2DVVA

Crystal structure of the second bromodomain of the human brd2 protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
112
structure length
112
Chain Sequence
GSHMEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 2
publication title Crystal structure of the second bromodomain of the human Brd2 protein
rcsb
source organism Homo sapiens
total genus 42
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2dvvA00
5I29A 4YBSA 4FLPA 5IBNA 5A5QA 5K29A 3K2JA 4N4FA 4CURA 5ENJA 5DW1A 2RO1A 5DX4A 4NR8A 5D3NA 5I7XA 5DFBA 4MEQA 5E9LA 5EWHA 5HFQA 3UVXA 5ACYA 3G0JA 4Z6IA 3LQJA 5D26A 5HLSA 3MQMA 5FE1A 3O36A 5TCMA 4J0RA 4YATA 4LDFA 4MR3A 4IOQA 5IGKA 3UV4A 2WP1A 5LJ1A 5EPRA 5CPEA 3IU5A 5CUEA 5F60A 5F61A 4OUFA 4WHWA 3RCWA 4XUBA 4KV1A 5E9KA 4UIYA 5HQ6A 4QR4A 4ZQLA 5LUUA 4UITA 5FE0A 4NYXA 5CGPA 5FB1A 4QZSA 4MR4A 4PCEA 3Q2FA 2L85A 5F3AA 4YYDA 4Z6HA 2E7OA 5I1QA 5A5NA 4QY4A 5CS8A 5DW2A 2DWWA 1WUGA 5D0CA 5L8TA 4MEPA 4CUTA 5FG6A 4QB3A 4F3IA 2D9EA 5A5OA 1EQFA 4XYAA 2N9GA 2L84A 2KTBB 4BW4A 3TLPA 4LYIA 5BT4A 4QSWA 4QYLA 5E3GA 3U5NA 2F6NA 4QEVA 5DYXA 4YK0A 3O33A 5L8UA 2YQDA 4YBMA 3QZSA 4QC1A 4CLBA 5CUDA 3UVWA 4O71A 5D3LA 2DVRA 3Q2EA 5ENEA 5CFWA 3LJWA 5A7CA 5E9IA 3HMEA 5AD2A 2RNWA 4YADA 4TZ8A 3P1CA 4QR3A 3MB3A 5DKDA 5EK9A 4UYHA 3S91A 5BT5A 4GPJA 4N4HA 4XY9A 3FKMX 4A9OA 5II2A 3U5OA 4J3IA 3I3JA 5E73A 5H1TA 4IOOA 5KO4A 5L99A 5EPBA 5I88A 5LVRA 3IU6A 5A5SA 5D3PA 5A85A 4A9LA 4Q0OA 4YBTA 5L96A 3U5LA 5DLZA 5DKHA 5D3HA 5COIA 2YEMA 4QSPA 2D82A 5E9VA 4C66A 4QNSA 5CUGA 5HENA 5A5RA 5HRVA 2R10A 3MB4A 4CUQA 1JSPB 5A82A 5IG6A 4A9KA 4A9HA 2RNXA 5E3DA 2DVSA 4J0SA 4QUUA 4MENA 4NUDA 3HMHA 4YABA 5CRMA 5EU1A 5EICA 4RVRA 5CQ4A 5FE3A 4YYGA 1ZS5A 4O7CA 5CQ7A 5HFRA 4KCXA 5L98A 5HCLA 3UVDA 5H1VA 5ENBA 3JVMA 5TB6A 4NRAA 5I86A 3ZYUA 3U5JA 3QZTA 3O35A 4TS8A 2LSPB 4HXSA 5DYAA 5AMFA 5KHMA 5I40A 5FB0A 4YC9A 4QR5A 4O72A 4PTBA 2L5EA 2OSSA 5HM0A 4LZRA 5LJ2A 5DYCA 5ENHA 5J0DA 5EP7A 3LQIA 5A83A 4Z1QA 4O7AA 5LJ0A 5C4QA 5C7NA 3O37A 5H85A 1JM4B 4Z93A 5EQ1A 4MR6A 4N4GA 5FH7A 5ENGA 1E6IA 4KV4A 5BT3A 3P1EA 5DYUA 2RI7A 4TU6A 4O77A 3UVYA 4CUPA 4NUEA 5HRWA 2DVVA 5I80A 2I8NA 4IR3A 3SVGA 5F1LA 2YDWA 5KTUA 2R0SA 5IIDA 5KU3A 3JVKA 4DONA 4C67A 4CL9A 5HQ5A 2MJVB 5A5PA 4LC2A 4A9NA 4YY4A 4Y03A 4QSTA 2NXBA 3LXJA 5D3TA 5L97A 4LYWA 4HXPA 4YYHA 2OUOA 5FE8A 5DFCA 4O74A 4WHUA 4LYSA 5ENIA 4PCIA 5FFWA 5FE2A 4CUUA 5CUCA 4A9JA 4XY8A 4O7FA 5F62A 4QSUA 4UYFB 4XUAA 5C89A 5CY9A 4IR4A 5EWDA 5LKUA 4HXMA 4UYFA 4UIZA 5FDZA 4YH4A 3JVJA 4CFKA 5A81A 5F36A 5CQ6A 5ENFA 4HXLA 4N4IA 2DKWA 4QSSA 3SVHA 4BW3A 4PY6A 5F2PA 4NRCA 5EWVA 5HRXA 5G4SA 4LRGA 4NR6A 5EWWA 4PKLA 2H60A 5CQ8A 5EISA 4YH3A 4BW1A 5DLXA 5FE5A 3AQAA 4YYJA 5II1A 4HBVA 5FE9A 5CUBA 5DKCA 4CUSA 5CZGA 4ZW1A 5CUAA 5EGUA 5IGLA 5ENCA 4QSXA 5FE4A 2GRCA 3JVLA 4IORA 4TQNA 5HQ7A 4A9EA 4ALGA 4O76A 5C85A 4MR5A 3UV2A 4NR7A 5H1UA 4X2IA 5E74A 5DFDA 4YY6A 4ZC9A 4NUCA 2WP2A 5HELA 5D3JA 4A9IA 5CTLA 4TTEA 4NR4A 2RFJA 4UIXA 4NRBA 5F1HA 4J1PA 3UW9A 4A9FA 5KTXA 3P1FA 5CQTA 3O34A 4O7BA 4HBWA 2YEKA 1X0JA 5D7XA 4IR5A 5EI4A 4YYNA 2DVQA 5LKTA 3U5MA 5KTWA 5E0RA 5HJCA 3SVFA 4CFLA 5D24A 4UYGA 5DY7A 5ETBA 4TT2A 4O70A 4HBXA 3U5PA 4LR6A 1WUMA 5G4RA 4NR5A 5JWMA 4N3WA 4QUTA 3DAIA 5DBMA 4WIVA 4NQMA 4OGIA 2E7NA 5F63A 5FFVA 4O78A 4HXNA 4QSVA 4OGJA 5LKZA 5IGMA 5C87A 2E3KA 3HMFA 5EVAA 3GG3A 4QBMA 4HXKA 4Z1SA 4NYWA 4UYDA 5CRZA 3P5OA 4TT6A 5LVQA 2F6JA 4ALHA 3D7CA 3QZVA 4TU4A 4NS5A 5E9MA 5FG4A 2YW5A 4UIVA 5AD3A 5I83A 3S92A 2R0VA 5CP5A 5CQ5A 4QSRA 2FSAA 2RNYA 5IGNA 3MULA 3ONIA 4YYMA 5FBXA 4QC3A 4HXRA 4HXOA 5D25A 4PS5A 4YAXA 4NQNA 4QEWA 5D3RA 5C8GA 4NYVA 2I7KA 4A9MA 4AKNA 4O7EA 2R0YA 5D3SA 3U5KA 2YELA 3NXBA 5FFYA 5EA1A 4UYEA 4NR9A 2OO1A 4NXJA 5ETDA 2RS9B 4LZSA 4Q0NA 4TZ2A 4QYDA 5LKXA 5CU8A 4IR6A 5HEMA 4BW2A 5EM3A 4UIUA 5F25A 5I89A 4UIWA 4MEOA 5JI8A 5FH8A 5EWCA 1F68A 5FH6A 4QSQA 4TT4A 4YYIA 5CQ3A 5EV9A 3AADA 3G0LA 2G4AA 3MUKA 2YYNA 4QEUA 5F5ZA 4E96A 4LZ2A 4BJXA 5AMEA 3LQHA 4BHWA 3MXFA 2DATA 5EPSA 4TYLA 3UV5A 5E7DA 3DWYA 5FE6A 4YYKA 3P1DA 5FE7A 5E9YA 5CQAA 5FG5A 1N72A 5I7YA 4HBYA 4O75A
chains in the Genus database with same CATH superfamily
5I29A 4YBSA 4FLPA 5IBNA 5A5QA 5K29A 3K2JA 4N4FA 4CURA 5ENJA 5DW1A 2RO1A 5DX4A 4NR8A 5D3NA 5I7XA 5DFBA 4MEQA 5E9LA 5EWHA 5HFQA 3UVXA 5ACYA 3G0JA 4Z6IA 3LQJA 5D26A 5HLSA 3MQMA 5FE1A 3O36A 5TCMA 4J0RA 4YATA 4LDFA 4MR3A 4IOQA 5IGKA 3UV4A 2WP1A 5LJ1A 5EPRA 5CPEA 3IU5A 5CUEA 5F60A 5F61A 4OUFA 4WHWA 3RCWA 4XUBA 4KV1A 5E9KA 4UIYA 5HQ6A 4QR4A 4ZQLA 5LUUA 4UITA 5FE0A 4NYXA 5CGPA 5FB1A 4QZSA 4MR4A 4PCEA 3Q2FA 2L85A 5F3AA 4YYDA 4Z6HA 2E7OA 5I1QA 5A5NA 4QY4A 5CS8A 5DW2A 3D1BA 2DWWA 1WUGA 5D0CA 5L8TA 4MEPA 4CUTA 5FG6A 4AKHA 4QB3A 4F3IA 2D9EA 5A5OA 1EQFA 4XYAA 2N9GA 2L84A 2KTBB 4BW4A 3TLPA 4LYIA 5BT4A 4QSWA 4QYLA 5E3GA 3U5NA 2F6NA 4QEVA 5DYXA 4YK0A 3ERRA 3O33A 5L8UA 2YQDA 4YBMA 3QZSA 4QC1A 4CLBA 5CUDA 3UVWA 4O71A 5D3LA 2DVRA 3Q2EA 5ENEA 5CFWA 3LJWA 5A7CA 5E9IA 3HMEA 5AD2A 2RNWA 4YADA 4TZ8A 3P1CA 4QR3A 3MB3A 5DKDA 5EK9A 4UYHA 3S91A 5BT5A 4GPJA 4N4HA 4XY9A 3FKMX 4A9OA 5II2A 3U5OA 4J3IA 3I3JA 5E73A 5H1TA 4IOOA 5KO4A 5L99A 3VKHA 5EPBA 5I88A 5LVRA 3IU6A 5A5SA 5D3PA 5A85A 4A9LA 4Q0OA 4YBTA 5L96A 3U5LA 5DLZA 5DKHA 5D3HA 5COIA 2YEMA 4QSPA 2D82A 5E9VA 4C66A 4QNSA 5CUGA 5HENA 5A5RA 5HRVA 2R10A 3MB4A 3D1DA 4CUQA 1JSPB 5A82A 5IG6A 4A9KA 4A9HA 2RNXA 5E3DA 2DVSA 4J0SA 4QUUA 4MENA 4NUDA 3HMHA 4YABA 5CRMA 5EU1A 5EICA 4RVRA 5CQ4A 5FE3A 4YYGA 1ZS5A 4O7CA 5CQ7A 5HFRA 4KCXA 5L98A 5HCLA 3UVDA 5H1VA 5ENBA 3JVMA 5TB6A 4NRAA 5I86A 3ZYUA 3U5JA 3QZTA 3O35A 4TS8A 2LSPB 4HXSA 5DYAA 5AMFA 5KHMA 5I40A 5FB0A 4YC9A 4QR5A 4O72A 4PTBA 1PUOA 2L5EA 2OSSA 5HM0A 4LZRA 5LJ2A 5DYCA 5ENHA 5J0DA 5EP7A 4AKGA 3LQIA 5A83A 4Z1QA 4O7AA 5LJ0A 5C4QA 5C7NA 3O37A 5H85A 1JM4B 4Z93A 5EQ1A 4MR6A 4N4GA 5FH7A 5ENGA 1E6IA 4KV4A 5BT3A 3P1EA 5DYUA 2RI7A 4TU6A 4O77A 3UVYA 4CUPA 4NUEA 5HRWA 2DVVA 5I80A 2I8NA 4IR3A 3SVGA 5F1LA 2YDWA 5KTUA 2R0SA 5IIDA 5KU3A 3JVKA 4DONA 4C67A 4CL9A 5HQ5A 2MJVB 5A5PA 4LC2A 4A9NA 4YY4A 4Y03A 4QSTA 2NXBA 3LXJA 5D3TA 5L97A 4LYWA 4HXPA 4YYHA 2OUOA 5FE8A 5DFCA 4O74A 4WHUA 4LYSA 5ENIA 4PCIA 5FFWA 5FE2A 4CUUA 5CUCA 4A9JA 4XY8A 4O7FA 5F62A 4QSUA 4UYFB 4XUAA 5C89A 5CY9A 4IR4A 5EWDA 5LKUA 4HXMA 4UYFA 4UIZA 5FDZA 3VKGA 4YH4A 3JVJA 4CFKA 5A81A 5F36A 5CQ6A 5ENFA 4HXLA 4N4IA 2DKWA 4QSSA 3SVHA 4BW3A 4PY6A 5F2PA 4NRCA 5EWVA 5HRXA 5G4SA 4LRGA 4NR6A 5EWWA 4PKLA 2H60A 5CQ8A 5EISA 4YH3A 4BW1A 5DLXA 5FE5A 3AQAA 4YYJA 5II1A 4HBVA 5FE9A 5CUBA 5DKCA 4CUSA 5CZGA 4ZW1A 5CUAA 5EGUA 5IGLA 5ENCA 4QSXA 5FE4A 2GRCA 3JVLA 4IORA 4TQNA 5HQ7A 4A9EA 4ALGA 4O76A 5C85A 4MR5A 3UV2A 4NR7A 5H1UA 4X2IA 5E74A 5DFDA 4YY6A 4ZC9A 4NUCA 2WP2A 5HELA 5D3JA 4A9IA 5CTLA 4TTEA 4NR4A 2RFJA 4UIXA 4NRBA 5F1HA 4J1PA 3UW9A 4A9FA 5KTXA 3P1FA 5CQTA 3O34A 4O7BA 4HBWA 2YEKA 1X0JA 5D7XA 4IR5A 5EI4A 4YYNA 2DVQA 5LKTA 3U5MA 5KTWA 5E0RA 5HJCA 4AI6A 3SVFA 4CFLA 5D24A 4UYGA 5DY7A 5ETBA 4TT2A 4O70A 4HBXA 3U5PA 2EJNA 4LR6A 1WUMA 5G4RA 4NR5A 5JWMA 4N3WA 4QUTA 3DAIA 5DBMA 4WIVA 4NQMA 4OGIA 2E7NA 5F63A 5FFVA 4O78A 4HXNA 4QSVA 4OGJA 5LKZA 5IGMA 5C87A 2E3KA 4AKIA 3HMFA 5EVAA 3GG3A 4QBMA 4HXKA 4Z1SA 4NYWA 4UYDA 5CRZA 3P5OA 4TT6A 5LVQA 2F6JA 4ALHA 3D7CA 3QZVA 4TU4A 4NS5A 5E9MA 5FG4A 2YW5A 4UIVA 5AD3A 5I83A 3S92A 2R0VA 5CP5A 5CQ5A 4QSRA 2FSAA 2RNYA 5IGNA 3MULA 3ONIA 4YYMA 5FBXA 4QC3A 4HXRA 4HXOA 5D25A 4PS5A 4YAXA 4NQNA 4QEWA 5D3RA 5C8GA 4NYVA 2I7KA 4A9MA 4AKNA 4O7EA 1ZKRA 2R0YA 5D3SA 3U5KA 2YELA 3NXBA 5FFYA 5EA1A 4UYEA 4NR9A 2OO1A 4NXJA 5ETDA 2RS9B 4LZSA 4Q0NA 4TZ2A 4QYDA 5LKXA 5CU8A 4IR6A 5HEMA 4BW2A 5EM3A 4UIUA 5F25A 5I89A 4UIWA 4MEOA 5JI8A 5FH8A 5EWCA 1F68A 5FH6A 4QSQA 4TT4A 4YYIA 5CQ3A 5EV9A 3AADA 3G0LA 2G4AA 3MUKA 2YYNA 4QEUA 5F5ZA 4E96A 4LZ2A 4BJXA 5AMEA 3LQHA 4BHWA 3MXFA 2DATA 5EPSA 4TYLA 3UV5A 5E7DA 3DWYA 5FE6A 4YYKA 3P1DA 5FE7A 5E9YA 5CQAA 5FG5A 1N72A 5I7YA 4HBYA 4O75A
chains in the Genus database with same CATH topology
5I29A 4YBSA 4FLPA 5IBNA 5A5QA 5K29A 3K2JA 4N4FA 4CURA 5ENJA 5DW1A 2RO1A 5DX4A 4NR8A 5D3NA 5I7XA 5DFBA 4MEQA 5E9LA 5EWHA 5HFQA 3UVXA 5ACYA 3G0JA 4Z6IA 3LQJA 5D26A 5HLSA 3MQMA 5FE1A 3O36A 5TCMA 4J0RA 4YATA 4LDFA 4MR3A 4IOQA 5IGKA 3UV4A 2WP1A 5LJ1A 5EPRA 5CPEA 3IU5A 5CUEA 5F60A 5F61A 4OUFA 4WHWA 3RCWA 4XUBA 4KV1A 5E9KA 4UIYA 5HQ6A 4QR4A 4ZQLA 5LUUA 4UITA 5FE0A 4NYXA 5CGPA 5FB1A 4QZSA 4MR4A 4PCEA 3Q2FA 2L85A 5F3AA 4YYDA 4Z6HA 2E7OA 5I1QA 5A5NA 4QY4A 5CS8A 5DW2A 2DWWA 1WUGA 5D0CA 5L8TA 4MEPA 4CUTA 5FG6A 4QB3A 4F3IA 2D9EA 5A5OA 1EQFA 4XYAA 2N9GA 2L84A 2KTBB 4BW4A 3TLPA 4LYIA 5BT4A 4QSWA 4QYLA 5E3GA 3U5NA 2F6NA 4QEVA 5DYXA 4YK0A 3O33A 5L8UA 2YQDA 4YBMA 3QZSA 4QC1A 4CLBA 5CUDA 3UVWA 4O71A 5D3LA 2DVRA 3Q2EA 5ENEA 5CFWA 3LJWA 5A7CA 5E9IA 3HMEA 5AD2A 2RNWA 4YADA 4TZ8A 3P1CA 4QR3A 3MB3A 5DKDA 5EK9A 4UYHA 3S91A 5BT5A 4GPJA 4N4HA 4XY9A 3FKMX 4A9OA 5II2A 3U5OA 4J3IA 3I3JA 5E73A 5H1TA 4IOOA 5KO4A 5L99A 5EPBA 5I88A 5LVRA 3IU6A 5A5SA 5D3PA 5A85A 4A9LA 4Q0OA 4YBTA 5L96A 3U5LA 5DLZA 5DKHA 5D3HA 5COIA 2YEMA 4QSPA 2D82A 5E9VA 4C66A 4QNSA 5CUGA 5HENA 5A5RA 5HRVA 2R10A 3MB4A 4CUQA 1JSPB 5A82A 5IG6A 4A9KA 4A9HA 2RNXA 5E3DA 2DVSA 4J0SA 4QUUA 4MENA 4NUDA 3HMHA 4YABA 5CRMA 5EU1A 5EICA 4RVRA 5CQ4A 5FE3A 4YYGA 1ZS5A 4O7CA 5CQ7A 5HFRA 4KCXA 5L98A 5HCLA 3UVDA 5H1VA 5ENBA 3JVMA 5TB6A 4NRAA 5I86A 3ZYUA 3U5JA 3QZTA 3O35A 4TS8A 2LSPB 4HXSA 5DYAA 5AMFA 5KHMA 5I40A 5FB0A 4YC9A 4QR5A 4O72A 4PTBA 2L5EA 2OSSA 5HM0A 4LZRA 5LJ2A 5DYCA 5ENHA 5J0DA 5EP7A 3LQIA 5A83A 4Z1QA 4O7AA 5LJ0A 5C4QA 5C7NA 3O37A 5H85A 1JM4B 4Z93A 5EQ1A 4MR6A 4N4GA 5FH7A 5ENGA 1E6IA 4KV4A 5BT3A 3P1EA 5DYUA 2RI7A 4TU6A 4O77A 3UVYA 4CUPA 4NUEA 5HRWA 2DVVA 5I80A 2I8NA 4IR3A 3SVGA 5F1LA 2YDWA 5KTUA 2R0SA 5IIDA 5KU3A 3JVKA 4DONA 4C67A 4CL9A 5HQ5A 2MJVB 5A5PA 4LC2A 4A9NA 4YY4A 4Y03A 4QSTA 2NXBA 3LXJA 5D3TA 5L97A 4LYWA 4HXPA 4YYHA 2OUOA 5FE8A 5DFCA 4O74A 4WHUA 4LYSA 5ENIA 4PCIA 5FFWA 5FE2A 4CUUA 5CUCA 4A9JA 4XY8A 4O7FA 5F62A 4QSUA 4UYFB 4XUAA 5C89A 5CY9A 4IR4A 5EWDA 5LKUA 4HXMA 4UYFA 4UIZA 5FDZA 4YH4A 3JVJA 4CFKA 5A81A 5F36A 5CQ6A 5ENFA 4HXLA 4N4IA 2DKWA 4QSSA 3SVHA 4BW3A 4PY6A 5F2PA 4NRCA 5EWVA 5HRXA 5G4SA 4LRGA 4NR6A 5EWWA 4PKLA 2H60A 5CQ8A 5EISA 4YH3A 4BW1A 5DLXA 5FE5A 3AQAA 4YYJA 5II1A 4HBVA 5FE9A 5CUBA 5DKCA 4CUSA 5CZGA 4ZW1A 5CUAA 5EGUA 5IGLA 5ENCA 4QSXA 5FE4A 2GRCA 3JVLA 4IORA 4TQNA 5HQ7A 4A9EA 4ALGA 4O76A 5C85A 4MR5A 3UV2A 4NR7A 5H1UA 4X2IA 5E74A 5DFDA 4YY6A 4ZC9A 4NUCA 2WP2A 5HELA 5D3JA 4A9IA 5CTLA 4TTEA 4NR4A 2RFJA 4UIXA 4NRBA 5F1HA 4J1PA 3UW9A 4A9FA 5KTXA 3P1FA 5CQTA 3O34A 4O7BA 4HBWA 2YEKA 1X0JA 5D7XA 4IR5A 5EI4A 4YYNA 2DVQA 5LKTA 3U5MA 5KTWA 5E0RA 5HJCA 3SVFA 4CFLA 5D24A 4UYGA 5DY7A 5ETBA 4TT2A 4O70A 4HBXA 3U5PA 4LR6A 1WUMA 5G4RA 4NR5A 5JWMA 4N3WA 4QUTA 3DAIA 5DBMA 4WIVA 4NQMA 4OGIA 2E7NA 5F63A 5FFVA 4O78A 4HXNA 4QSVA 4OGJA 5LKZA 5IGMA 5C87A 2E3KA 3HMFA 5EVAA 3GG3A 4QBMA 4HXKA 4Z1SA 4NYWA 4UYDA 5CRZA 3P5OA 4TT6A 5LVQA 2F6JA 4ALHA 3D7CA 3QZVA 4TU4A 4NS5A 5E9MA 5FG4A 2YW5A 4UIVA 5AD3A 5I83A 3S92A 2R0VA 5CP5A 5CQ5A 4QSRA 2FSAA 2RNYA 5IGNA 3MULA 3ONIA 4YYMA 5FBXA 4QC3A 4HXRA 4HXOA 5D25A 4PS5A 4YAXA 4NQNA 4QEWA 5D3RA 5C8GA 4NYVA 2I7KA 4A9MA 4AKNA 4O7EA 2R0YA 5D3SA 3U5KA 2YELA 3NXBA 5FFYA 5EA1A 4UYEA 4NR9A 2OO1A 4NXJA 5ETDA 2RS9B 4LZSA 4Q0NA 4TZ2A 4QYDA 5LKXA 5CU8A 4IR6A 5HEMA 4BW2A 5EM3A 4UIUA 5F25A 5I89A 4UIWA 4MEOA 5JI8A 5FH8A 5EWCA 1F68A 5FH6A 4QSQA 4TT4A 4YYIA 5CQ3A 5EV9A 3AADA 3G0LA 2G4AA 3MUKA 2YYNA 4QEUA 5F5ZA 4E96A 4LZ2A 4BJXA 5AMEA 3LQHA 4BHWA 3MXFA 2DATA 5EPSA 4TYLA 3UV5A 5E7DA 3DWYA 5FE6A 4YYKA 3P1DA 5FE7A 5E9YA 5CQAA 5FG5A 1N72A 5I7YA 4HBYA 4O75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I29 A;  4YBS A;  4FLP A;  5IBN A;  5A5Q A;  5K29 A;  3K2J A;  4N4F A;  4CUR A;  5ENJ A;  5DW1 A;  2RO1 A;  5DX4 A;  4NR8 A;  5D3N A;  5I7X A;  5DFB A;  4MEQ A;  5E9L A;  5EWH A;  5HFQ A;  3UVX A;  5ACY A;  3G0J A;  4Z6I A;  3LQJ A;  5D26 A;  5HLS A;  3MQM A;  5FE1 A;  3O36 A;  5TCM A;  4J0R A;  4YAT A;  4LDF A;  4MR3 A;  4IOQ A;  5IGK A;  3UV4 A;  2WP1 A;  5LJ1 A;  5EPR A;  5CPE A;  3IU5 A;  5CUE A;  5F60 A;  5F61 A;  4OUF A;  4WHW A;  3RCW A;  4XUB A;  4KV1 A;  5E9K A;  4UIY A;  5HQ6 A;  4QR4 A;  4ZQL A;  5LUU A;  4UIT A;  5FE0 A;  4NYX A;  5CGP A;  5FB1 A;  4QZS A;  4MR4 A;  4PCE A;  3Q2F A;  2L85 A;  5F3A A;  4YYD A;  4Z6H A;  2E7O A;  5I1Q A;  5A5N A;  4QY4 A;  5CS8 A;  5DW2 A;  2DWW A;  1WUG A;  5D0C A;  5L8T A;  4MEP A;  4CUT A;  5FG6 A;  4QB3 A;  4F3I A;  2D9E A;  5A5O A;  1EQF A;  4XYA A;  2N9G A;  2L84 A;  2KTB B;  4BW4 A;  3TLP A;  4LYI A;  5BT4 A;  4QSW A;  4QYL A;  5E3G A;  3U5N A;  2F6N A;  4QEV A;  5DYX A;  4YK0 A;  3O33 A;  5L8U A;  2YQD A;  4YBM A;  3QZS A;  4QC1 A;  4CLB A;  5CUD A;  3UVW A;  4O71 A;  5D3L A;  2DVR A;  3Q2E A;  5ENE A;  5CFW A;  3LJW A;  5A7C A;  5E9I A;  3HME A;  5AD2 A;  2RNW A;  4YAD A;  4TZ8 A;  3P1C A;  4QR3 A;  3MB3 A;  5DKD A;  5EK9 A;  4UYH A;  3S91 A;  5BT5 A;  4GPJ A;  4N4H A;  4XY9 A;  3FKM X;  4A9O A;  5II2 A;  3U5O A;  4J3I A;  3I3J A;  5E73 A;  5H1T A;  4IOO A;  5KO4 A;  5L99 A;  5EPB A;  5I88 A;  5LVR A;  3IU6 A;  5A5S A;  5D3P A;  5A85 A;  4A9L A;  4Q0O A;  4YBT A;  5L96 A;  3U5L A;  5DLZ A;  5DKH A;  5D3H A;  5COI A;  2YEM A;  4QSP A;  2D82 A;  5E9V A;  4C66 A;  4QNS A;  5CUG A;  5HEN A;  5A5R A;  5HRV A;  2R10 A;  3MB4 A;  4CUQ A;  1JSP B;  5A82 A;  5IG6 A;  4A9K A;  4A9H A;  2RNX A;  5E3D A;  2DVS A;  4J0S A;  4QUU A;  4MEN A;  4NUD A;  3HMH A;  4YAB A;  5CRM A;  5EU1 A;  5EIC A;  4RVR A;  5CQ4 A;  5FE3 A;  4YYG A;  1ZS5 A;  4O7C A;  5CQ7 A;  5HFR A;  4KCX A;  5L98 A;  5HCL A;  3UVD A;  5H1V A;  5ENB A;  3JVM A;  5TB6 A;  4NRA A;  5I86 A;  3ZYU A;  3U5J A;  3QZT A;  3O35 A;  4TS8 A;  2LSP B;  4HXS A;  5DYA A;  5AMF A;  5KHM A;  5I40 A;  5FB0 A;  4YC9 A;  4QR5 A;  4O72 A;  4PTB A;  2L5E A;  2OSS A;  5HM0 A;  4LZR A;  5LJ2 A;  5DYC A;  5ENH A;  5J0D A;  5EP7 A;  3LQI A;  5A83 A;  4Z1Q A;  4O7A A;  5LJ0 A;  5C4Q A;  5C7N A;  3O37 A;  5H85 A;  1JM4 B;  4Z93 A;  5EQ1 A;  4MR6 A;  4N4G A;  5FH7 A;  5ENG A;  1E6I A;  4KV4 A;  5BT3 A;  3P1E A;  5DYU A;  2RI7 A;  4TU6 A;  4O77 A;  3UVY A;  4CUP A;  4NUE A;  5HRW A;  2DVV A;  5I80 A;  2I8N A;  4IR3 A;  3SVG A;  5F1L A;  2YDW A;  5KTU A;  2R0S A;  5IID A;  5KU3 A;  3JVK A;  4DON A;  4C67 A;  4CL9 A;  5HQ5 A;  2MJV B;  5A5P A;  4LC2 A;  4A9N A;  4YY4 A;  4Y03 A;  4QST A;  2NXB A;  3LXJ A;  5D3T A;  5L97 A;  4LYW A;  4HXP A;  4YYH A;  2OUO A;  5FE8 A;  5DFC A;  4O74 A;  4WHU A;  4LYS A;  5ENI A;  4PCI A;  5FFW A;  5FE2 A;  4CUU A;  5CUC A;  4A9J A;  4XY8 A;  4O7F A;  5F62 A;  4QSU A;  4UYF B;  4XUA A;  5C89 A;  5CY9 A;  4IR4 A;  5EWD A;  5LKU A;  4HXM A;  4UYF A;  4UIZ A;  5FDZ A;  4YH4 A;  3JVJ A;  4CFK A;  5A81 A;  5F36 A;  5CQ6 A;  5ENF A;  4HXL A;  4N4I A;  2DKW A;  4QSS A;  3SVH A;  4BW3 A;  4PY6 A;  5F2P A;  4NRC A;  5EWV A;  5HRX A;  5G4S A;  4LRG A;  4NR6 A;  5EWW A;  4PKL A;  2H60 A;  5CQ8 A;  5EIS A;  4YH3 A;  4BW1 A;  5DLX A;  5FE5 A;  3AQA A;  4YYJ A;  5II1 A;  4HBV A;  5FE9 A;  5CUB A;  5DKC A;  4CUS A;  5CZG A;  4ZW1 A;  5CUA A;  5EGU A;  5IGL A;  5ENC A;  4QSX A;  5FE4 A;  2GRC A;  3JVL A;  4IOR A;  4TQN A;  5HQ7 A;  4A9E A;  4ALG A;  4O76 A;  5C85 A;  4MR5 A;  3UV2 A;  4NR7 A;  5H1U A;  4X2I A;  5E74 A;  5DFD A;  4YY6 A;  4ZC9 A;  4NUC A;  2WP2 A;  5HEL A;  5D3J A;  4A9I A;  5CTL A;  4TTE A;  4NR4 A;  2RFJ A;  4UIX A;  4NRB A;  5F1H A;  4J1P A;  3UW9 A;  4A9F A;  5KTX A;  3P1F A;  5CQT A;  3O34 A;  4O7B A;  4HBW A;  2YEK A;  1X0J A;  5D7X A;  4IR5 A;  5EI4 A;  4YYN A;  2DVQ A;  5LKT A;  3U5M A;  5KTW A;  5E0R A;  5HJC A;  3SVF A;  4CFL A;  5D24 A;  4UYG A;  5DY7 A;  5ETB A;  4TT2 A;  4O70 A;  4HBX A;  3U5P A;  4LR6 A;  1WUM A;  5G4R A;  4NR5 A;  5JWM A;  4N3W A;  4QUT A;  3DAI A;  5DBM A;  4WIV A;  4NQM A;  4OGI A;  2E7N A;  5F63 A;  5FFV A;  4O78 A;  4HXN A;  4QSV A;  4OGJ A;  5LKZ A;  5IGM A;  5C87 A;  2E3K A;  3HMF A;  5EVA A;  3GG3 A;  4QBM A;  4HXK A;  4Z1S A;  4NYW A;  4UYD A;  5CRZ A;  3P5O A;  4TT6 A;  5LVQ A;  2F6J A;  4ALH A;  3D7C A;  3QZV A;  4TU4 A;  4NS5 A;  5E9M A;  5FG4 A;  2YW5 A;  4UIV A;  5AD3 A;  5I83 A;  3S92 A;  2R0V A;  5CP5 A;  5CQ5 A;  4QSR A;  2FSA A;  2RNY A;  5IGN A;  3MUL A;  3ONI A;  4YYM A;  5FBX A;  4QC3 A;  4HXR A;  4HXO A;  5D25 A;  4PS5 A;  4YAX A;  4NQN A;  4QEW A;  5D3R A;  5C8G A;  4NYV A;  2I7K A;  4A9M A;  4AKN A;  4O7E A;  2R0Y A;  5D3S A;  3U5K A;  2YEL A;  3NXB A;  5FFY A;  5EA1 A;  4UYE A;  4NR9 A;  2OO1 A;  4NXJ A;  5ETD A;  2RS9 B;  4LZS A;  4Q0N A;  4TZ2 A;  4QYD A;  5LKX A;  5CU8 A;  4IR6 A;  5HEM A;  4BW2 A;  5EM3 A;  4UIU A;  5F25 A;  5I89 A;  4UIW A;  4MEO A;  5JI8 A;  5FH8 A;  5EWC A;  1F68 A;  5FH6 A;  4QSQ A;  4TT4 A;  4YYI A;  5CQ3 A;  5EV9 A;  3AAD A;  3G0L A;  2G4A A;  3MUK A;  2YYN A;  4QEU A;  5F5Z A;  4E96 A;  4LZ2 A;  4BJX A;  5AME A;  3LQH A;  4BHW A;  3MXF A;  2DAT A;  5EPS A;  4TYL A;  3UV5 A;  5E7D A;  3DWY A;  5FE6 A;  4YYK A;  3P1D A;  5FE7 A;  5E9Y A;  5CQA A;  5FG5 A;  1N72 A;  5I7Y A;  4HBY A;  4O75 A; 
#chains in the Genus database with same CATH topology
 5I29 A;  4YBS A;  4FLP A;  5IBN A;  5A5Q A;  5K29 A;  3K2J A;  4N4F A;  4CUR A;  5ENJ A;  5DW1 A;  2RO1 A;  5DX4 A;  4NR8 A;  5D3N A;  5I7X A;  5DFB A;  4MEQ A;  5E9L A;  5EWH A;  5HFQ A;  3UVX A;  5ACY A;  3G0J A;  4Z6I A;  3LQJ A;  5D26 A;  5HLS A;  3MQM A;  5FE1 A;  3O36 A;  5TCM A;  4J0R A;  4YAT A;  4LDF A;  4MR3 A;  4IOQ A;  5IGK A;  3UV4 A;  2WP1 A;  5LJ1 A;  5EPR A;  5CPE A;  3IU5 A;  5CUE A;  5F60 A;  5F61 A;  4OUF A;  4WHW A;  3RCW A;  4XUB A;  4KV1 A;  5E9K A;  4UIY A;  5HQ6 A;  4QR4 A;  4ZQL A;  5LUU A;  4UIT A;  5FE0 A;  4NYX A;  5CGP A;  5FB1 A;  4QZS A;  4MR4 A;  4PCE A;  3Q2F A;  2L85 A;  5F3A A;  4YYD A;  4Z6H A;  2E7O A;  5I1Q A;  5A5N A;  4QY4 A;  5CS8 A;  5DW2 A;  3D1B A;  2DWW A;  1WUG A;  5D0C A;  5L8T A;  4MEP A;  4CUT A;  5FG6 A;  4AKH A;  4QB3 A;  4F3I A;  2D9E A;  5A5O A;  1EQF A;  4XYA A;  2N9G A;  2L84 A;  2KTB B;  4BW4 A;  3TLP A;  4LYI A;  5BT4 A;  4QSW A;  4QYL A;  5E3G A;  3U5N A;  2F6N A;  4QEV A;  5DYX A;  4YK0 A;  3ERR A;  3O33 A;  5L8U A;  2YQD A;  4YBM A;  3QZS A;  4QC1 A;  4CLB A;  5CUD A;  3UVW A;  4O71 A;  5D3L A;  2DVR A;  3Q2E A;  5ENE A;  5CFW A;  3LJW A;  5A7C A;  5E9I A;  3HME A;  5AD2 A;  2RNW A;  4YAD A;  4TZ8 A;  3P1C A;  4QR3 A;  3MB3 A;  5DKD A;  5EK9 A;  4UYH A;  3S91 A;  5BT5 A;  4GPJ A;  4N4H A;  4XY9 A;  3FKM X;  4A9O A;  5II2 A;  3U5O A;  4J3I A;  3I3J A;  5E73 A;  5H1T A;  4IOO A;  5KO4 A;  5L99 A;  3VKH A;  5EPB A;  5I88 A;  5LVR A;  3IU6 A;  5A5S A;  5D3P A;  5A85 A;  4A9L A;  4Q0O A;  4YBT A;  5L96 A;  3U5L A;  5DLZ A;  5DKH A;  5D3H A;  5COI A;  2YEM A;  4QSP A;  2D82 A;  5E9V A;  4C66 A;  4QNS A;  5CUG A;  5HEN A;  5A5R A;  5HRV A;  2R10 A;  3MB4 A;  3D1D A;  4CUQ A;  1JSP B;  5A82 A;  5IG6 A;  4A9K A;  4A9H A;  2RNX A;  5E3D A;  2DVS A;  4J0S A;  4QUU A;  4MEN A;  4NUD A;  3HMH A;  4YAB A;  5CRM A;  5EU1 A;  5EIC A;  4RVR A;  5CQ4 A;  5FE3 A;  4YYG A;  1ZS5 A;  4O7C A;  5CQ7 A;  5HFR A;  4KCX A;  5L98 A;  5HCL A;  3UVD A;  5H1V A;  5ENB A;  3JVM A;  5TB6 A;  4NRA A;  5I86 A;  3ZYU A;  3U5J A;  3QZT A;  3O35 A;  4TS8 A;  2LSP B;  4HXS A;  5DYA A;  5AMF A;  5KHM A;  5I40 A;  5FB0 A;  4YC9 A;  4QR5 A;  4O72 A;  4PTB A;  1PUO A;  2L5E A;  2OSS A;  5HM0 A;  4LZR A;  5LJ2 A;  5DYC A;  5ENH A;  5J0D A;  5EP7 A;  4AKG A;  3LQI A;  5A83 A;  4Z1Q A;  4O7A A;  5LJ0 A;  5C4Q A;  5C7N A;  3O37 A;  5H85 A;  1JM4 B;  4Z93 A;  5EQ1 A;  4MR6 A;  4N4G A;  5FH7 A;  5ENG A;  1E6I A;  4KV4 A;  5BT3 A;  3P1E A;  5DYU A;  2RI7 A;  4TU6 A;  4O77 A;  3UVY A;  4CUP A;  4NUE A;  5HRW A;  2DVV A;  5I80 A;  2I8N A;  4IR3 A;  3SVG A;  5F1L A;  2YDW A;  5KTU A;  2R0S A;  5IID A;  5KU3 A;  3JVK A;  4DON A;  4C67 A;  4CL9 A;  5HQ5 A;  2MJV B;  5A5P A;  4LC2 A;  4A9N A;  4YY4 A;  4Y03 A;  4QST A;  2NXB A;  3LXJ A;  5D3T A;  5L97 A;  4LYW A;  4HXP A;  4YYH A;  2OUO A;  5FE8 A;  5DFC A;  4O74 A;  4WHU A;  4LYS A;  5ENI A;  4PCI A;  5FFW A;  5FE2 A;  4CUU A;  5CUC A;  4A9J A;  4XY8 A;  4O7F A;  5F62 A;  4QSU A;  4UYF B;  4XUA A;  5C89 A;  5CY9 A;  4IR4 A;  5EWD A;  5LKU A;  4HXM A;  4UYF A;  4UIZ A;  5FDZ A;  3VKG A;  4YH4 A;  3JVJ A;  4CFK A;  5A81 A;  5F36 A;  5CQ6 A;  5ENF A;  4HXL A;  4N4I A;  2DKW A;  4QSS A;  3SVH A;  4BW3 A;  4PY6 A;  5F2P A;  4NRC A;  5EWV A;  5HRX A;  5G4S A;  4LRG A;  4NR6 A;  5EWW A;  4PKL A;  2H60 A;  5CQ8 A;  5EIS A;  4YH3 A;  4BW1 A;  5DLX A;  5FE5 A;  3AQA A;  4YYJ A;  5II1 A;  4HBV A;  5FE9 A;  5CUB A;  5DKC A;  4CUS A;  5CZG A;  4ZW1 A;  5CUA A;  5EGU A;  5IGL A;  5ENC A;  4QSX A;  5FE4 A;  2GRC A;  3JVL A;  4IOR A;  4TQN A;  5HQ7 A;  4A9E A;  4ALG A;  4O76 A;  5C85 A;  4MR5 A;  3UV2 A;  4NR7 A;  5H1U A;  4X2I A;  5E74 A;  5DFD A;  4YY6 A;  4ZC9 A;  4NUC A;  2WP2 A;  5HEL A;  5D3J A;  4A9I A;  5CTL A;  4TTE A;  4NR4 A;  2RFJ A;  4UIX A;  4NRB A;  5F1H A;  4J1P A;  3UW9 A;  4A9F A;  5KTX A;  3P1F A;  5CQT A;  3O34 A;  4O7B A;  4HBW A;  2YEK A;  1X0J A;  5D7X A;  4IR5 A;  5EI4 A;  4YYN A;  2DVQ A;  5LKT A;  3U5M A;  5KTW A;  5E0R A;  5HJC A;  4AI6 A;  3SVF A;  4CFL A;  5D24 A;  4UYG A;  5DY7 A;  5ETB A;  4TT2 A;  4O70 A;  4HBX A;  3U5P A;  2EJN A;  4LR6 A;  1WUM A;  5G4R A;  4NR5 A;  5JWM A;  4N3W A;  4QUT A;  3DAI A;  5DBM A;  4WIV A;  4NQM A;  4OGI A;  2E7N A;  5F63 A;  5FFV A;  4O78 A;  4HXN A;  4QSV A;  4OGJ A;  5LKZ A;  5IGM A;  5C87 A;  2E3K A;  4AKI A;  3HMF A;  5EVA A;  3GG3 A;  4QBM A;  4HXK A;  4Z1S A;  4NYW A;  4UYD A;  5CRZ A;  3P5O A;  4TT6 A;  5LVQ A;  2F6J A;  4ALH A;  3D7C A;  3QZV A;  4TU4 A;  4NS5 A;  5E9M A;  5FG4 A;  2YW5 A;  4UIV A;  5AD3 A;  5I83 A;  3S92 A;  2R0V A;  5CP5 A;  5CQ5 A;  4QSR A;  2FSA A;  2RNY A;  5IGN A;  3MUL A;  3ONI A;  4YYM A;  5FBX A;  4QC3 A;  4HXR A;  4HXO A;  5D25 A;  4PS5 A;  4YAX A;  4NQN A;  4QEW A;  5D3R A;  5C8G A;  4NYV A;  2I7K A;  4A9M A;  4AKN A;  4O7E A;  1ZKR A;  2R0Y A;  5D3S A;  3U5K A;  2YEL A;  3NXB A;  5FFY A;  5EA1 A;  4UYE A;  4NR9 A;  2OO1 A;  4NXJ A;  5ETD A;  2RS9 B;  4LZS A;  4Q0N A;  4TZ2 A;  4QYD A;  5LKX A;  5CU8 A;  4IR6 A;  5HEM A;  4BW2 A;  5EM3 A;  4UIU A;  5F25 A;  5I89 A;  4UIW A;  4MEO A;  5JI8 A;  5FH8 A;  5EWC A;  1F68 A;  5FH6 A;  4QSQ A;  4TT4 A;  4YYI A;  5CQ3 A;  5EV9 A;  3AAD A;  3G0L A;  2G4A A;  3MUK A;  2YYN A;  4QEU A;  5F5Z A;  4E96 A;  4LZ2 A;  4BJX A;  5AME A;  3LQH A;  4BHW A;  3MXF A;  2DAT A;  5EPS A;  4TYL A;  3UV5 A;  5E7D A;  3DWY A;  5FE6 A;  4YYK A;  3P1D A;  5FE7 A;  5E9Y A;  5CQA A;  5FG5 A;  1N72 A;  5I7Y A;  4HBY A;  4O75 A; 
#chains in the Genus database with same CATH homology
 5I29 A;  4YBS A;  4FLP A;  5IBN A;  5A5Q A;  5K29 A;  3K2J A;  4N4F A;  4CUR A;  5ENJ A;  5DW1 A;  2RO1 A;  5DX4 A;  4NR8 A;  5D3N A;  5I7X A;  5DFB A;  4MEQ A;  5E9L A;  5EWH A;  5HFQ A;  3UVX A;  5ACY A;  3G0J A;  4Z6I A;  3LQJ A;  5D26 A;  5HLS A;  3MQM A;  5FE1 A;  3O36 A;  5TCM A;  4J0R A;  4YAT A;  4LDF A;  4MR3 A;  4IOQ A;  5IGK A;  3UV4 A;  2WP1 A;  5LJ1 A;  5EPR A;  5CPE A;  3IU5 A;  5CUE A;  5F60 A;  5F61 A;  4OUF A;  4WHW A;  3RCW A;  4XUB A;  4KV1 A;  5E9K A;  4UIY A;  5HQ6 A;  4QR4 A;  4ZQL A;  5LUU A;  4UIT A;  5FE0 A;  4NYX A;  5CGP A;  5FB1 A;  4QZS A;  4MR4 A;  4PCE A;  3Q2F A;  2L85 A;  5F3A A;  4YYD A;  4Z6H A;  2E7O A;  5I1Q A;  5A5N A;  4QY4 A;  5CS8 A;  5DW2 A;  2DWW A;  1WUG A;  5D0C A;  5L8T A;  4MEP A;  4CUT A;  5FG6 A;  4QB3 A;  4F3I A;  2D9E A;  5A5O A;  1EQF A;  4XYA A;  2N9G A;  2L84 A;  2KTB B;  4BW4 A;  3TLP A;  4LYI A;  5BT4 A;  4QSW A;  4QYL A;  5E3G A;  3U5N A;  2F6N A;  4QEV A;  5DYX A;  4YK0 A;  3O33 A;  5L8U A;  2YQD A;  4YBM A;  3QZS A;  4QC1 A;  4CLB A;  5CUD A;  3UVW A;  4O71 A;  5D3L A;  2DVR A;  3Q2E A;  5ENE A;  5CFW A;  3LJW A;  5A7C A;  5E9I A;  3HME A;  5AD2 A;  2RNW A;  4YAD A;  4TZ8 A;  3P1C A;  4QR3 A;  3MB3 A;  5DKD A;  5EK9 A;  4UYH A;  3S91 A;  5BT5 A;  4GPJ A;  4N4H A;  4XY9 A;  3FKM X;  4A9O A;  5II2 A;  3U5O A;  4J3I A;  3I3J A;  5E73 A;  5H1T A;  4IOO A;  5KO4 A;  5L99 A;  5EPB A;  5I88 A;  5LVR A;  3IU6 A;  5A5S A;  5D3P A;  5A85 A;  4A9L A;  4Q0O A;  4YBT A;  5L96 A;  3U5L A;  5DLZ A;  5DKH A;  5D3H A;  5COI A;  2YEM A;  4QSP A;  2D82 A;  5E9V A;  4C66 A;  4QNS A;  5CUG A;  5HEN A;  5A5R A;  5HRV A;  2R10 A;  3MB4 A;  4CUQ A;  1JSP B;  5A82 A;  5IG6 A;  4A9K A;  4A9H A;  2RNX A;  5E3D A;  2DVS A;  4J0S A;  4QUU A;  4MEN A;  4NUD A;  3HMH A;  4YAB A;  5CRM A;  5EU1 A;  5EIC A;  4RVR A;  5CQ4 A;  5FE3 A;  4YYG A;  1ZS5 A;  4O7C A;  5CQ7 A;  5HFR A;  4KCX A;  5L98 A;  5HCL A;  3UVD A;  5H1V A;  5ENB A;  3JVM A;  5TB6 A;  4NRA A;  5I86 A;  3ZYU A;  3U5J A;  3QZT A;  3O35 A;  4TS8 A;  2LSP B;  4HXS A;  5DYA A;  5AMF A;  5KHM A;  5I40 A;  5FB0 A;  4YC9 A;  4QR5 A;  4O72 A;  4PTB A;  2L5E A;  2OSS A;  5HM0 A;  4LZR A;  5LJ2 A;  5DYC A;  5ENH A;  5J0D A;  5EP7 A;  3LQI A;  5A83 A;  4Z1Q A;  4O7A A;  5LJ0 A;  5C4Q A;  5C7N A;  3O37 A;  5H85 A;  1JM4 B;  4Z93 A;  5EQ1 A;  4MR6 A;  4N4G A;  5FH7 A;  5ENG A;  1E6I A;  4KV4 A;  5BT3 A;  3P1E A;  5DYU A;  2RI7 A;  4TU6 A;  4O77 A;  3UVY A;  4CUP A;  4NUE A;  5HRW A;  2DVV A;  5I80 A;  2I8N A;  4IR3 A;  3SVG A;  5F1L A;  2YDW A;  5KTU A;  2R0S A;  5IID A;  5KU3 A;  3JVK A;  4DON A;  4C67 A;  4CL9 A;  5HQ5 A;  2MJV B;  5A5P A;  4LC2 A;  4A9N A;  4YY4 A;  4Y03 A;  4QST A;  2NXB A;  3LXJ A;  5D3T A;  5L97 A;  4LYW A;  4HXP A;  4YYH A;  2OUO A;  5FE8 A;  5DFC A;  4O74 A;  4WHU A;  4LYS A;  5ENI A;  4PCI A;  5FFW A;  5FE2 A;  4CUU A;  5CUC A;  4A9J A;  4XY8 A;  4O7F A;  5F62 A;  4QSU A;  4UYF B;  4XUA A;  5C89 A;  5CY9 A;  4IR4 A;  5EWD A;  5LKU A;  4HXM A;  4UYF A;  4UIZ A;  5FDZ A;  4YH4 A;  3JVJ A;  4CFK A;  5A81 A;  5F36 A;  5CQ6 A;  5ENF A;  4HXL A;  4N4I A;  2DKW A;  4QSS A;  3SVH A;  4BW3 A;  4PY6 A;  5F2P A;  4NRC A;  5EWV A;  5HRX A;  5G4S A;  4LRG A;  4NR6 A;  5EWW A;  4PKL A;  2H60 A;  5CQ8 A;  5EIS A;  4YH3 A;  4BW1 A;  5DLX A;  5FE5 A;  3AQA A;  4YYJ A;  5II1 A;  4HBV A;  5FE9 A;  5CUB A;  5DKC A;  4CUS A;  5CZG A;  4ZW1 A;  5CUA A;  5EGU A;  5IGL A;  5ENC A;  4QSX A;  5FE4 A;  2GRC A;  3JVL A;  4IOR A;  4TQN A;  5HQ7 A;  4A9E A;  4ALG A;  4O76 A;  5C85 A;  4MR5 A;  3UV2 A;  4NR7 A;  5H1U A;  4X2I A;  5E74 A;  5DFD A;  4YY6 A;  4ZC9 A;  4NUC A;  2WP2 A;  5HEL A;  5D3J A;  4A9I A;  5CTL A;  4TTE A;  4NR4 A;  2RFJ A;  4UIX A;  4NRB A;  5F1H A;  4J1P A;  3UW9 A;  4A9F A;  5KTX A;  3P1F A;  5CQT A;  3O34 A;  4O7B A;  4HBW A;  2YEK A;  1X0J A;  5D7X A;  4IR5 A;  5EI4 A;  4YYN A;  2DVQ A;  5LKT A;  3U5M A;  5KTW A;  5E0R A;  5HJC A;  3SVF A;  4CFL A;  5D24 A;  4UYG A;  5DY7 A;  5ETB A;  4TT2 A;  4O70 A;  4HBX A;  3U5P A;  4LR6 A;  1WUM A;  5G4R A;  4NR5 A;  5JWM A;  4N3W A;  4QUT A;  3DAI A;  5DBM A;  4WIV A;  4NQM A;  4OGI A;  2E7N A;  5F63 A;  5FFV A;  4O78 A;  4HXN A;  4QSV A;  4OGJ A;  5LKZ A;  5IGM A;  5C87 A;  2E3K A;  3HMF A;  5EVA A;  3GG3 A;  4QBM A;  4HXK A;  4Z1S A;  4NYW A;  4UYD A;  5CRZ A;  3P5O A;  4TT6 A;  5LVQ A;  2F6J A;  4ALH A;  3D7C A;  3QZV A;  4TU4 A;  4NS5 A;  5E9M A;  5FG4 A;  2YW5 A;  4UIV A;  5AD3 A;  5I83 A;  3S92 A;  2R0V A;  5CP5 A;  5CQ5 A;  4QSR A;  2FSA A;  2RNY A;  5IGN A;  3MUL A;  3ONI A;  4YYM A;  5FBX A;  4QC3 A;  4HXR A;  4HXO A;  5D25 A;  4PS5 A;  4YAX A;  4NQN A;  4QEW A;  5D3R A;  5C8G A;  4NYV A;  2I7K A;  4A9M A;  4AKN A;  4O7E A;  2R0Y A;  5D3S A;  3U5K A;  2YEL A;  3NXB A;  5FFY A;  5EA1 A;  4UYE A;  4NR9 A;  2OO1 A;  4NXJ A;  5ETD A;  2RS9 B;  4LZS A;  4Q0N A;  4TZ2 A;  4QYD A;  5LKX A;  5CU8 A;  4IR6 A;  5HEM A;  4BW2 A;  5EM3 A;  4UIU A;  5F25 A;  5I89 A;  4UIW A;  4MEO A;  5JI8 A;  5FH8 A;  5EWC A;  1F68 A;  5FH6 A;  4QSQ A;  4TT4 A;  4YYI A;  5CQ3 A;  5EV9 A;  3AAD A;  3G0L A;  2G4A A;  3MUK A;  2YYN A;  4QEU A;  5F5Z A;  4E96 A;  4LZ2 A;  4BJX A;  5AME A;  3LQH A;  4BHW A;  3MXF A;  2DAT A;  5EPS A;  4TYL A;  3UV5 A;  5E7D A;  3DWY A;  5FE6 A;  4YYK A;  3P1D A;  5FE7 A;  5E9Y A;  5CQA A;  5FG5 A;  1N72 A;  5I7Y A;  4HBY A;  4O75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...