2DVVA

Crystal structure of the second bromodomain of the human brd2 protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
112
structure length
112
Chain Sequence
GSHMEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 2
publication title Crystal structure of the second bromodomain of the human Brd2 protein
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2dvvA00
5F2PA 5FE9A 4YY6A 5IIDA 4NR7A 3TLPA 4QC1A 4MEPA 4QSVA 3O37A 5D25A 5HLSA 5ACYA 4UIXA 4UYGA 3UV4A 3JVJA 4ALHA 5EK9A 4N4IA 5HQ5A 4DONA 4UIWA 1F68A 1WUGA 4TYLA 5CQ5A 5A83A 5FG4A 4XYAA 4NRBA 4QSQA 4QB3A 4QY4A 5E9VA 3Q2EA 5I83A 2LSPB 5ETDA 5IGLA 4CLBA 4A9IA 5CTLA 5HRWA 5DFBA 4ALGA 4HXOA 5CP5A 3MB3A 2E7NA 4Q0OA 5F61A 4A9MA 4TS8A 5F60A 5CRMA 5F62A 5CUCA 5E3GA 3LXJA 4LYWA 5EICA 4Z1SA 4TU6A 4XUAA 5CUDA 5L98A 5D3TA 3G0JA 5IGMA 5D3HA 3U5NA 4GPJA 4CFLA 4HXNA 5D3SA 4KCXA 2D82A 4WIVA 5CPEA 5FH7A 5KU3A 2I8NA 4HBVA 4CUQA 4CUPA 5A85A 5A5NA 2YELA 3DAIA 5CRZA 4O7AA 3HMEA 5CQ4A 5ENCA 5DW2A 4Q0NA 5KO4A 4UITA 4A9FA 4HXMA 5A5SA 4LZ2A 5CQ3A 4Z6HA 5AMEA 5J0DA 5FE6A 5C87A 3U5MA 5LJ0A 5E9LA 4Z93A 3I3JA 4XY8A 4YYJA 4IR6A 5ENGA 5G4RA 5FH6A 4XUBA 3QZSA 3G0LA 4MEQA 5CUBA 4N4FA 5EV9A 2H60A 2RS9B 5ETBA 4A9OA 5L97A 4ZQLA 3O36A 2E7OA 4MR6A 4N4HA 3D7CA 4Z6IA 3UVYA 5KTUA 5HEMA 4QR5A 5I1QA 4RVRA 5DBMA 5TB6A 4NYVA 2L5EA 5CQ8A 5C4QA 4O70A 5HFQA 4AKNA 1N72A 2E3KA 5AMFA 5D3PA 5LVRA 5F5ZA 5HENA 5I29A 3DWYA 4NUDA 4QUTA 5CZGA 5A7CA 4OGIA 5DY7A 4LZRA 2RO1A 4YATA 5FE3A 4LZSA 5A81A 4NR6A 4NRCA 4PKLA 5ENJA 5FBXA 4O76A 5DYAA 4BW2A 4XY9A 5LKXA 5A5PA 4QYLA 4FLPA 4QR4A 5COIA 4QSPA 4YADA 3JVKA 4HXRA 5CGPA 5CQAA 5BT3A 4O71A 1JM4B 5LKZA 3UV5A 3S91A 5DKDA 4YYDA 2R0YA 3MQMA 4WHUA 5CU8A 3LQHA 5EI4A 4LYIA 4NXJA 4NR8A 4HBXA 5E73A 4HXLA 3AADA 4YYHA 5FG5A 2RFJA 2RNWA 3JVMA 4NQMA 5HJCA 5F25A 2WP2A 4O72A 4QC3A 2YEMA 4QNSA 5FG6A 3UVWA 4CUSA 4YYGA 5FE1A 1WUMA 4QSSA 5FDZA 4YYIA 2OSSA 5LJ1A 4UYFA 5E9KA 5AD3A 5EP7A 2DATA 3IU6A 5F1LA 5DKCA 4NYXA 5DFDA 2YEKA 4YY4A 1E6IA 1X0JA 5HRVA 4QSUA 5D26A 5LKUA 2MJVB 4LYSA 5EGUA 4ZC9A 4QSXA 4IORA 5HCLA 4ZW1A 5C85A 5E3DA 5IBNA 4LDFA 5FE5A 5D3RA 2NXBA 4NUCA 4O74A 4UIZA 2RNXA 3HMHA 3NXBA 4Y03A 5L8UA 5F1HA 3JVLA 5FFWA 4TQNA 5HQ7A 3MB4A 3U5KA 5EQ1A 4O77A 2F6JA 4UIUA 5DFCA 5EPRA 5KTWA 3U5LA 3U5PA 5L8TA 4PCIA 4YBTA 2YQDA 5CS8A 5LVQA 4MR5A 2R0VA 4KV1A 4OGJA 2KTBB 4BJXA 2YDWA 4YK0A 4QR3A 4J3IA 5F63A 3O34A 5FB1A 5II1A 5FE8A 3UVXA 4YH3A 3P5OA 5EM3A 5DYXA 5H85A 2FSAA 5BT4A 5EWHA 4NRAA 4QEUA 2RNYA 4J0RA 3QZVA 5DLXA 2DVVA 4MR4A 5D3NA 4OUFA 3MULA 5E74A 1JSPB 4O7BA 5LJ2A 4HBYA 3QZTA 2YW5A 4IOQA 5D3JA 3U5JA 5E9IA 2D9EA 5JWMA 3LQJA 5FFYA 4Z1QA 4HXSA 5CFWA 5I80A 3P1CA 2L84A 3LJWA 5CUEA 4MR3A 4TZ8A 3K2JA 5DKHA 3S92A 5EPSA 3ZYUA 5HRXA 4NR9A 4YBMA 4QEVA 5I40A 4YBSA 5CQ6A 5A5RA 5LKTA 4IOOA 5D24A 4N3WA 4QBMA 4NS5A 3P1FA 4TZ2A 5I89A 4YAXA 5KHMA 5HM0A 4CUTA 3SVHA 5H1UA 5IG6A 1ZS5A 3HMFA 5CQ7A 5CUGA 2GRCA 5DLZA 2DVSA 4YYNA 4KV4A 4YC9A 5II2A 5EISA 4O7FA 4UYFB 4YH4A 4BW1A 5L96A 3UVDA 5DYCA 2YYNA 5FB0A 5IGNA 5DYUA 5HELA 3FKMX 5IGKA 4LRGA 4IR4A 4YYKA 5CUAA 2G4AA 5C8GA 4CURA 1EQFA 5HFRA 3P1DA 2OO1A 4N4GA 3MUKA 4PTBA 4BW4A 5BT5A 2DVQA 4PY6A 3Q2FA 4TU4A 5EU1A 5FE4A 4O75A 5I7YA 4O78A 5EWCA 5A5QA 4QSRA 4UYEA 3SVGA 4TT2A 5AD2A 5ENIA 2OUOA 4LC2A 4UIVA 4NUEA 5F36A 4YYMA 5E7DA 3P1EA 4NQNA 5H1VA 4E96A 3O33A 5ENFA 5A5OA 4UIYA 4NR4A 2DVRA 4C67A 4YABA 4HXPA 2DWWA 4O7CA 5K29A 4NR5A 5TCMA 5JI8A 5ENHA 3AQAA 4A9KA 4TTEA 4J0SA 2F6NA 4UYDA 4CUUA 5D0CA 5FE0A 4F3IA 4HXKA 4A9JA 4PCEA 4UYHA 5ENBA 2DKWA 5EVAA 4QUUA 5EWWA 5A82A 2N9GA 5E0RA 4HBWA 4QEWA 3UV2A 4A9NA 4TT4A 4A9HA 4BHWA 5ENEA 5FE7A 5I7XA 5C89A 4A9EA 4MENA 5H1TA 5D3LA 5D7XA 3U5OA 4PS5A 5KTXA 5CQTA 4QYDA 5FE2A 5EA1A 3LQIA 5I88A 5G4SA 5CY9A 2L85A 4QSWA 5FFVA 5EPBA 5LUUA 3MXFA 4J1PA 3SVFA 5DW1A 3UW9A 5E9YA 5E9MA 3IU5A 5I86A 2I7KA 3ONIA 2WP1A 4LR6A 4TT6A 3GG3A 5F3AA 4CFKA 4IR3A 4O7EA 5EWDA 4QSTA 5EWVA 5HQ6A 4WHWA 4BW3A 5DX4A 3RCWA 4QZSA 4CL9A 5L99A 2R10A 4A9LA 4NYWA 5FH8A 4MEOA 4IR5A 4X2IA 5C7NA 2R0SA 3O35A 4C66A 2RI7A
chains in the Genus database with same CATH superfamily
5F2PA 5FE9A 4YY6A 5IIDA 4NR7A 3TLPA 4QC1A 4MEPA 4QSVA 3O37A 5D25A 5HLSA 5ACYA 4UIXA 4UYGA 3UV4A 3JVJA 4ALHA 5EK9A 4N4IA 5HQ5A 4DONA 4UIWA 1F68A 1WUGA 4TYLA 5CQ5A 5A83A 5FG4A 4XYAA 4NRBA 4QSQA 4QB3A 4QY4A 5E9VA 3Q2EA 5I83A 2LSPB 5ETDA 3VKGA 5IGLA 4CLBA 4A9IA 5CTLA 5HRWA 5DFBA 4ALGA 4HXOA 5CP5A 3MB3A 2E7NA 4Q0OA 5F61A 4A9MA 4TS8A 5F60A 5CRMA 5F62A 5CUCA 5E3GA 3LXJA 4LYWA 5EICA 4Z1SA 4TU6A 4XUAA 5CUDA 5L98A 5D3TA 3G0JA 5IGMA 5D3HA 3U5NA 4GPJA 4CFLA 4HXNA 5D3SA 4KCXA 2D82A 4WIVA 5CPEA 5FH7A 5KU3A 2I8NA 4HBVA 4CUQA 4CUPA 5A85A 5A5NA 2YELA 3DAIA 5CRZA 4O7AA 3HMEA 5CQ4A 5ENCA 5DW2A 4Q0NA 5KO4A 4UITA 4A9FA 4HXMA 5A5SA 4LZ2A 5CQ3A 4Z6HA 2EJNA 5AMEA 5J0DA 5FE6A 5C87A 3U5MA 5LJ0A 5E9LA 4Z93A 3I3JA 4XY8A 4YYJA 4IR6A 5ENGA 5G4RA 5FH6A 4XUBA 3QZSA 3G0LA 4MEQA 5CUBA 4AI6A 4N4FA 5EV9A 2H60A 2RS9B 5ETBA 4A9OA 5L97A 4ZQLA 3O36A 2E7OA 4MR6A 4N4HA 3D7CA 4Z6IA 3UVYA 5KTUA 5HEMA 4QR5A 5I1QA 4RVRA 5DBMA 5TB6A 4NYVA 2L5EA 5CQ8A 5C4QA 4O70A 5HFQA 4AKNA 1N72A 2E3KA 5AMFA 5D3PA 5LVRA 5F5ZA 5HENA 5I29A 3DWYA 4NUDA 4QUTA 5CZGA 5A7CA 4OGIA 5DY7A 4LZRA 2RO1A 4YATA 5FE3A 4LZSA 5A81A 4NR6A 4NRCA 4PKLA 5ENJA 5FBXA 4O76A 5DYAA 4BW2A 4XY9A 5LKXA 5A5PA 4QYLA 4FLPA 4QR4A 5COIA 4QSPA 4YADA 3JVKA 4HXRA 5CGPA 5CQAA 5BT3A 4O71A 1JM4B 5LKZA 3UV5A 3S91A 5DKDA 4YYDA 2R0YA 3MQMA 4WHUA 5CU8A 4AKHA 3LQHA 5EI4A 4LYIA 4NXJA 4NR8A 4HBXA 5E73A 4HXLA 3AADA 4YYHA 5FG5A 2RFJA 2RNWA 3JVMA 4NQMA 5HJCA 5F25A 2WP2A 4O72A 4QC3A 2YEMA 4QNSA 4AKIA 5FG6A 3UVWA 4CUSA 4YYGA 5FE1A 1WUMA 4QSSA 5FDZA 4YYIA 2OSSA 5LJ1A 4UYFA 5E9KA 5AD3A 5EP7A 2DATA 3IU6A 5F1LA 5DKCA 4NYXA 5DFDA 2YEKA 4YY4A 1E6IA 1X0JA 5HRVA 4QSUA 5D26A 5LKUA 2MJVB 4LYSA 5EGUA 4ZC9A 4QSXA 4IORA 5HCLA 4ZW1A 5C85A 5E3DA 5IBNA 4LDFA 5FE5A 5D3RA 2NXBA 4NUCA 4O74A 4UIZA 2RNXA 3HMHA 3NXBA 4Y03A 5L8UA 5F1HA 3JVLA 5FFWA 4TQNA 5HQ7A 3MB4A 3U5KA 5EQ1A 4O77A 2F6JA 4UIUA 5DFCA 5EPRA 5KTWA 3U5LA 3U5PA 5L8TA 4PCIA 4YBTA 2YQDA 5CS8A 5LVQA 4MR5A 2R0VA 4KV1A 4OGJA 2KTBB 4BJXA 2YDWA 4YK0A 4QR3A 4J3IA 5F63A 3O34A 5FB1A 5II1A 5FE8A 3UVXA 4YH3A 3P5OA 5EM3A 5DYXA 5H85A 2FSAA 5BT4A 5EWHA 4AKGA 4NRAA 4QEUA 2RNYA 3ERRA 3QZVA 4J0RA 5DLXA 2DVVA 4MR4A 5D3NA 4OUFA 3MULA 5E74A 1JSPB 4O7BA 5LJ2A 4HBYA 3QZTA 3VKHA 2YW5A 4IOQA 5D3JA 3U5JA 5E9IA 2D9EA 5JWMA 3LQJA 5FFYA 4Z1QA 4HXSA 5CFWA 5I80A 3P1CA 2L84A 3D1DA 3LJWA 5CUEA 4MR3A 4TZ8A 3K2JA 5DKHA 3S92A 5EPSA 3ZYUA 5HRXA 4NR9A 4YBMA 4QEVA 5I40A 4YBSA 5CQ6A 5A5RA 5LKTA 4IOOA 5D24A 4N3WA 4QBMA 4NS5A 3P1FA 4TZ2A 5I89A 4YAXA 5KHMA 5HM0A 4CUTA 3SVHA 5H1UA 1PUOA 5IG6A 1ZS5A 3HMFA 5CQ7A 5CUGA 2GRCA 5DLZA 2DVSA 4YYNA 4KV4A 4YC9A 5II2A 5EISA 4O7FA 4UYFB 4YH4A 4BW1A 5L96A 3UVDA 5DYCA 2YYNA 5FB0A 5IGNA 5DYUA 5HELA 3FKMX 5IGKA 4LRGA 4IR4A 4YYKA 5CUAA 2G4AA 5C8GA 4CURA 1EQFA 5HFRA 3P1DA 2OO1A 4N4GA 3MUKA 4PTBA 4BW4A 5BT5A 2DVQA 4PY6A 3Q2FA 4TU4A 5EU1A 5FE4A 4O75A 5I7YA 4O78A 5EWCA 5A5QA 4QSRA 4UYEA 3SVGA 4TT2A 5AD2A 5ENIA 2OUOA 4LC2A 4UIVA 4NUEA 5F36A 4YYMA 5E7DA 3P1EA 4NQNA 5H1VA 4E96A 1ZKRA 3O33A 5ENFA 5A5OA 4UIYA 4NR4A 2DVRA 4C67A 4YABA 4HXPA 2DWWA 4O7CA 5K29A 4NR5A 5TCMA 5JI8A 5ENHA 3AQAA 4A9KA 4TTEA 4J0SA 2F6NA 4UYDA 4CUUA 5D0CA 5FE0A 4F3IA 4HXKA 4A9JA 4PCEA 4UYHA 5ENBA 2DKWA 5EVAA 4QUUA 5EWWA 5A82A 2N9GA 5E0RA 4HBWA 4QEWA 3UV2A 4A9NA 4TT4A 4A9HA 4BHWA 5ENEA 5FE7A 5I7XA 5C89A 4A9EA 4MENA 5H1TA 5D3LA 5D7XA 3U5OA 3D1BA 4PS5A 5KTXA 5CQTA 4QYDA 5FE2A 5EA1A 3LQIA 5I88A 5G4SA 5CY9A 2L85A 4QSWA 5FFVA 5EPBA 5LUUA 3MXFA 4J1PA 3SVFA 5DW1A 3UW9A 5E9YA 5E9MA 3IU5A 5I86A 2I7KA 3ONIA 2WP1A 4LR6A 4TT6A 3GG3A 5F3AA 4CFKA 4IR3A 4O7EA 5EWDA 4QSTA 5EWVA 5HQ6A 4WHWA 4BW3A 5DX4A 3RCWA 4QZSA 4CL9A 5L99A 2R10A 4A9LA 4NYWA 5FH8A 4MEOA 4IR5A 4X2IA 5C7NA 2R0SA 3O35A 4C66A 2RI7A
chains in the Genus database with same CATH topology
5F2PA 5FE9A 4YY6A 5IIDA 4NR7A 3TLPA 4QC1A 4MEPA 4QSVA 3O37A 5D25A 5HLSA 5ACYA 4UIXA 4UYGA 3UV4A 3JVJA 4ALHA 5EK9A 4N4IA 5HQ5A 4DONA 4UIWA 1F68A 1WUGA 4TYLA 5CQ5A 5A83A 5FG4A 4XYAA 4NRBA 4QSQA 4QB3A 4QY4A 5E9VA 3Q2EA 5I83A 2LSPB 5ETDA 5IGLA 4CLBA 4A9IA 5CTLA 5HRWA 5DFBA 4ALGA 4HXOA 5CP5A 3MB3A 2E7NA 4Q0OA 5F61A 4A9MA 4TS8A 5F60A 5CRMA 5F62A 5CUCA 5E3GA 3LXJA 4LYWA 5EICA 4Z1SA 4TU6A 4XUAA 5CUDA 5L98A 5D3TA 3G0JA 5IGMA 5D3HA 3U5NA 4GPJA 4CFLA 4HXNA 5D3SA 4KCXA 2D82A 4WIVA 5CPEA 5FH7A 5KU3A 2I8NA 4HBVA 4CUQA 4CUPA 5A85A 5A5NA 2YELA 3DAIA 5CRZA 4O7AA 3HMEA 5CQ4A 5ENCA 5DW2A 4Q0NA 5KO4A 4UITA 4A9FA 4HXMA 5A5SA 4LZ2A 5CQ3A 4Z6HA 5AMEA 5J0DA 5FE6A 5C87A 3U5MA 5LJ0A 5E9LA 4Z93A 3I3JA 4XY8A 4YYJA 4IR6A 5ENGA 5G4RA 5FH6A 4XUBA 3QZSA 3G0LA 4MEQA 5CUBA 4N4FA 5EV9A 2H60A 2RS9B 5ETBA 4A9OA 5L97A 4ZQLA 3O36A 2E7OA 4MR6A 4N4HA 3D7CA 4Z6IA 3UVYA 5KTUA 5HEMA 4QR5A 5I1QA 4RVRA 5DBMA 5TB6A 4NYVA 2L5EA 5CQ8A 5C4QA 4O70A 5HFQA 4AKNA 1N72A 2E3KA 5AMFA 5D3PA 5LVRA 5F5ZA 5HENA 5I29A 3DWYA 4NUDA 4QUTA 5CZGA 5A7CA 4OGIA 5DY7A 4LZRA 2RO1A 4YATA 5FE3A 4LZSA 5A81A 4NR6A 4NRCA 4PKLA 5ENJA 5FBXA 4O76A 5DYAA 4BW2A 4XY9A 5LKXA 5A5PA 4QYLA 4FLPA 4QR4A 5COIA 4QSPA 4YADA 3JVKA 4HXRA 5CGPA 5CQAA 5BT3A 4O71A 1JM4B 5LKZA 3UV5A 3S91A 5DKDA 4YYDA 2R0YA 3MQMA 4WHUA 5CU8A 3LQHA 5EI4A 4LYIA 4NXJA 4NR8A 4HBXA 5E73A 4HXLA 3AADA 4YYHA 5FG5A 2RFJA 2RNWA 3JVMA 4NQMA 5HJCA 5F25A 2WP2A 4O72A 4QC3A 2YEMA 4QNSA 5FG6A 3UVWA 4CUSA 4YYGA 5FE1A 1WUMA 4QSSA 5FDZA 4YYIA 2OSSA 5LJ1A 4UYFA 5E9KA 5AD3A 5EP7A 2DATA 3IU6A 5F1LA 5DKCA 4NYXA 5DFDA 2YEKA 4YY4A 1E6IA 1X0JA 5HRVA 4QSUA 5D26A 5LKUA 2MJVB 4LYSA 5EGUA 4ZC9A 4QSXA 4IORA 5HCLA 4ZW1A 5C85A 5E3DA 5IBNA 4LDFA 5FE5A 5D3RA 2NXBA 4NUCA 4O74A 4UIZA 2RNXA 3HMHA 3NXBA 4Y03A 5L8UA 5F1HA 3JVLA 5FFWA 4TQNA 5HQ7A 3MB4A 3U5KA 5EQ1A 4O77A 2F6JA 4UIUA 5DFCA 5EPRA 5KTWA 3U5LA 3U5PA 5L8TA 4PCIA 4YBTA 2YQDA 5CS8A 5LVQA 4MR5A 2R0VA 4KV1A 4OGJA 2KTBB 4BJXA 2YDWA 4YK0A 4QR3A 4J3IA 5F63A 3O34A 5FB1A 5II1A 5FE8A 3UVXA 4YH3A 3P5OA 5EM3A 5DYXA 5H85A 2FSAA 5BT4A 5EWHA 4NRAA 4QEUA 2RNYA 4J0RA 3QZVA 5DLXA 2DVVA 4MR4A 5D3NA 4OUFA 3MULA 5E74A 1JSPB 4O7BA 5LJ2A 4HBYA 3QZTA 2YW5A 4IOQA 5D3JA 3U5JA 5E9IA 2D9EA 5JWMA 3LQJA 5FFYA 4Z1QA 4HXSA 5CFWA 5I80A 3P1CA 2L84A 3LJWA 5CUEA 4MR3A 4TZ8A 3K2JA 5DKHA 3S92A 5EPSA 3ZYUA 5HRXA 4NR9A 4YBMA 4QEVA 5I40A 4YBSA 5CQ6A 5A5RA 5LKTA 4IOOA 5D24A 4N3WA 4QBMA 4NS5A 3P1FA 4TZ2A 5I89A 4YAXA 5KHMA 5HM0A 4CUTA 3SVHA 5H1UA 5IG6A 1ZS5A 3HMFA 5CQ7A 5CUGA 2GRCA 5DLZA 2DVSA 4YYNA 4KV4A 4YC9A 5II2A 5EISA 4O7FA 4UYFB 4YH4A 4BW1A 5L96A 3UVDA 5DYCA 2YYNA 5FB0A 5IGNA 5DYUA 5HELA 3FKMX 5IGKA 4LRGA 4IR4A 4YYKA 5CUAA 2G4AA 5C8GA 4CURA 1EQFA 5HFRA 3P1DA 2OO1A 4N4GA 3MUKA 4PTBA 4BW4A 5BT5A 2DVQA 4PY6A 3Q2FA 4TU4A 5EU1A 5FE4A 4O75A 5I7YA 4O78A 5EWCA 5A5QA 4QSRA 4UYEA 3SVGA 4TT2A 5AD2A 5ENIA 2OUOA 4LC2A 4UIVA 4NUEA 5F36A 4YYMA 5E7DA 3P1EA 4NQNA 5H1VA 4E96A 3O33A 5ENFA 5A5OA 4UIYA 4NR4A 2DVRA 4C67A 4YABA 4HXPA 2DWWA 4O7CA 5K29A 4NR5A 5TCMA 5JI8A 5ENHA 3AQAA 4A9KA 4TTEA 4J0SA 2F6NA 4UYDA 4CUUA 5D0CA 5FE0A 4F3IA 4HXKA 4A9JA 4PCEA 4UYHA 5ENBA 2DKWA 5EVAA 4QUUA 5EWWA 5A82A 2N9GA 5E0RA 4HBWA 4QEWA 3UV2A 4A9NA 4TT4A 4A9HA 4BHWA 5ENEA 5FE7A 5I7XA 5C89A 4A9EA 4MENA 5H1TA 5D3LA 5D7XA 3U5OA 4PS5A 5KTXA 5CQTA 4QYDA 5FE2A 5EA1A 3LQIA 5I88A 5G4SA 5CY9A 2L85A 4QSWA 5FFVA 5EPBA 5LUUA 3MXFA 4J1PA 3SVFA 5DW1A 3UW9A 5E9YA 5E9MA 3IU5A 5I86A 2I7KA 3ONIA 2WP1A 4LR6A 4TT6A 3GG3A 5F3AA 4CFKA 4IR3A 4O7EA 5EWDA 4QSTA 5EWVA 5HQ6A 4WHWA 4BW3A 5DX4A 3RCWA 4QZSA 4CL9A 5L99A 2R10A 4A9LA 4NYWA 5FH8A 4MEOA 4IR5A 4X2IA 5C7NA 2R0SA 3O35A 4C66A 2RI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F2P A;  5FE9 A;  4YY6 A;  5IID A;  4NR7 A;  3TLP A;  4QC1 A;  4MEP A;  4QSV A;  3O37 A;  5D25 A;  5HLS A;  5ACY A;  4UIX A;  4UYG A;  3UV4 A;  3JVJ A;  4ALH A;  5EK9 A;  4N4I A;  5HQ5 A;  4DON A;  4UIW A;  1F68 A;  1WUG A;  4TYL A;  5CQ5 A;  5A83 A;  5FG4 A;  4XYA A;  4NRB A;  4QSQ A;  4QB3 A;  4QY4 A;  5E9V A;  3Q2E A;  5I83 A;  2LSP B;  5ETD A;  5IGL A;  4CLB A;  4A9I A;  5CTL A;  5HRW A;  5DFB A;  4ALG A;  4HXO A;  5CP5 A;  3MB3 A;  2E7N A;  4Q0O A;  5F61 A;  4A9M A;  4TS8 A;  5F60 A;  5CRM A;  5F62 A;  5CUC A;  5E3G A;  3LXJ A;  4LYW A;  5EIC A;  4Z1S A;  4TU6 A;  4XUA A;  5CUD A;  5L98 A;  5D3T A;  3G0J A;  5IGM A;  5D3H A;  3U5N A;  4GPJ A;  4CFL A;  4HXN A;  5D3S A;  4KCX A;  2D82 A;  4WIV A;  5CPE A;  5FH7 A;  5KU3 A;  2I8N A;  4HBV A;  4CUQ A;  4CUP A;  5A85 A;  5A5N A;  2YEL A;  3DAI A;  5CRZ A;  4O7A A;  3HME A;  5CQ4 A;  5ENC A;  5DW2 A;  4Q0N A;  5KO4 A;  4UIT A;  4A9F A;  4HXM A;  5A5S A;  4LZ2 A;  5CQ3 A;  4Z6H A;  5AME A;  5J0D A;  5FE6 A;  5C87 A;  3U5M A;  5LJ0 A;  5E9L A;  4Z93 A;  3I3J A;  4XY8 A;  4YYJ A;  4IR6 A;  5ENG A;  5G4R A;  5FH6 A;  4XUB A;  3QZS A;  3G0L A;  4MEQ A;  5CUB A;  4N4F A;  5EV9 A;  2H60 A;  2RS9 B;  5ETB A;  4A9O A;  5L97 A;  4ZQL A;  3O36 A;  2E7O A;  4MR6 A;  4N4H A;  3D7C A;  4Z6I A;  3UVY A;  5KTU A;  5HEM A;  4QR5 A;  5I1Q A;  4RVR A;  5DBM A;  5TB6 A;  4NYV A;  2L5E A;  5CQ8 A;  5C4Q A;  4O70 A;  5HFQ A;  4AKN A;  1N72 A;  2E3K A;  5AMF A;  5D3P A;  5LVR A;  5F5Z A;  5HEN A;  5I29 A;  3DWY A;  4NUD A;  4QUT A;  5CZG A;  5A7C A;  4OGI A;  5DY7 A;  4LZR A;  2RO1 A;  4YAT A;  5FE3 A;  4LZS A;  5A81 A;  4NR6 A;  4NRC A;  4PKL A;  5ENJ A;  5FBX A;  4O76 A;  5DYA A;  4BW2 A;  4XY9 A;  5LKX A;  5A5P A;  4QYL A;  4FLP A;  4QR4 A;  5COI A;  4QSP A;  4YAD A;  3JVK A;  4HXR A;  5CGP A;  5CQA A;  5BT3 A;  4O71 A;  1JM4 B;  5LKZ A;  3UV5 A;  3S91 A;  5DKD A;  4YYD A;  2R0Y A;  3MQM A;  4WHU A;  5CU8 A;  3LQH A;  5EI4 A;  4LYI A;  4NXJ A;  4NR8 A;  4HBX A;  5E73 A;  4HXL A;  3AAD A;  4YYH A;  5FG5 A;  2RFJ A;  2RNW A;  3JVM A;  4NQM A;  5HJC A;  5F25 A;  2WP2 A;  4O72 A;  4QC3 A;  2YEM A;  4QNS A;  5FG6 A;  3UVW A;  4CUS A;  4YYG A;  5FE1 A;  1WUM A;  4QSS A;  5FDZ A;  4YYI A;  2OSS A;  5LJ1 A;  4UYF A;  5E9K A;  5AD3 A;  5EP7 A;  2DAT A;  3IU6 A;  5F1L A;  5DKC A;  4NYX A;  5DFD A;  2YEK A;  4YY4 A;  1E6I A;  1X0J A;  5HRV A;  4QSU A;  5D26 A;  5LKU A;  2MJV B;  4LYS A;  5EGU A;  4ZC9 A;  4QSX A;  4IOR A;  5HCL A;  4ZW1 A;  5C85 A;  5E3D A;  5IBN A;  4LDF A;  5FE5 A;  5D3R A;  2NXB A;  4NUC A;  4O74 A;  4UIZ A;  2RNX A;  3HMH A;  3NXB A;  4Y03 A;  5L8U A;  5F1H A;  3JVL A;  5FFW A;  4TQN A;  5HQ7 A;  3MB4 A;  3U5K A;  5EQ1 A;  4O77 A;  2F6J A;  4UIU A;  5DFC A;  5EPR A;  5KTW A;  3U5L A;  3U5P A;  5L8T A;  4PCI A;  4YBT A;  2YQD A;  5CS8 A;  5LVQ A;  4MR5 A;  2R0V A;  4KV1 A;  4OGJ A;  2KTB B;  4BJX A;  2YDW A;  4YK0 A;  4QR3 A;  4J3I A;  5F63 A;  3O34 A;  5FB1 A;  5II1 A;  5FE8 A;  3UVX A;  4YH3 A;  3P5O A;  5EM3 A;  5DYX A;  5H85 A;  2FSA A;  5BT4 A;  5EWH A;  4NRA A;  4QEU A;  2RNY A;  4J0R A;  3QZV A;  5DLX A;  2DVV A;  4MR4 A;  5D3N A;  4OUF A;  3MUL A;  5E74 A;  1JSP B;  4O7B A;  5LJ2 A;  4HBY A;  3QZT A;  2YW5 A;  4IOQ A;  5D3J A;  3U5J A;  5E9I A;  2D9E A;  5JWM A;  3LQJ A;  5FFY A;  4Z1Q A;  4HXS A;  5CFW A;  5I80 A;  3P1C A;  2L84 A;  3LJW A;  5CUE A;  4MR3 A;  4TZ8 A;  3K2J A;  5DKH A;  3S92 A;  5EPS A;  3ZYU A;  5HRX A;  4NR9 A;  4YBM A;  4QEV A;  5I40 A;  4YBS A;  5CQ6 A;  5A5R A;  5LKT A;  4IOO A;  5D24 A;  4N3W A;  4QBM A;  4NS5 A;  3P1F A;  4TZ2 A;  5I89 A;  4YAX A;  5KHM A;  5HM0 A;  4CUT A;  3SVH A;  5H1U A;  5IG6 A;  1ZS5 A;  3HMF A;  5CQ7 A;  5CUG A;  2GRC A;  5DLZ A;  2DVS A;  4YYN A;  4KV4 A;  4YC9 A;  5II2 A;  5EIS A;  4O7F A;  4UYF B;  4YH4 A;  4BW1 A;  5L96 A;  3UVD A;  5DYC A;  2YYN A;  5FB0 A;  5IGN A;  5DYU A;  5HEL A;  3FKM X;  5IGK A;  4LRG A;  4IR4 A;  4YYK A;  5CUA A;  2G4A A;  5C8G A;  4CUR A;  1EQF A;  5HFR A;  3P1D A;  2OO1 A;  4N4G A;  3MUK A;  4PTB A;  4BW4 A;  5BT5 A;  2DVQ A;  4PY6 A;  3Q2F A;  4TU4 A;  5EU1 A;  5FE4 A;  4O75 A;  5I7Y A;  4O78 A;  5EWC A;  5A5Q A;  4QSR A;  4UYE A;  3SVG A;  4TT2 A;  5AD2 A;  5ENI A;  2OUO A;  4LC2 A;  4UIV A;  4NUE A;  5F36 A;  4YYM A;  5E7D A;  3P1E A;  4NQN A;  5H1V A;  4E96 A;  3O33 A;  5ENF A;  5A5O A;  4UIY A;  4NR4 A;  2DVR A;  4C67 A;  4YAB A;  4HXP A;  2DWW A;  4O7C A;  5K29 A;  4NR5 A;  5TCM A;  5JI8 A;  5ENH A;  3AQA A;  4A9K A;  4TTE A;  4J0S A;  2F6N A;  4UYD A;  4CUU A;  5D0C A;  5FE0 A;  4F3I A;  4HXK A;  4A9J A;  4PCE A;  4UYH A;  5ENB A;  2DKW A;  5EVA A;  4QUU A;  5EWW A;  5A82 A;  2N9G A;  5E0R A;  4HBW A;  4QEW A;  3UV2 A;  4A9N A;  4TT4 A;  4A9H A;  4BHW A;  5ENE A;  5FE7 A;  5I7X A;  5C89 A;  4A9E A;  4MEN A;  5H1T A;  5D3L A;  5D7X A;  3U5O A;  4PS5 A;  5KTX A;  5CQT A;  4QYD A;  5FE2 A;  5EA1 A;  3LQI A;  5I88 A;  5G4S A;  5CY9 A;  2L85 A;  4QSW A;  5FFV A;  5EPB A;  5LUU A;  3MXF A;  4J1P A;  3SVF A;  5DW1 A;  3UW9 A;  5E9Y A;  5E9M A;  3IU5 A;  5I86 A;  2I7K A;  3ONI A;  2WP1 A;  4LR6 A;  4TT6 A;  3GG3 A;  5F3A A;  4CFK A;  4IR3 A;  4O7E A;  5EWD A;  4QST A;  5EWV A;  5HQ6 A;  4WHW A;  4BW3 A;  5DX4 A;  3RCW A;  4QZS A;  4CL9 A;  5L99 A;  2R10 A;  4A9L A;  4NYW A;  5FH8 A;  4MEO A;  4IR5 A;  4X2I A;  5C7N A;  2R0S A;  3O35 A;  4C66 A;  2RI7 A; 
#chains in the Genus database with same CATH topology
 5F2P A;  5FE9 A;  4YY6 A;  5IID A;  4NR7 A;  3TLP A;  4QC1 A;  4MEP A;  4QSV A;  3O37 A;  5D25 A;  5HLS A;  5ACY A;  4UIX A;  4UYG A;  3UV4 A;  3JVJ A;  4ALH A;  5EK9 A;  4N4I A;  5HQ5 A;  4DON A;  4UIW A;  1F68 A;  1WUG A;  4TYL A;  5CQ5 A;  5A83 A;  5FG4 A;  4XYA A;  4NRB A;  4QSQ A;  4QB3 A;  4QY4 A;  5E9V A;  3Q2E A;  5I83 A;  2LSP B;  5ETD A;  3VKG A;  5IGL A;  4CLB A;  4A9I A;  5CTL A;  5HRW A;  5DFB A;  4ALG A;  4HXO A;  5CP5 A;  3MB3 A;  2E7N A;  4Q0O A;  5F61 A;  4A9M A;  4TS8 A;  5F60 A;  5CRM A;  5F62 A;  5CUC A;  5E3G A;  3LXJ A;  4LYW A;  5EIC A;  4Z1S A;  4TU6 A;  4XUA A;  5CUD A;  5L98 A;  5D3T A;  3G0J A;  5IGM A;  5D3H A;  3U5N A;  4GPJ A;  4CFL A;  4HXN A;  5D3S A;  4KCX A;  2D82 A;  4WIV A;  5CPE A;  5FH7 A;  5KU3 A;  2I8N A;  4HBV A;  4CUQ A;  4CUP A;  5A85 A;  5A5N A;  2YEL A;  3DAI A;  5CRZ A;  4O7A A;  3HME A;  5CQ4 A;  5ENC A;  5DW2 A;  4Q0N A;  5KO4 A;  4UIT A;  4A9F A;  4HXM A;  5A5S A;  4LZ2 A;  5CQ3 A;  4Z6H A;  2EJN A;  5AME A;  5J0D A;  5FE6 A;  5C87 A;  3U5M A;  5LJ0 A;  5E9L A;  4Z93 A;  3I3J A;  4XY8 A;  4YYJ A;  4IR6 A;  5ENG A;  5G4R A;  5FH6 A;  4XUB A;  3QZS A;  3G0L A;  4MEQ A;  5CUB A;  4AI6 A;  4N4F A;  5EV9 A;  2H60 A;  2RS9 B;  5ETB A;  4A9O A;  5L97 A;  4ZQL A;  3O36 A;  2E7O A;  4MR6 A;  4N4H A;  3D7C A;  4Z6I A;  3UVY A;  5KTU A;  5HEM A;  4QR5 A;  5I1Q A;  4RVR A;  5DBM A;  5TB6 A;  4NYV A;  2L5E A;  5CQ8 A;  5C4Q A;  4O70 A;  5HFQ A;  4AKN A;  1N72 A;  2E3K A;  5AMF A;  5D3P A;  5LVR A;  5F5Z A;  5HEN A;  5I29 A;  3DWY A;  4NUD A;  4QUT A;  5CZG A;  5A7C A;  4OGI A;  5DY7 A;  4LZR A;  2RO1 A;  4YAT A;  5FE3 A;  4LZS A;  5A81 A;  4NR6 A;  4NRC A;  4PKL A;  5ENJ A;  5FBX A;  4O76 A;  5DYA A;  4BW2 A;  4XY9 A;  5LKX A;  5A5P A;  4QYL A;  4FLP A;  4QR4 A;  5COI A;  4QSP A;  4YAD A;  3JVK A;  4HXR A;  5CGP A;  5CQA A;  5BT3 A;  4O71 A;  1JM4 B;  5LKZ A;  3UV5 A;  3S91 A;  5DKD A;  4YYD A;  2R0Y A;  3MQM A;  4WHU A;  5CU8 A;  4AKH A;  3LQH A;  5EI4 A;  4LYI A;  4NXJ A;  4NR8 A;  4HBX A;  5E73 A;  4HXL A;  3AAD A;  4YYH A;  5FG5 A;  2RFJ A;  2RNW A;  3JVM A;  4NQM A;  5HJC A;  5F25 A;  2WP2 A;  4O72 A;  4QC3 A;  2YEM A;  4QNS A;  4AKI A;  5FG6 A;  3UVW A;  4CUS A;  4YYG A;  5FE1 A;  1WUM A;  4QSS A;  5FDZ A;  4YYI A;  2OSS A;  5LJ1 A;  4UYF A;  5E9K A;  5AD3 A;  5EP7 A;  2DAT A;  3IU6 A;  5F1L A;  5DKC A;  4NYX A;  5DFD A;  2YEK A;  4YY4 A;  1E6I A;  1X0J A;  5HRV A;  4QSU A;  5D26 A;  5LKU A;  2MJV B;  4LYS A;  5EGU A;  4ZC9 A;  4QSX A;  4IOR A;  5HCL A;  4ZW1 A;  5C85 A;  5E3D A;  5IBN A;  4LDF A;  5FE5 A;  5D3R A;  2NXB A;  4NUC A;  4O74 A;  4UIZ A;  2RNX A;  3HMH A;  3NXB A;  4Y03 A;  5L8U A;  5F1H A;  3JVL A;  5FFW A;  4TQN A;  5HQ7 A;  3MB4 A;  3U5K A;  5EQ1 A;  4O77 A;  2F6J A;  4UIU A;  5DFC A;  5EPR A;  5KTW A;  3U5L A;  3U5P A;  5L8T A;  4PCI A;  4YBT A;  2YQD A;  5CS8 A;  5LVQ A;  4MR5 A;  2R0V A;  4KV1 A;  4OGJ A;  2KTB B;  4BJX A;  2YDW A;  4YK0 A;  4QR3 A;  4J3I A;  5F63 A;  3O34 A;  5FB1 A;  5II1 A;  5FE8 A;  3UVX A;  4YH3 A;  3P5O A;  5EM3 A;  5DYX A;  5H85 A;  2FSA A;  5BT4 A;  5EWH A;  4AKG A;  4NRA A;  4QEU A;  2RNY A;  3ERR A;  3QZV A;  4J0R A;  5DLX A;  2DVV A;  4MR4 A;  5D3N A;  4OUF A;  3MUL A;  5E74 A;  1JSP B;  4O7B A;  5LJ2 A;  4HBY A;  3QZT A;  3VKH A;  2YW5 A;  4IOQ A;  5D3J A;  3U5J A;  5E9I A;  2D9E A;  5JWM A;  3LQJ A;  5FFY A;  4Z1Q A;  4HXS A;  5CFW A;  5I80 A;  3P1C A;  2L84 A;  3D1D A;  3LJW A;  5CUE A;  4MR3 A;  4TZ8 A;  3K2J A;  5DKH A;  3S92 A;  5EPS A;  3ZYU A;  5HRX A;  4NR9 A;  4YBM A;  4QEV A;  5I40 A;  4YBS A;  5CQ6 A;  5A5R A;  5LKT A;  4IOO A;  5D24 A;  4N3W A;  4QBM A;  4NS5 A;  3P1F A;  4TZ2 A;  5I89 A;  4YAX A;  5KHM A;  5HM0 A;  4CUT A;  3SVH A;  5H1U A;  1PUO A;  5IG6 A;  1ZS5 A;  3HMF A;  5CQ7 A;  5CUG A;  2GRC A;  5DLZ A;  2DVS A;  4YYN A;  4KV4 A;  4YC9 A;  5II2 A;  5EIS A;  4O7F A;  4UYF B;  4YH4 A;  4BW1 A;  5L96 A;  3UVD A;  5DYC A;  2YYN A;  5FB0 A;  5IGN A;  5DYU A;  5HEL A;  3FKM X;  5IGK A;  4LRG A;  4IR4 A;  4YYK A;  5CUA A;  2G4A A;  5C8G A;  4CUR A;  1EQF A;  5HFR A;  3P1D A;  2OO1 A;  4N4G A;  3MUK A;  4PTB A;  4BW4 A;  5BT5 A;  2DVQ A;  4PY6 A;  3Q2F A;  4TU4 A;  5EU1 A;  5FE4 A;  4O75 A;  5I7Y A;  4O78 A;  5EWC A;  5A5Q A;  4QSR A;  4UYE A;  3SVG A;  4TT2 A;  5AD2 A;  5ENI A;  2OUO A;  4LC2 A;  4UIV A;  4NUE A;  5F36 A;  4YYM A;  5E7D A;  3P1E A;  4NQN A;  5H1V A;  4E96 A;  1ZKR A;  3O33 A;  5ENF A;  5A5O A;  4UIY A;  4NR4 A;  2DVR A;  4C67 A;  4YAB A;  4HXP A;  2DWW A;  4O7C A;  5K29 A;  4NR5 A;  5TCM A;  5JI8 A;  5ENH A;  3AQA A;  4A9K A;  4TTE A;  4J0S A;  2F6N A;  4UYD A;  4CUU A;  5D0C A;  5FE0 A;  4F3I A;  4HXK A;  4A9J A;  4PCE A;  4UYH A;  5ENB A;  2DKW A;  5EVA A;  4QUU A;  5EWW A;  5A82 A;  2N9G A;  5E0R A;  4HBW A;  4QEW A;  3UV2 A;  4A9N A;  4TT4 A;  4A9H A;  4BHW A;  5ENE A;  5FE7 A;  5I7X A;  5C89 A;  4A9E A;  4MEN A;  5H1T A;  5D3L A;  5D7X A;  3U5O A;  3D1B A;  4PS5 A;  5KTX A;  5CQT A;  4QYD A;  5FE2 A;  5EA1 A;  3LQI A;  5I88 A;  5G4S A;  5CY9 A;  2L85 A;  4QSW A;  5FFV A;  5EPB A;  5LUU A;  3MXF A;  4J1P A;  3SVF A;  5DW1 A;  3UW9 A;  5E9Y A;  5E9M A;  3IU5 A;  5I86 A;  2I7K A;  3ONI A;  2WP1 A;  4LR6 A;  4TT6 A;  3GG3 A;  5F3A A;  4CFK A;  4IR3 A;  4O7E A;  5EWD A;  4QST A;  5EWV A;  5HQ6 A;  4WHW A;  4BW3 A;  5DX4 A;  3RCW A;  4QZS A;  4CL9 A;  5L99 A;  2R10 A;  4A9L A;  4NYW A;  5FH8 A;  4MEO A;  4IR5 A;  4X2I A;  5C7N A;  2R0S A;  3O35 A;  4C66 A;  2RI7 A; 
#chains in the Genus database with same CATH homology
 5F2P A;  5FE9 A;  4YY6 A;  5IID A;  4NR7 A;  3TLP A;  4QC1 A;  4MEP A;  4QSV A;  3O37 A;  5D25 A;  5HLS A;  5ACY A;  4UIX A;  4UYG A;  3UV4 A;  3JVJ A;  4ALH A;  5EK9 A;  4N4I A;  5HQ5 A;  4DON A;  4UIW A;  1F68 A;  1WUG A;  4TYL A;  5CQ5 A;  5A83 A;  5FG4 A;  4XYA A;  4NRB A;  4QSQ A;  4QB3 A;  4QY4 A;  5E9V A;  3Q2E A;  5I83 A;  2LSP B;  5ETD A;  5IGL A;  4CLB A;  4A9I A;  5CTL A;  5HRW A;  5DFB A;  4ALG A;  4HXO A;  5CP5 A;  3MB3 A;  2E7N A;  4Q0O A;  5F61 A;  4A9M A;  4TS8 A;  5F60 A;  5CRM A;  5F62 A;  5CUC A;  5E3G A;  3LXJ A;  4LYW A;  5EIC A;  4Z1S A;  4TU6 A;  4XUA A;  5CUD A;  5L98 A;  5D3T A;  3G0J A;  5IGM A;  5D3H A;  3U5N A;  4GPJ A;  4CFL A;  4HXN A;  5D3S A;  4KCX A;  2D82 A;  4WIV A;  5CPE A;  5FH7 A;  5KU3 A;  2I8N A;  4HBV A;  4CUQ A;  4CUP A;  5A85 A;  5A5N A;  2YEL A;  3DAI A;  5CRZ A;  4O7A A;  3HME A;  5CQ4 A;  5ENC A;  5DW2 A;  4Q0N A;  5KO4 A;  4UIT A;  4A9F A;  4HXM A;  5A5S A;  4LZ2 A;  5CQ3 A;  4Z6H A;  5AME A;  5J0D A;  5FE6 A;  5C87 A;  3U5M A;  5LJ0 A;  5E9L A;  4Z93 A;  3I3J A;  4XY8 A;  4YYJ A;  4IR6 A;  5ENG A;  5G4R A;  5FH6 A;  4XUB A;  3QZS A;  3G0L A;  4MEQ A;  5CUB A;  4N4F A;  5EV9 A;  2H60 A;  2RS9 B;  5ETB A;  4A9O A;  5L97 A;  4ZQL A;  3O36 A;  2E7O A;  4MR6 A;  4N4H A;  3D7C A;  4Z6I A;  3UVY A;  5KTU A;  5HEM A;  4QR5 A;  5I1Q A;  4RVR A;  5DBM A;  5TB6 A;  4NYV A;  2L5E A;  5CQ8 A;  5C4Q A;  4O70 A;  5HFQ A;  4AKN A;  1N72 A;  2E3K A;  5AMF A;  5D3P A;  5LVR A;  5F5Z A;  5HEN A;  5I29 A;  3DWY A;  4NUD A;  4QUT A;  5CZG A;  5A7C A;  4OGI A;  5DY7 A;  4LZR A;  2RO1 A;  4YAT A;  5FE3 A;  4LZS A;  5A81 A;  4NR6 A;  4NRC A;  4PKL A;  5ENJ A;  5FBX A;  4O76 A;  5DYA A;  4BW2 A;  4XY9 A;  5LKX A;  5A5P A;  4QYL A;  4FLP A;  4QR4 A;  5COI A;  4QSP A;  4YAD A;  3JVK A;  4HXR A;  5CGP A;  5CQA A;  5BT3 A;  4O71 A;  1JM4 B;  5LKZ A;  3UV5 A;  3S91 A;  5DKD A;  4YYD A;  2R0Y A;  3MQM A;  4WHU A;  5CU8 A;  3LQH A;  5EI4 A;  4LYI A;  4NXJ A;  4NR8 A;  4HBX A;  5E73 A;  4HXL A;  3AAD A;  4YYH A;  5FG5 A;  2RFJ A;  2RNW A;  3JVM A;  4NQM A;  5HJC A;  5F25 A;  2WP2 A;  4O72 A;  4QC3 A;  2YEM A;  4QNS A;  5FG6 A;  3UVW A;  4CUS A;  4YYG A;  5FE1 A;  1WUM A;  4QSS A;  5FDZ A;  4YYI A;  2OSS A;  5LJ1 A;  4UYF A;  5E9K A;  5AD3 A;  5EP7 A;  2DAT A;  3IU6 A;  5F1L A;  5DKC A;  4NYX A;  5DFD A;  2YEK A;  4YY4 A;  1E6I A;  1X0J A;  5HRV A;  4QSU A;  5D26 A;  5LKU A;  2MJV B;  4LYS A;  5EGU A;  4ZC9 A;  4QSX A;  4IOR A;  5HCL A;  4ZW1 A;  5C85 A;  5E3D A;  5IBN A;  4LDF A;  5FE5 A;  5D3R A;  2NXB A;  4NUC A;  4O74 A;  4UIZ A;  2RNX A;  3HMH A;  3NXB A;  4Y03 A;  5L8U A;  5F1H A;  3JVL A;  5FFW A;  4TQN A;  5HQ7 A;  3MB4 A;  3U5K A;  5EQ1 A;  4O77 A;  2F6J A;  4UIU A;  5DFC A;  5EPR A;  5KTW A;  3U5L A;  3U5P A;  5L8T A;  4PCI A;  4YBT A;  2YQD A;  5CS8 A;  5LVQ A;  4MR5 A;  2R0V A;  4KV1 A;  4OGJ A;  2KTB B;  4BJX A;  2YDW A;  4YK0 A;  4QR3 A;  4J3I A;  5F63 A;  3O34 A;  5FB1 A;  5II1 A;  5FE8 A;  3UVX A;  4YH3 A;  3P5O A;  5EM3 A;  5DYX A;  5H85 A;  2FSA A;  5BT4 A;  5EWH A;  4NRA A;  4QEU A;  2RNY A;  4J0R A;  3QZV A;  5DLX A;  2DVV A;  4MR4 A;  5D3N A;  4OUF A;  3MUL A;  5E74 A;  1JSP B;  4O7B A;  5LJ2 A;  4HBY A;  3QZT A;  2YW5 A;  4IOQ A;  5D3J A;  3U5J A;  5E9I A;  2D9E A;  5JWM A;  3LQJ A;  5FFY A;  4Z1Q A;  4HXS A;  5CFW A;  5I80 A;  3P1C A;  2L84 A;  3LJW A;  5CUE A;  4MR3 A;  4TZ8 A;  3K2J A;  5DKH A;  3S92 A;  5EPS A;  3ZYU A;  5HRX A;  4NR9 A;  4YBM A;  4QEV A;  5I40 A;  4YBS A;  5CQ6 A;  5A5R A;  5LKT A;  4IOO A;  5D24 A;  4N3W A;  4QBM A;  4NS5 A;  3P1F A;  4TZ2 A;  5I89 A;  4YAX A;  5KHM A;  5HM0 A;  4CUT A;  3SVH A;  5H1U A;  5IG6 A;  1ZS5 A;  3HMF A;  5CQ7 A;  5CUG A;  2GRC A;  5DLZ A;  2DVS A;  4YYN A;  4KV4 A;  4YC9 A;  5II2 A;  5EIS A;  4O7F A;  4UYF B;  4YH4 A;  4BW1 A;  5L96 A;  3UVD A;  5DYC A;  2YYN A;  5FB0 A;  5IGN A;  5DYU A;  5HEL A;  3FKM X;  5IGK A;  4LRG A;  4IR4 A;  4YYK A;  5CUA A;  2G4A A;  5C8G A;  4CUR A;  1EQF A;  5HFR A;  3P1D A;  2OO1 A;  4N4G A;  3MUK A;  4PTB A;  4BW4 A;  5BT5 A;  2DVQ A;  4PY6 A;  3Q2F A;  4TU4 A;  5EU1 A;  5FE4 A;  4O75 A;  5I7Y A;  4O78 A;  5EWC A;  5A5Q A;  4QSR A;  4UYE A;  3SVG A;  4TT2 A;  5AD2 A;  5ENI A;  2OUO A;  4LC2 A;  4UIV A;  4NUE A;  5F36 A;  4YYM A;  5E7D A;  3P1E A;  4NQN A;  5H1V A;  4E96 A;  3O33 A;  5ENF A;  5A5O A;  4UIY A;  4NR4 A;  2DVR A;  4C67 A;  4YAB A;  4HXP A;  2DWW A;  4O7C A;  5K29 A;  4NR5 A;  5TCM A;  5JI8 A;  5ENH A;  3AQA A;  4A9K A;  4TTE A;  4J0S A;  2F6N A;  4UYD A;  4CUU A;  5D0C A;  5FE0 A;  4F3I A;  4HXK A;  4A9J A;  4PCE A;  4UYH A;  5ENB A;  2DKW A;  5EVA A;  4QUU A;  5EWW A;  5A82 A;  2N9G A;  5E0R A;  4HBW A;  4QEW A;  3UV2 A;  4A9N A;  4TT4 A;  4A9H A;  4BHW A;  5ENE A;  5FE7 A;  5I7X A;  5C89 A;  4A9E A;  4MEN A;  5H1T A;  5D3L A;  5D7X A;  3U5O A;  4PS5 A;  5KTX A;  5CQT A;  4QYD A;  5FE2 A;  5EA1 A;  3LQI A;  5I88 A;  5G4S A;  5CY9 A;  2L85 A;  4QSW A;  5FFV A;  5EPB A;  5LUU A;  3MXF A;  4J1P A;  3SVF A;  5DW1 A;  3UW9 A;  5E9Y A;  5E9M A;  3IU5 A;  5I86 A;  2I7K A;  3ONI A;  2WP1 A;  4LR6 A;  4TT6 A;  3GG3 A;  5F3A A;  4CFK A;  4IR3 A;  4O7E A;  5EWD A;  4QST A;  5EWV A;  5HQ6 A;  4WHW A;  4BW3 A;  5DX4 A;  3RCW A;  4QZS A;  4CL9 A;  5L99 A;  2R10 A;  4A9L A;  4NYW A;  5FH8 A;  4MEO A;  4IR5 A;  4X2I A;  5C7N A;  2R0S A;  3O35 A;  4C66 A;  2RI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...