR5A 4PS5A 5C8GA 5ENBA 5DFCA 4NUEA 4CL9A 4QEUA 4KV1A 4QSXA 2F6NA 5ENEA 4XY9A 4LYSA 5L8TA 5DBMA 4O76A 3Q2EA 5FBXA 2RNWA 2DATA 4TS8A 2GRCA 3AQAA 4QR5A 4UYFA 4NR5A 4YBSA 4NUCA 4QSPA 5L98A 2I8NA 5E7DA 4YYDA 5CQTA 5EU1A 2D82A 5KO4A 5A83A 5E0RA 5H1TA 5LKXA 2RNYA 4A9LA 5C89A 4NYVA 3D7CA 4HXPA 4WIVA 5BT5A 4YY4A 4OGIA 4NR8A 3DWYA 4CFKA 5E9LA 4X2IA 5L97A 5DW2A 4MR6A 5HENA 4CUQA 5A5QA 4NQNA 5KTWA 5CUCA 3DAIA 4QYDA 5F63A 5EPRA 5FFVA 5II2A 4YATA 4O70A 5D3JA 4N4IA 4ZQLA 5TCMA 2E7NA 2DVQA 2DVSA 5ACYA 4NQMA 4CUUA 4O74A 1F68A 4UYGA 5F2PA 4UIUA 4N4GA 5ETDA 4GPJA 2MJVB 4UITA 5HRVA 4TT4A 5ENCA 4ZC9A 4TU4A 5E9IA 5HRXA 5LVRA 5DKHA 5E9VA 3HMHA 4O78A 5EPSA 4LZ2A 5HFQA 2DVRA 5FE5A 3Q2FA 4YYJA 4QC1A 2H60A 5EICA 4A9IA 3LQIA 3P1CA 5FE8A 5EV9A 5E9MA 5A81A 5DKDA 5I80A 4C66A 4YYIA 5A5PA 3LQJA 1JSPB 5FE6A 4NR7A 5D3RA 3TLPA 4QY4A 4MR5A 3MB4A 3UV5A 4YBMA 5FE2A 3MQMA 5G4RA 5K29A 5FE3A 5HCLA 4MEQA 4A9NA 4CUPA 2RS9B 3U5MA 5DW1A 4QUUA 4RVRA 5EISA 4O7EA 5D3SA 4QSTA 4TU6A 5CY9A 5HM0A 5CUBA 4HBXA 3K2JA 5FB1A 5F62A 5H1VA 3FKMX 4Z93A 4NR4A 4HXMA 5EWHA 4Y03A 5D3TA 4ZW1A 4UYFB 5ENHA 5I83A 3G0JA 5DY7A 4YC9A 5F3AA 4Q0NA 2N9GA 4C67A 4O7CA 4ALHA 5CFWA 4A9JA 5CRZA 5EWDA 4TTEA 5D24A 5CUDA 5FE9A 2RI7A 4BW2A 4OGJA 5I29A 4J0RA 3HMEA 2R0VA 3LQHA 5DYXA 5A5NA 4YABA 4YADA 5L8UA 3UV2A 2DKWA 5CRMA 5A5SA 3HMFA 4HXNA 5DYUA 5CQAA 3S91A 5DLZA 5DYAA 5EA1A 4Z6HA 3LJWA 4J3IA 5D25A 2YYNA 2OSSA 2WP1A 3IU5A 4O7BA 4QR3A 4YAXA 4QR4A 5C7NA 3JVJA 4HXOA 4N3WA 5LJ2A 4QBMA 4UIXA 5H1UA 1WUGA 5ETBA 3UVWA 4NS5A 5F61A 5LVQA 2R0SA 1JM4B 5LJ0A 4YYKA 5HRWA 5CZGA 5IGKA 5IGNA 4YH3A 5BT3A 5J0DA 5FB0A 4WHUA 4O7AA 4ALGA 4YYNA 5D3HA 5FE0A 5CGPA 5EM3A 4CLBA 4E96A 4HBWA 4LZRA 3JVLA 3I3JA 3JVKA 3MXFA 3UVXA 4TZ8A 5E9YA 4A9HA 2YDWA 5ENFA 4CFLA 3SVFA 5LUUA 5FDZA 4UYEA 4YYHA 4LDFA 5FH6A 4O71A 4BW3A 5A5RA 5ENGA 5CPEA 4QNSA 4A9OA 4XUBA 4CUSA 4HXSA 4MEOA 3P1EA 4MR4A 3P1DA 5CQ4A 5F60A 4Z1SA 5TB6A 2WP2A 5F25A 4QZSA 2L84A 2F6JA 4Z1QA 5HFRA 4KCXA 1X0JA 5D7XA 3QZTA 4CUTA 4J1PA 5IGLA 3AADA 4XY8A 2L85A 2RO1A 4PY6A 5EI4A 5EWVA 5I40A 3QZSA 4XYAA 4F3IA 3IU6A 5IBNA 3UW9A 5BT4A 5LJ1A 3NXBA 4YYMA 5F5ZA 3G0LA 4QC3A 4NRBA 5DX4A 1WUMA 2YW5A 4XUAA 5FE4A 4Q0OA 5A5OA 3U5NA 4MEPA 3SVHA 5CUAA 4QUTA 4NUDA 5I7YA 5AMEA 3MUKA 5C87A 4NXJA 5F1LA 2YEKA 4UYHA 5HLSA 4IORA 5AD2A 4TT6A 5ENIA 3ZYUA 4QEWA 5EQ1A 4MENA 5CQ3A 5KU3A 5FFWA 4YY6A 4AKNA 3LXJA 5IGMA 5LKUA 4QSQA 5CQ7A 5E73A 4KV4A 3RCWA 5D3PA 4UIWA 2DVVA 4O75A 4YBTA 5CUGA 4BJXA 5DFDA 5I86A 4A9EA 5II1A 4HBVA 4LZSA 3U5KA 3ONIA 4NR9A 4NRCA 4N4HA 5JI8A 5D3LA 3P5OA 4FLPA 5CU8A 4A9MA 3O36A 2OUOA 5FH7A 4UYDA 4UIYA 5I89A 5DFBA 5CQ6A 4O7FA 5DKCA 5EP7A 4HXLA 4UIZA 4HXRA 3P1FA 4QSUA 5A85A 2YELA 5CQ8A 5AMFA 5FH8A 5D3NA 4NRAA 5EVAA 3UVYA 4A9KA 5E74A 5C85A 3O35A 4QSSA 4YYGA 5HELA 3GG3A 5HJCA 5KTXA 4PCEA 4QSWA 5E9KA 3MULA 4IR3A 4TQNA 3O37A 2E3KA 4QYLA 4DONA 5EWWA 5FG5A 4QSVA 5HEMA 4IR6A 4LRGA 4UIVA 5CTLA 4Z6IA 4LR6A 4A9FA 5FE7A 5I88A 5HQ7A 5AD3A 5I7XA 5COIA 5LKZA 3SVGA 4J0SA 1EQFA 4WHWA 5D0CA 5A7CA 2YEMA 5FE1A 1E6IA 5ENJA 4NYWA 4PKLA 5DYCA 2NXBA 2G4AA 2E7OA 3O34A 4IR4A 5EK9A 5HQ5A 3S92A 4QB3A 4N4FA 1N72A 3O33A 5FFYA 4QSRA 3QZVA 3U5PA 5A82A 4QEVA 3U5LA 2FSAA 4TT2A 4NYXA 4CURA 2RNXA 5LKTA 5KTUA 4BW1A 2D9EA 3MB3A 5F1HA 4HXKA 2OO1A 5D26A 4TYLA 2LSPB 4LYWA 5F36A 5IIDA 4BHWA 1ZS5A 5G4SA 3U5OA 3UV4A 4PCIA 5H85A 5JWMA 4HBYA 5EGUA 3U5JA 2I7KA 4TZ2A 5CS8A 5DLXA 5FG4A 2DWWA 4LC2A 5E3DA 5EPBA 4MR3A 5E3GA 5KHMA 4BW4A 4LYIA 5CQ5A 3UVDA 2YQDA 4IOOA 5L99A 4OUFA 2KTBB 3JVMA 5CP5A 4NR6A 4O77A
chains in the Genus database with same CATH superfamily
5C4QA 5HQ6A 4PTBA 4IOQA 2L5EA 5CUEA 2R10A 4YH4A 5IG6A 5L96A 5FG6A 4YK0A 5I1QA 2RFJA 5EWCA 2R0YA 4O72A 4IR5A 4PS5A 5C8GA 5ENBA 5DFCA 4NUEA 4CL9A 4QEUA 4KV1A 4QSXA 2F6NA 5ENEA 4XY9A 4LYSA 5L8TA 5DBMA 4O76A 3Q2EA 5FBXA 2RNWA 2DATA 4TS8A 2GRCA 3AQAA 4QR5A 4UYFA 4NR5A 4YBSA 4NUCA 4QSPA 5L98A 2I8NA 5E7DA 4YYDA 5CQTA 5EU1A 2D82A 5KO4A 5A83A 5E0RA 5H1TA 5LKXA 2RNYA 4A9LA 5C89A 4NYVA 3D7CA 4HXPA 4WIVA 5BT5A 4YY4A 4OGIA 4NR8A 3DWYA 4CFKA 5E9LA 4X2IA 5L97A 5DW2A 4MR6A 5HENA 4CUQA 5A5QA 4NQNA 5KTWA 5CUCA 3DAIA 4QYDA 5F63A 5EPRA 5FFVA 5II2A 4YATA 4O70A 5D3JA 4N4IA 4ZQLA 5TCMA 2E7NA 2DVQA 2DVSA 5ACYA 4NQMA 4CUUA 4O74A 1F68A 4UYGA 5F2PA 4UIUA 4N4GA 5ETDA 4GPJA 2MJVB 4UITA 5HRVA 4TT4A 5ENCA 4ZC9A 4TU4A 5E9IA 5HRXA 5LVRA 5DKHA 5E9VA 3HMHA 4O78A 5EPSA 4LZ2A 5HFQA 2DVRA 5FE5A 3Q2FA 4YYJA 4QC1A 2H60A 5EICA 4A9IA 3LQIA 3P1CA 5FE8A 5EV9A 5E9MA 5A81A 5DKDA 5I80A 4C66A 4YYIA 5A5PA 3LQJA 1JSPB 5FE6A 4NR7A 5D3RA 3TLPA 4QY4A 4MR5A 3MB4A 3UV5A 1ZKRA 4YBMA 5FE2A 3MQMA 5G4RA 5K29A 5FE3A 5HCLA 4MEQA 4A9NA 4CUPA 2RS9B 3U5MA 5DW1A 4QUUA 4RVRA 5EISA 4O7EA 5D3SA 3VKGA 4QSTA 4TU6A 5CY9A 5HM0A 5CUBA 4HBXA 3K2JA 5FB1A 5F62A 5H1VA 3FKMX 4Z93A 4NR4A 4HXMA 5EWHA 4Y03A 5D3TA 4ZW1A 4UYFB 5ENHA 5I83A 3G0JA 5DY7A 4YC9A 5F3AA 4Q0NA 2N9GA 4C67A 4O7CA 4ALHA 5CFWA 4A9JA 5CRZA 5EWDA 4TTEA 5D24A 5CUDA 5FE9A 2RI7A 4BW2A 4OGJA 5I29A 4J0RA 3HMEA 2R0VA 3LQHA 5DYXA 5A5NA 4YABA 4YADA 5L8UA 3UV2A 2DKWA 5CRMA 5A5SA 3HMFA 4HXNA 5DYUA 5CQAA 3S91A 5DLZA 5DYAA 5EA1A 4Z6HA 3LJWA 4J3IA 5D25A 2YYNA 2OSSA 2WP1A 3IU5A 4O7BA 4QR3A 4YAXA 4QR4A 5C7NA 3JVJA 4HXOA 4N3WA 5LJ2A 4QBMA 4UIXA 5H1UA 1WUGA 5ETBA 3UVWA 4NS5A 5F61A 5LVQA 2R0SA 1JM4B 5LJ0A 4YYKA 5HRWA 3VKHA 5CZGA 5IGKA 5IGNA 4YH3A 5BT3A 5J0DA 5FB0A 4WHUA 4O7AA 4ALGA 4YYNA 5D3HA 5FE0A 5CGPA 5EM3A 4CLBA 4E96A 4HBWA 4LZRA 3JVLA 3JVKA 3I3JA 3MXFA 3UVXA 4TZ8A 5E9YA 4A9HA 2YDWA 5ENFA 4CFLA 3SVFA 5LUUA 5FDZA 4UYEA 4YYHA 4LDFA 5FH6A 4O71A 4BW3A 5A5RA 5ENGA 5CPEA 4QNSA 4A9OA 4XUBA 3D1DA 4CUSA 4HXSA 4MEOA 3P1EA 4MR4A 3P1DA 5CQ4A 1PUOA 2EJNA 5F60A 4Z1SA 5TB6A 2WP2A 5F25A 4QZSA 2L84A 2F6JA 4Z1QA 5HFRA 4KCXA 1X0JA 5D7XA 3QZTA 4CUTA 4J1PA 5IGLA 3AADA 4XY8A 2L85A 2RO1A 4PY6A 5EI4A 5EWVA 5I40A 3QZSA 4XYAA 4F3IA 3IU6A 5IBNA 3UW9A 5BT4A 5LJ1A 3NXBA 4YYMA 5F5ZA 3G0LA 4QC3A 4NRBA 5DX4A 1WUMA 2YW5A 4XUAA 5FE4A 4Q0OA 5A5OA 3U5NA 4MEPA 3SVHA 5CUAA 4QUTA 4NUDA 5I7YA 5AMEA 3MUKA 5C87A 4NXJA 5F1LA 2YEKA 4UYHA 5HLSA 4IORA 5AD2A 4TT6A 5ENIA 3ZYUA 4QEWA 5EQ1A 4MENA 5CQ3A 5KU3A 5FFWA 4YY6A 4AKNA 3LXJA 5IGMA 5LKUA 4QSQA 5CQ7A 5E73A 4KV4A 3RCWA 5D3PA 4UIWA 2DVVA 4O75A 4YBTA 5CUGA 4BJXA 5DFDA 5I86A 4A9EA 5II1A 4HBVA 4LZSA 3U5KA 3ONIA 4NR9A 4NRCA 4N4HA 5JI8A 5D3LA 3P5OA 4FLPA 5CU8A 4A9MA 3O36A 2OUOA 4AKHA 5FH7A 4UYDA 4UIYA 5I89A 4AKGA 5DFBA 5CQ6A 4O7FA 5DKCA 5EP7A 4HXLA 4UIZA 4HXRA 3P1FA 4QSUA 5A85A 2YELA 3ERRA 5CQ8A 5AMFA 5FH8A 5D3NA 4NRAA 5EVAA 3UVYA 4A9KA 5E74A 5C85A 3O35A 4QSSA 4YYGA 5HELA 3GG3A 5HJCA 5KTXA 4PCEA 4QSWA 5E9KA 3MULA 4IR3A 4TQNA 3O37A 2E3KA 4QYLA 4DONA 5EWWA 5FG5A 4QSVA 5HEMA 4IR6A 4LRGA 4UIVA 5CTLA 4Z6IA 4LR6A 4A9FA 5FE7A 5I88A 5HQ7A 5AD3A 5I7XA 5COIA 5LKZA 3SVGA 4J0SA 1EQFA 4WHWA 5D0CA 5A7CA 2YEMA 5FE1A 1E6IA 5ENJA 4NYWA 4PKLA 5DYCA 2NXBA 3D1BA 2G4AA 2E7OA 3O34A 4IR4A 5EK9A 5HQ5A 3S92A 4QB3A 4N4FA 1N72A 3O33A 5FFYA 4QSRA 3QZVA 3U5PA 5A82A 4QEVA 3U5LA 2FSAA 4TT2A 4NYXA 4CURA 2RNXA 5LKTA 5KTUA 4AKIA 4BW1A 2D9EA 3MB3A 5F1HA 4HXKA 2OO1A 5D26A 4TYLA 2LSPB 4LYWA 5F36A 5IIDA 4BHWA 1ZS5A 5G4SA 3U5OA 3UV4A 4PCIA 5H85A 5JWMA 4HBYA 5EGUA 3U5JA 2I7KA 4TZ2A 5CS8A 5DLXA 5FG4A 4AI6A 2DWWA 4LC2A 5E3DA 5EPBA 4MR3A 5E3GA 5KHMA 4BW4A 4LYIA 5CQ5A 3UVDA 2YQDA 4IOOA 5L99A 4OUFA 2KTBB 3JVMA 5CP5A 4NR6A 4O77A
chains in the Genus database with same CATH topology
5C4QA 5HQ6A 4PTBA 4IOQA 2L5EA 5CUEA 2R10A 4YH4A 5IG6A 5L96A 5FG6A 4YK0A 5I1QA 2RFJA 5EWCA 2R0YA 4O72A 4IR5A 4PS5A 5C8GA 5ENBA 5DFCA 4NUEA 4CL9A 4QEUA 4KV1A 4QSXA 2F6NA 5ENEA 4XY9A 4LYSA 5L8TA 5DBMA 4O76A 3Q2EA 5FBXA 2RNWA 2DATA 4TS8A 2GRCA 3AQAA 4QR5A 4UYFA 4NR5A 4YBSA 4NUCA 4QSPA 5L98A 2I8NA 5E7DA 4YYDA 5CQTA 5EU1A 2D82A 5KO4A 5A83A 5E0RA 5H1TA 5LKXA 2RNYA 4A9LA 5C89A 4NYVA 3D7CA 4HXPA 4WIVA 5BT5A 4YY4A 4OGIA 4NR8A 3DWYA 4CFKA 5E9LA 4X2IA 5L97A 5DW2A 4MR6A 5HENA 4CUQA 5A5QA 4NQNA 5KTWA 5CUCA 3DAIA 4QYDA 5F63A 5EPRA 5FFVA 5II2A 4YATA 4O70A 5D3JA 4N4IA 4ZQLA 5TCMA 2E7NA 2DVQA 2DVSA 5ACYA 4NQMA 4CUUA 4O74A 1F68A 4UYGA 5F2PA 4UIUA 4N4GA 5ETDA 4GPJA 2MJVB 4UITA 5HRVA 4TT4A 5ENCA 4ZC9A 4TU4A 5E9IA 5HRXA 5LVRA 5DKHA 5E9VA 3HMHA 4O78A 5EPSA 4LZ2A 5HFQA 2DVRA 5FE5A 3Q2FA 4YYJA 4QC1A 2H60A 5EICA 4A9IA 3LQIA 3P1CA 5FE8A 5EV9A 5E9MA 5A81A 5DKDA 5I80A 4C66A 4YYIA 5A5PA 3LQJA 1JSPB 5FE6A 4NR7A 5D3RA 3TLPA 4QY4A 4MR5A 3MB4A 3UV5A 4YBMA 5FE2A 3MQMA 5G4RA 5K29A 5FE3A 5HCLA 4MEQA 4A9NA 4CUPA 2RS9B 3U5MA 5DW1A 4QUUA 4RVRA 5EISA 4O7EA 5D3SA 4QSTA 4TU6A 5CY9A 5HM0A 5CUBA 4HBXA 3K2JA 5FB1A 5F62A 5H1VA 3FKMX 4Z93A 4NR4A 4HXMA 5EWHA 4Y03A 5D3TA 4ZW1A 4UYFB 5ENHA 5I83A 3G0JA 5DY7A 4YC9A 5F3AA 4Q0NA 2N9GA 4C67A 4O7CA 4ALHA 5CFWA 4A9JA 5CRZA 5EWDA 4TTEA 5D24A 5CUDA 5FE9A 2RI7A 4BW2A 4OGJA 5I29A 4J0RA 3HMEA 2R0VA 3LQHA 5DYXA 5A5NA 4YABA 4YADA 5L8UA 3UV2A 2DKWA 5CRMA 5A5SA 3HMFA 4HXNA 5DYUA 5CQAA 3S91A 5DLZA 5DYAA 5EA1A 4Z6HA 3LJWA 4J3IA 5D25A 2YYNA 2OSSA 2WP1A 3IU5A 4O7BA 4QR3A 4YAXA 4QR4A 5C7NA 3JVJA 4HXOA 4N3WA 5LJ2A 4QBMA 4UIXA 5H1UA 1WUGA 5ETBA 3UVWA 4NS5A 5F61A 5LVQA 2R0SA 1JM4B 5LJ0A 4YYKA 5HRWA 5CZGA 5IGKA 5IGNA 4YH3A 5BT3A 5J0DA 5FB0A 4WHUA 4O7AA 4ALGA 4YYNA 5D3HA 5FE0A 5CGPA 5EM3A 4CLBA 4E96A 4HBWA 4LZRA 3JVLA 3I3JA 3JVKA 3MXFA 3UVXA 4TZ8A 5E9YA 4A9HA 2YDWA 5ENFA 4CFLA 3SVFA 5LUUA 5FDZA 4UYEA 4YYHA 4LDFA 5FH6A 4O71A 4BW3A 5A5RA 5ENGA 5CPEA 4QNSA 4A9OA 4XUBA 4CUSA 4HXSA 4MEOA 3P1EA 4MR4A 3P1DA 5CQ4A 5F60A 4Z1SA 5TB6A 2WP2A 5F25A 4QZSA 2L84A 2F6JA 4Z1QA 5HFRA 4KCXA 1X0JA 5D7XA 3QZTA 4CUTA 4J1PA 5IGLA 3AADA 4XY8A 2L85A 2RO1A 4PY6A 5EI4A 5EWVA 5I40A 3QZSA 4XYAA 4F3IA 3IU6A 5IBNA 3UW9A 5BT4A 5LJ1A 3NXBA 4YYMA 5F5ZA 3G0LA 4QC3A 4NRBA 5DX4A 1WUMA 2YW5A 4XUAA 5FE4A 4Q0OA 5A5OA 3U5NA 4MEPA 3SVHA 5CUAA 4QUTA 4NUDA 5I7YA 5AMEA 3MUKA 5C87A 4NXJA 5F1LA 2YEKA 4UYHA 5HLSA 4IORA 5AD2A 4TT6A 5ENIA 3ZYUA 4QEWA 5EQ1A 4MENA 5CQ3A 5KU3A 5FFWA 4YY6A 4AKNA 3LXJA 5IGMA 5LKUA 4QSQA 5CQ7A 5E73A 4KV4A 3RCWA 5D3PA 4UIWA 2DVVA 4O75A 4YBTA 5CUGA 4BJXA 5DFDA 5I86A 4A9EA 5II1A 4HBVA 4LZSA 3U5KA 3ONIA 4NR9A 4NRCA 4N4HA 5JI8A 5D3LA 3P5OA 4FLPA 5CU8A 4A9MA 3O36A 2OUOA 5FH7A 4UYDA 4UIYA 5I89A 5DFBA 5CQ6A 4O7FA 5DKCA 5EP7A 4HXLA 4UIZA 4HXRA 3P1FA 4QSUA 5A85A 2YELA 5CQ8A 5AMFA 5FH8A 5D3NA 4NRAA 5EVAA 3UVYA 4A9KA 5E74A 5C85A 3O35A 4QSSA 4YYGA 5HELA 3GG3A 5HJCA 5KTXA 4PCEA 4QSWA 5E9KA 3MULA 4IR3A 4TQNA 3O37A 2E3KA 4QYLA 4DONA 5EWWA 5FG5A 4QSVA 5HEMA 4IR6A 4LRGA 4UIVA 5CTLA 4Z6IA 4LR6A 4A9FA 5FE7A 5I88A 5HQ7A 5AD3A 5I7XA 5COIA 5LKZA 3SVGA 4J0SA 1EQFA 4WHWA 5D0CA 5A7CA 2YEMA 5FE1A 1E6IA 5ENJA 4NYWA 4PKLA 5DYCA 2NXBA 2G4AA 2E7OA 3O34A 4IR4A 5EK9A 5HQ5A 3S92A 4QB3A 4N4FA 1N72A 3O33A 5FFYA 4QSRA 3QZVA 3U5PA 5A82A 4QEVA 3U5LA 2FSAA 4TT2A 4NYXA 4CURA 2RNXA 5LKTA 5KTUA 4BW1A 2D9EA 3MB3A 5F1HA 4HXKA 2OO1A 5D26A 4TYLA 2LSPB 4LYWA 5F36A 5IIDA 4BHWA 1ZS5A 5G4SA 3U5OA 3UV4A 4PCIA 5H85A 5JWMA 4HBYA 5EGUA 3U5JA 2I7KA 4TZ2A 5CS8A 5DLXA 5FG4A 2DWWA 4LC2A 5E3DA 5EPBA 4MR3A 5E3GA 5KHMA 4BW4A 4LYIA 5CQ5A 3UVDA 2YQDA 4IOOA 5L99A 4OUFA 2KTBB 3JVMA 5CP5A 4NR6A 4O77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4Q A;  5HQ6 A;  4PTB A;  4IOQ A;  2L5E A;  5CUE A;  2R10 A;  4YH4 A;  5IG6 A;  5L96 A;  5FG6 A;  4YK0 A;  5I1Q A;  2RFJ A;  5EWC A;  2R0Y A;  4O72 A;  4IR5 A;  4PS5 A;  5C8G A;  5ENB A;  5DFC A;  4NUE A;  4CL9 A;  4QEU A;  4KV1 A;  4QSX A;  2F6N A;  5ENE A;  4XY9 A;  4LYS A;  5L8T A;  5DBM A;  4O76 A;  3Q2E A;  5FBX A;  2RNW A;  2DAT A;  4TS8 A;  2GRC A;  3AQA A;  4QR5 A;  4UYF A;  4NR5 A;  4YBS A;  4NUC A;  4QSP A;  5L98 A;  2I8N A;  5E7D A;  4YYD A;  5CQT A;  5EU1 A;  2D82 A;  5KO4 A;  5A83 A;  5E0R A;  5H1T A;  5LKX A;  2RNY A;  4A9L A;  5C89 A;  4NYV A;  3D7C A;  4HXP A;  4WIV A;  5BT5 A;  4YY4 A;  4OGI A;  4NR8 A;  3DWY A;  4CFK A;  5E9L A;  4X2I A;  5L97 A;  5DW2 A;  4MR6 A;  5HEN A;  4CUQ A;  5A5Q A;  4NQN A;  5KTW A;  5CUC A;  3DAI A;  4QYD A;  5F63 A;  5EPR A;  5FFV A;  5II2 A;  4YAT A;  4O70 A;  5D3J A;  4N4I A;  4ZQL A;  5TCM A;  2E7N A;  2DVQ A;  2DVS A;  5ACY A;  4NQM A;  4CUU A;  4O74 A;  1F68 A;  4UYG A;  5F2P A;  4UIU A;  4N4G A;  5ETD A;  4GPJ A;  2MJV B;  4UIT A;  5HRV A;  4TT4 A;  5ENC A;  4ZC9 A;  4TU4 A;  5E9I A;  5HRX A;  5LVR A;  5DKH A;  5E9V A;  3HMH A;  4O78 A;  5EPS A;  4LZ2 A;  5HFQ A;  2DVR A;  5FE5 A;  3Q2F A;  4YYJ A;  4QC1 A;  2H60 A;  5EIC A;  4A9I A;  3LQI A;  3P1C A;  5FE8 A;  5EV9 A;  5E9M A;  5A81 A;  5DKD A;  5I80 A;  4C66 A;  4YYI A;  5A5P A;  3LQJ A;  1JSP B;  5FE6 A;  4NR7 A;  5D3R A;  3TLP A;  4QY4 A;  4MR5 A;  3MB4 A;  3UV5 A;  4YBM A;  5FE2 A;  3MQM A;  5G4R A;  5K29 A;  5FE3 A;  5HCL A;  4MEQ A;  4A9N A;  4CUP A;  2RS9 B;  3U5M A;  5DW1 A;  4QUU A;  4RVR A;  5EIS A;  4O7E A;  5D3S A;  4QST A;  4TU6 A;  5CY9 A;  5HM0 A;  5CUB A;  4HBX A;  3K2J A;  5FB1 A;  5F62 A;  5H1V A;  3FKM X;  4Z93 A;  4NR4 A;  4HXM A;  5EWH A;  4Y03 A;  5D3T A;  4ZW1 A;  4UYF B;  5ENH A;  5I83 A;  3G0J A;  5DY7 A;  4YC9 A;  5F3A A;  4Q0N A;  2N9G A;  4C67 A;  4O7C A;  4ALH A;  5CFW A;  4A9J A;  5CRZ A;  5EWD A;  4TTE A;  5D24 A;  5CUD A;  5FE9 A;  2RI7 A;  4BW2 A;  4OGJ A;  5I29 A;  4J0R A;  3HME A;  2R0V A;  3LQH A;  5DYX A;  5A5N A;  4YAB A;  4YAD A;  5L8U A;  3UV2 A;  2DKW A;  5CRM A;  5A5S A;  3HMF A;  4HXN A;  5DYU A;  5CQA A;  3S91 A;  5DLZ A;  5DYA A;  5EA1 A;  4Z6H A;  3LJW A;  4J3I A;  5D25 A;  2YYN A;  2OSS A;  2WP1 A;  3IU5 A;  4O7B A;  4QR3 A;  4YAX A;  4QR4 A;  5C7N A;  3JVJ A;  4HXO A;  4N3W A;  5LJ2 A;  4QBM A;  4UIX A;  5H1U A;  1WUG A;  5ETB A;  3UVW A;  4NS5 A;  5F61 A;  5LVQ A;  2R0S A;  1JM4 B;  5LJ0 A;  4YYK A;  5HRW A;  5CZG A;  5IGK A;  5IGN A;  4YH3 A;  5BT3 A;  5J0D A;  5FB0 A;  4WHU A;  4O7A A;  4ALG A;  4YYN A;  5D3H A;  5FE0 A;  5CGP A;  5EM3 A;  4CLB A;  4E96 A;  4HBW A;  4LZR A;  3JVL A;  3I3J A;  3JVK A;  3MXF A;  3UVX A;  4TZ8 A;  5E9Y A;  4A9H A;  2YDW A;  5ENF A;  4CFL A;  3SVF A;  5LUU A;  5FDZ A;  4UYE A;  4YYH A;  4LDF A;  5FH6 A;  4O71 A;  4BW3 A;  5A5R A;  5ENG A;  5CPE A;  4QNS A;  4A9O A;  4XUB A;  4CUS A;  4HXS A;  4MEO A;  3P1E A;  4MR4 A;  3P1D A;  5CQ4 A;  5F60 A;  4Z1S A;  5TB6 A;  2WP2 A;  5F25 A;  4QZS A;  2L84 A;  2F6J A;  4Z1Q A;  5HFR A;  4KCX A;  1X0J A;  5D7X A;  3QZT A;  4CUT A;  4J1P A;  5IGL A;  3AAD A;  4XY8 A;  2L85 A;  2RO1 A;  4PY6 A;  5EI4 A;  5EWV A;  5I40 A;  3QZS A;  4XYA A;  4F3I A;  3IU6 A;  5IBN A;  3UW9 A;  5BT4 A;  5LJ1 A;  3NXB A;  4YYM A;  5F5Z A;  3G0L A;  4QC3 A;  4NRB A;  5DX4 A;  1WUM A;  2YW5 A;  4XUA A;  5FE4 A;  4Q0O A;  5A5O A;  3U5N A;  4MEP A;  3SVH A;  5CUA A;  4QUT A;  4NUD A;  5I7Y A;  5AME A;  3MUK A;  5C87 A;  4NXJ A;  5F1L A;  2YEK A;  4UYH A;  5HLS A;  4IOR A;  5AD2 A;  4TT6 A;  5ENI A;  3ZYU A;  4QEW A;  5EQ1 A;  4MEN A;  5CQ3 A;  5KU3 A;  5FFW A;  4YY6 A;  4AKN A;  3LXJ A;  5IGM A;  5LKU A;  4QSQ A;  5CQ7 A;  5E73 A;  4KV4 A;  3RCW A;  5D3P A;  4UIW A;  2DVV A;  4O75 A;  4YBT A;  5CUG A;  4BJX A;  5DFD A;  5I86 A;  4A9E A;  5II1 A;  4HBV A;  4LZS A;  3U5K A;  3ONI A;  4NR9 A;  4NRC A;  4N4H A;  5JI8 A;  5D3L A;  3P5O A;  4FLP A;  5CU8 A;  4A9M A;  3O36 A;  2OUO A;  5FH7 A;  4UYD A;  4UIY A;  5I89 A;  5DFB A;  5CQ6 A;  4O7F A;  5DKC A;  5EP7 A;  4HXL A;  4UIZ A;  4HXR A;  3P1F A;  4QSU A;  5A85 A;  2YEL A;  5CQ8 A;  5AMF A;  5FH8 A;  5D3N A;  4NRA A;  5EVA A;  3UVY A;  4A9K A;  5E74 A;  5C85 A;  3O35 A;  4QSS A;  4YYG A;  5HEL A;  3GG3 A;  5HJC A;  5KTX A;  4PCE A;  4QSW A;  5E9K A;  3MUL A;  4IR3 A;  4TQN A;  3O37 A;  2E3K A;  4QYL A;  4DON A;  5EWW A;  5FG5 A;  4QSV A;  5HEM A;  4IR6 A;  4LRG A;  4UIV A;  5CTL A;  4Z6I A;  4LR6 A;  4A9F A;  5FE7 A;  5I88 A;  5HQ7 A;  5AD3 A;  5I7X A;  5COI A;  5LKZ A;  3SVG A;  4J0S A;  1EQF A;  4WHW A;  5D0C A;  5A7C A;  2YEM A;  5FE1 A;  1E6I A;  5ENJ A;  4NYW A;  4PKL A;  5DYC A;  2NXB A;  2G4A A;  2E7O A;  3O34 A;  4IR4 A;  5EK9 A;  5HQ5 A;  3S92 A;  4QB3 A;  4N4F A;  1N72 A;  3O33 A;  5FFY A;  4QSR A;  3QZV A;  3U5P A;  5A82 A;  4QEV A;  3U5L A;  2FSA A;  4TT2 A;  4NYX A;  4CUR A;  2RNX A;  5LKT A;  5KTU A;  4BW1 A;  2D9E A;  3MB3 A;  5F1H A;  4HXK A;  2OO1 A;  5D26 A;  4TYL A;  2LSP B;  4LYW A;  5F36 A;  5IID A;  4BHW A;  1ZS5 A;  5G4S A;  3U5O A;  3UV4 A;  4PCI A;  5H85 A;  5JWM A;  4HBY A;  5EGU A;  3U5J A;  2I7K A;  4TZ2 A;  5CS8 A;  5DLX A;  5FG4 A;  2DWW A;  4LC2 A;  5E3D A;  5EPB A;  4MR3 A;  5E3G A;  5KHM A;  4BW4 A;  4LYI A;  5CQ5 A;  3UVD A;  2YQD A;  4IOO A;  5L99 A;  4OUF A;  2KTB B;  3JVM A;  5CP5 A;  4NR6 A;  4O77 A; 
#chains in the Genus database with same CATH topology
 5C4Q A;  5HQ6 A;  4PTB A;  4IOQ A;  2L5E A;  5CUE A;  2R10 A;  4YH4 A;  5IG6 A;  5L96 A;  5FG6 A;  4YK0 A;  5I1Q A;  2RFJ A;  5EWC A;  2R0Y A;  4O72 A;  4IR5 A;  4PS5 A;  5C8G A;  5ENB A;  5DFC A;  4NUE A;  4CL9 A;  4QEU A;  4KV1 A;  4QSX A;  2F6N A;  5ENE A;  4XY9 A;  4LYS A;  5L8T A;  5DBM A;  4O76 A;  3Q2E A;  5FBX A;  2RNW A;  2DAT A;  4TS8 A;  2GRC A;  3AQA A;  4QR5 A;  4UYF A;  4NR5 A;  4YBS A;  4NUC A;  4QSP A;  5L98 A;  2I8N A;  5E7D A;  4YYD A;  5CQT A;  5EU1 A;  2D82 A;  5KO4 A;  5A83 A;  5E0R A;  5H1T A;  5LKX A;  2RNY A;  4A9L A;  5C89 A;  4NYV A;  3D7C A;  4HXP A;  4WIV A;  5BT5 A;  4YY4 A;  4OGI A;  4NR8 A;  3DWY A;  4CFK A;  5E9L A;  4X2I A;  5L97 A;  5DW2 A;  4MR6 A;  5HEN A;  4CUQ A;  5A5Q A;  4NQN A;  5KTW A;  5CUC A;  3DAI A;  4QYD A;  5F63 A;  5EPR A;  5FFV A;  5II2 A;  4YAT A;  4O70 A;  5D3J A;  4N4I A;  4ZQL A;  5TCM A;  2E7N A;  2DVQ A;  2DVS A;  5ACY A;  4NQM A;  4CUU A;  4O74 A;  1F68 A;  4UYG A;  5F2P A;  4UIU A;  4N4G A;  5ETD A;  4GPJ A;  2MJV B;  4UIT A;  5HRV A;  4TT4 A;  5ENC A;  4ZC9 A;  4TU4 A;  5E9I A;  5HRX A;  5LVR A;  5DKH A;  5E9V A;  3HMH A;  4O78 A;  5EPS A;  4LZ2 A;  5HFQ A;  2DVR A;  5FE5 A;  3Q2F A;  4YYJ A;  4QC1 A;  2H60 A;  5EIC A;  4A9I A;  3LQI A;  3P1C A;  5FE8 A;  5EV9 A;  5E9M A;  5A81 A;  5DKD A;  5I80 A;  4C66 A;  4YYI A;  5A5P A;  3LQJ A;  1JSP B;  5FE6 A;  4NR7 A;  5D3R A;  3TLP A;  4QY4 A;  4MR5 A;  3MB4 A;  3UV5 A;  1ZKR A;  4YBM A;  5FE2 A;  3MQM A;  5G4R A;  5K29 A;  5FE3 A;  5HCL A;  4MEQ A;  4A9N A;  4CUP A;  2RS9 B;  3U5M A;  5DW1 A;  4QUU A;  4RVR A;  5EIS A;  4O7E A;  5D3S A;  3VKG A;  4QST A;  4TU6 A;  5CY9 A;  5HM0 A;  5CUB A;  4HBX A;  3K2J A;  5FB1 A;  5F62 A;  5H1V A;  3FKM X;  4Z93 A;  4NR4 A;  4HXM A;  5EWH A;  4Y03 A;  5D3T A;  4ZW1 A;  4UYF B;  5ENH A;  5I83 A;  3G0J A;  5DY7 A;  4YC9 A;  5F3A A;  4Q0N A;  2N9G A;  4C67 A;  4O7C A;  4ALH A;  5CFW A;  4A9J A;  5CRZ A;  5EWD A;  4TTE A;  5D24 A;  5CUD A;  5FE9 A;  2RI7 A;  4BW2 A;  4OGJ A;  5I29 A;  4J0R A;  3HME A;  2R0V A;  3LQH A;  5DYX A;  5A5N A;  4YAB A;  4YAD A;  5L8U A;  3UV2 A;  2DKW A;  5CRM A;  5A5S A;  3HMF A;  4HXN A;  5DYU A;  5CQA A;  3S91 A;  5DLZ A;  5DYA A;  5EA1 A;  4Z6H A;  3LJW A;  4J3I A;  5D25 A;  2YYN A;  2OSS A;  2WP1 A;  3IU5 A;  4O7B A;  4QR3 A;  4YAX A;  4QR4 A;  5C7N A;  3JVJ A;  4HXO A;  4N3W A;  5LJ2 A;  4QBM A;  4UIX A;  5H1U A;  1WUG A;  5ETB A;  3UVW A;  4NS5 A;  5F61 A;  5LVQ A;  2R0S A;  1JM4 B;  5LJ0 A;  4YYK A;  5HRW A;  3VKH A;  5CZG A;  5IGK A;  5IGN A;  4YH3 A;  5BT3 A;  5J0D A;  5FB0 A;  4WHU A;  4O7A A;  4ALG A;  4YYN A;  5D3H A;  5FE0 A;  5CGP A;  5EM3 A;  4CLB A;  4E96 A;  4HBW A;  4LZR A;  3JVL A;  3JVK A;  3I3J A;  3MXF A;  3UVX A;  4TZ8 A;  5E9Y A;  4A9H A;  2YDW A;  5ENF A;  4CFL A;  3SVF A;  5LUU A;  5FDZ A;  4UYE A;  4YYH A;  4LDF A;  5FH6 A;  4O71 A;  4BW3 A;  5A5R A;  5ENG A;  5CPE A;  4QNS A;  4A9O A;  4XUB A;  3D1D A;  4CUS A;  4HXS A;  4MEO A;  3P1E A;  4MR4 A;  3P1D A;  5CQ4 A;  1PUO A;  2EJN A;  5F60 A;  4Z1S A;  5TB6 A;  2WP2 A;  5F25 A;  4QZS A;  2L84 A;  2F6J A;  4Z1Q A;  5HFR A;  4KCX A;  1X0J A;  5D7X A;  3QZT A;  4CUT A;  4J1P A;  5IGL A;  3AAD A;  4XY8 A;  2L85 A;  2RO1 A;  4PY6 A;  5EI4 A;  5EWV A;  5I40 A;  3QZS A;  4XYA A;  4F3I A;  3IU6 A;  5IBN A;  3UW9 A;  5BT4 A;  5LJ1 A;  3NXB A;  4YYM A;  5F5Z A;  3G0L A;  4QC3 A;  4NRB A;  5DX4 A;  1WUM A;  2YW5 A;  4XUA A;  5FE4 A;  4Q0O A;  5A5O A;  3U5N A;  4MEP A;  3SVH A;  5CUA A;  4QUT A;  4NUD A;  5I7Y A;  5AME A;  3MUK A;  5C87 A;  4NXJ A;  5F1L A;  2YEK A;  4UYH A;  5HLS A;  4IOR A;  5AD2 A;  4TT6 A;  5ENI A;  3ZYU A;  4QEW A;  5EQ1 A;  4MEN A;  5CQ3 A;  5KU3 A;  5FFW A;  4YY6 A;  4AKN A;  3LXJ A;  5IGM A;  5LKU A;  4QSQ A;  5CQ7 A;  5E73 A;  4KV4 A;  3RCW A;  5D3P A;  4UIW A;  2DVV A;  4O75 A;  4YBT A;  5CUG A;  4BJX A;  5DFD A;  5I86 A;  4A9E A;  5II1 A;  4HBV A;  4LZS A;  3U5K A;  3ONI A;  4NR9 A;  4NRC A;  4N4H A;  5JI8 A;  5D3L A;  3P5O A;  4FLP A;  5CU8 A;  4A9M A;  3O36 A;  2OUO A;  4AKH A;  5FH7 A;  4UYD A;  4UIY A;  5I89 A;  4AKG A;  5DFB A;  5CQ6 A;  4O7F A;  5DKC A;  5EP7 A;  4HXL A;  4UIZ A;  4HXR A;  3P1F A;  4QSU A;  5A85 A;  2YEL A;  3ERR A;  5CQ8 A;  5AMF A;  5FH8 A;  5D3N A;  4NRA A;  5EVA A;  3UVY A;  4A9K A;  5E74 A;  5C85 A;  3O35 A;  4QSS A;  4YYG A;  5HEL A;  3GG3 A;  5HJC A;  5KTX A;  4PCE A;  4QSW A;  5E9K A;  3MUL A;  4IR3 A;  4TQN A;  3O37 A;  2E3K A;  4QYL A;  4DON A;  5EWW A;  5FG5 A;  4QSV A;  5HEM A;  4IR6 A;  4LRG A;  4UIV A;  5CTL A;  4Z6I A;  4LR6 A;  4A9F A;  5FE7 A;  5I88 A;  5HQ7 A;  5AD3 A;  5I7X A;  5COI A;  5LKZ A;  3SVG A;  4J0S A;  1EQF A;  4WHW A;  5D0C A;  5A7C A;  2YEM A;  5FE1 A;  1E6I A;  5ENJ A;  4NYW A;  4PKL A;  5DYC A;  2NXB A;  3D1B A;  2G4A A;  2E7O A;  3O34 A;  4IR4 A;  5EK9 A;  5HQ5 A;  3S92 A;  4QB3 A;  4N4F A;  1N72 A;  3O33 A;  5FFY A;  4QSR A;  3QZV A;  3U5P A;  5A82 A;  4QEV A;  3U5L A;  2FSA A;  4TT2 A;  4NYX A;  4CUR A;  2RNX A;  5LKT A;  5KTU A;  4AKI A;  4BW1 A;  2D9E A;  3MB3 A;  5F1H A;  4HXK A;  2OO1 A;  5D26 A;  4TYL A;  2LSP B;  4LYW A;  5F36 A;  5IID A;  4BHW A;  1ZS5 A;  5G4S A;  3U5O A;  3UV4 A;  4PCI A;  5H85 A;  5JWM A;  4HBY A;  5EGU A;  3U5J A;  2I7K A;  4TZ2 A;  5CS8 A;  5DLX A;  5FG4 A;  4AI6 A;  2DWW A;  4LC2 A;  5E3D A;  5EPB A;  4MR3 A;  5E3G A;  5KHM A;  4BW4 A;  4LYI A;  5CQ5 A;  3UVD A;  2YQD A;  4IOO A;  5L99 A;  4OUF A;  2KTB B;  3JVM A;  5CP5 A;  4NR6 A;  4O77 A; 
#chains in the Genus database with same CATH homology
 5C4Q A;  5HQ6 A;  4PTB A;  4IOQ A;  2L5E A;  5CUE A;  2R10 A;  4YH4 A;  5IG6 A;  5L96 A;  5FG6 A;  4YK0 A;  5I1Q A;  2RFJ A;  5EWC A;  2R0Y A;  4O72 A;  4IR5 A;  4PS5 A;  5C8G A;  5ENB A;  5DFC A;  4NUE A;  4CL9 A;  4QEU A;  4KV1 A;  4QSX A;  2F6N A;  5ENE A;  4XY9 A;  4LYS A;  5L8T A;  5DBM A;  4O76 A;  3Q2E A;  5FBX A;  2RNW A;  2DAT A;  4TS8 A;  2GRC A;  3AQA A;  4QR5 A;  4UYF A;  4NR5 A;  4YBS A;  4NUC A;  4QSP A;  5L98 A;  2I8N A;  5E7D A;  4YYD A;  5CQT A;  5EU1 A;  2D82 A;  5KO4 A;  5A83 A;  5E0R A;  5H1T A;  5LKX A;  2RNY A;  4A9L A;  5C89 A;  4NYV A;  3D7C A;  4HXP A;  4WIV A;  5BT5 A;  4YY4 A;  4OGI A;  4NR8 A;  3DWY A;  4CFK A;  5E9L A;  4X2I A;  5L97 A;  5DW2 A;  4MR6 A;  5HEN A;  4CUQ A;  5A5Q A;  4NQN A;  5KTW A;  5CUC A;  3DAI A;  4QYD A;  5F63 A;  5EPR A;  5FFV A;  5II2 A;  4YAT A;  4O70 A;  5D3J A;  4N4I A;  4ZQL A;  5TCM A;  2E7N A;  2DVQ A;  2DVS A;  5ACY A;  4NQM A;  4CUU A;  4O74 A;  1F68 A;  4UYG A;  5F2P A;  4UIU A;  4N4G A;  5ETD A;  4GPJ A;  2MJV B;  4UIT A;  5HRV A;  4TT4 A;  5ENC A;  4ZC9 A;  4TU4 A;  5E9I A;  5HRX A;  5LVR A;  5DKH A;  5E9V A;  3HMH A;  4O78 A;  5EPS A;  4LZ2 A;  5HFQ A;  2DVR A;  5FE5 A;  3Q2F A;  4YYJ A;  4QC1 A;  2H60 A;  5EIC A;  4A9I A;  3LQI A;  3P1C A;  5FE8 A;  5EV9 A;  5E9M A;  5A81 A;  5DKD A;  5I80 A;  4C66 A;  4YYI A;  5A5P A;  3LQJ A;  1JSP B;  5FE6 A;  4NR7 A;  5D3R A;  3TLP A;  4QY4 A;  4MR5 A;  3MB4 A;  3UV5 A;  4YBM A;  5FE2 A;  3MQM A;  5G4R A;  5K29 A;  5FE3 A;  5HCL A;  4MEQ A;  4A9N A;  4CUP A;  2RS9 B;  3U5M A;  5DW1 A;  4QUU A;  4RVR A;  5EIS A;  4O7E A;  5D3S A;  4QST A;  4TU6 A;  5CY9 A;  5HM0 A;  5CUB A;  4HBX A;  3K2J A;  5FB1 A;  5F62 A;  5H1V A;  3FKM X;  4Z93 A;  4NR4 A;  4HXM A;  5EWH A;  4Y03 A;  5D3T A;  4ZW1 A;  4UYF B;  5ENH A;  5I83 A;  3G0J A;  5DY7 A;  4YC9 A;  5F3A A;  4Q0N A;  2N9G A;  4C67 A;  4O7C A;  4ALH A;  5CFW A;  4A9J A;  5CRZ A;  5EWD A;  4TTE A;  5D24 A;  5CUD A;  5FE9 A;  2RI7 A;  4BW2 A;  4OGJ A;  5I29 A;  4J0R A;  3HME A;  2R0V A;  3LQH A;  5DYX A;  5A5N A;  4YAB A;  4YAD A;  5L8U A;  3UV2 A;  2DKW A;  5CRM A;  5A5S A;  3HMF A;  4HXN A;  5DYU A;  5CQA A;  3S91 A;  5DLZ A;  5DYA A;  5EA1 A;  4Z6H A;  3LJW A;  4J3I A;  5D25 A;  2YYN A;  2OSS A;  2WP1 A;  3IU5 A;  4O7B A;  4QR3 A;  4YAX A;  4QR4 A;  5C7N A;  3JVJ A;  4HXO A;  4N3W A;  5LJ2 A;  4QBM A;  4UIX A;  5H1U A;  1WUG A;  5ETB A;  3UVW A;  4NS5 A;  5F61 A;  5LVQ A;  2R0S A;  1JM4 B;  5LJ0 A;  4YYK A;  5HRW A;  5CZG A;  5IGK A;  5IGN A;  4YH3 A;  5BT3 A;  5J0D A;  5FB0 A;  4WHU A;  4O7A A;  4ALG A;  4YYN A;  5D3H A;  5FE0 A;  5CGP A;  5EM3 A;  4CLB A;  4E96 A;  4HBW A;  4LZR A;  3JVL A;  3I3J A;  3JVK A;  3MXF A;  3UVX A;  4TZ8 A;  5E9Y A;  4A9H A;  2YDW A;  5ENF A;  4CFL A;  3SVF A;  5LUU A;  5FDZ A;  4UYE A;  4YYH A;  4LDF A;  5FH6 A;  4O71 A;  4BW3 A;  5A5R A;  5ENG A;  5CPE A;  4QNS A;  4A9O A;  4XUB A;  4CUS A;  4HXS A;  4MEO A;  3P1E A;  4MR4 A;  3P1D A;  5CQ4 A;  5F60 A;  4Z1S A;  5TB6 A;  2WP2 A;  5F25 A;  4QZS A;  2L84 A;  2F6J A;  4Z1Q A;  5HFR A;  4KCX A;  1X0J A;  5D7X A;  3QZT A;  4CUT A;  4J1P A;  5IGL A;  3AAD A;  4XY8 A;  2L85 A;  2RO1 A;  4PY6 A;  5EI4 A;  5EWV A;  5I40 A;  3QZS A;  4XYA A;  4F3I A;  3IU6 A;  5IBN A;  3UW9 A;  5BT4 A;  5LJ1 A;  3NXB A;  4YYM A;  5F5Z A;  3G0L A;  4QC3 A;  4NRB A;  5DX4 A;  1WUM A;  2YW5 A;  4XUA A;  5FE4 A;  4Q0O A;  5A5O A;  3U5N A;  4MEP A;  3SVH A;  5CUA A;  4QUT A;  4NUD A;  5I7Y A;  5AME A;  3MUK A;  5C87 A;  4NXJ A;  5F1L A;  2YEK A;  4UYH A;  5HLS A;  4IOR A;  5AD2 A;  4TT6 A;  5ENI A;  3ZYU A;  4QEW A;  5EQ1 A;  4MEN A;  5CQ3 A;  5KU3 A;  5FFW A;  4YY6 A;  4AKN A;  3LXJ A;  5IGM A;  5LKU A;  4QSQ A;  5CQ7 A;  5E73 A;  4KV4 A;  3RCW A;  5D3P A;  4UIW A;  2DVV A;  4O75 A;  4YBT A;  5CUG A;  4BJX A;  5DFD A;  5I86 A;  4A9E A;  5II1 A;  4HBV A;  4LZS A;  3U5K A;  3ONI A;  4NR9 A;  4NRC A;  4N4H A;  5JI8 A;  5D3L A;  3P5O A;  4FLP A;  5CU8 A;  4A9M A;  3O36 A;  2OUO A;  5FH7 A;  4UYD A;  4UIY A;  5I89 A;  5DFB A;  5CQ6 A;  4O7F A;  5DKC A;  5EP7 A;  4HXL A;  4UIZ A;  4HXR A;  3P1F A;  4QSU A;  5A85 A;  2YEL A;  5CQ8 A;  5AMF A;  5FH8 A;  5D3N A;  4NRA A;  5EVA A;  3UVY A;  4A9K A;  5E74 A;  5C85 A;  3O35 A;  4QSS A;  4YYG A;  5HEL A;  3GG3 A;  5HJC A;  5KTX A;  4PCE A;  4QSW A;  5E9K A;  3MUL A;  4IR3 A;  4TQN A;  3O37 A;  2E3K A;  4QYL A;  4DON A;  5EWW A;  5FG5 A;  4QSV A;  5HEM A;  4IR6 A;  4LRG A;  4UIV A;  5CTL A;  4Z6I A;  4LR6 A;  4A9F A;  5FE7 A;  5I88 A;  5HQ7 A;  5AD3 A;  5I7X A;  5COI A;  5LKZ A;  3SVG A;  4J0S A;  1EQF A;  4WHW A;  5D0C A;  5A7C A;  2YEM A;  5FE1 A;  1E6I A;  5ENJ A;  4NYW A;  4PKL A;  5DYC A;  2NXB A;  2G4A A;  2E7O A;  3O34 A;  4IR4 A;  5EK9 A;  5HQ5 A;  3S92 A;  4QB3 A;  4N4F A;  1N72 A;  3O33 A;  5FFY A;  4QSR A;  3QZV A;  3U5P A;  5A82 A;  4QEV A;  3U5L A;  2FSA A;  4TT2 A;  4NYX A;  4CUR A;  2RNX A;  5LKT A;  5KTU A;  4BW1 A;  2D9E A;  3MB3 A;  5F1H A;  4HXK A;  2OO1 A;  5D26 A;  4TYL A;  2LSP B;  4LYW A;  5F36 A;  5IID A;  4BHW A;  1ZS5 A;  5G4S A;  3U5O A;  3UV4 A;  4PCI A;  5H85 A;  5JWM A;  4HBY A;  5EGU A;  3U5J A;  2I7K A;  4TZ2 A;  5CS8 A;  5DLX A;  5FG4 A;  2DWW A;  4LC2 A;  5E3D A;  5EPB A;  4MR3 A;  5E3G A;  5KHM A;  4BW4 A;  4LYI A;  5CQ5 A;  3UVD A;  2YQD A;  4IOO A;  5L99 A;  4OUF A;  2KTB B;  3JVM A;  5CP5 A;  4NR6 A;  4O77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...