5DYCA

Crystal structure of the human brpf1 bromodomain in complex with seed6
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 41
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5dycA00
5EWVA 4UITA 5H1VA 5EP7A 5LKXA 4QBMA 5I7YA 4UIXA 5HQ7A 4QSPA 4NXJA 4Y03A 5E7DA 4NR7A 4UIVA 5D3PA 4XYAA 5A5QA 3NXBA 2OUOA 4LC2A 5CUCA 5FE7A 5D3TA 5F5ZA 4ZC9A 4J0RA 2R0YA 3MB3A 5DLXA 4NR6A 5HEMA 5E9YA 4YAXA 4TS8A 5II2A 4HBWA 5EWHA 3O37A 4CUSA 1N72A 5FE8A 5I86A 2E7OA 5ENFA 5I83A 5C85A 5I80A 5HELA 2YQDA 4IOQA 2FSAA 5BT5A 3UV2A 4O7FA 5FFWA 1EQFA 4YADA 4MENA 2OSSA 4YH4A 4QEUA 4UYHA 4Z93A 5D3NA 5DYCA 2H60A 5A83A 4YYKA 3G0LA 2N9GA 4UYFB 4YYMA 5DFCA 5I89A 3S91A 5KO4A 4TYLA 5CQ6A 4UYEA 4YBSA 5H1UA 4WHUA 4QZSA 4HXNA 4TT4A 4NYWA 4XY9A 5FFYA 4YYGA 5D25A 5A5OA 3Q2EA 2E3KA 3D7CA 4O70A 4Z1SA 5JI8A 4MR5A 5CZGA 3RCWA 5JWMA 5LJ0A 3UW9A 5EM3A 2D9EA 5IGKA 4QY4A 5EWDA 2RNYA 5E9MA 4O78A 4IR5A 5ENJA 5IBNA 2LSPB 4A9HA 3UVWA 4N4FA 4NR9A 5KHMA 5F1HA 3LXJA 5D24A 4X2IA 5DYXA 5EV9A 3U5JA 4QEVA 2RO1A 4O7BA 4A9KA 5KU3A 2YW5A 5BT4A 4A9MA 4BW2A 5FE5A 5CQAA 5ENGA 5LUUA 5EICA 3UV5A 5CUEA 5CS8A 5DKHA 5L99A 5F2PA 5EPBA 5A82A 4YK0A 4QSVA 5EQ1A 5EVAA 4YC9A 3TLPA 4UYFA 4QUUA 5II1A 5LKTA 4KV4A 4BJXA 2DWWA 4LZRA 4A9OA 5FG5A 4YYNA 5H1TA 4QR5A 5CFWA 2NXBA 5LKZA 2G4AA 4N4HA 4CUTA 5HM0A 4E96A 5ENIA 4LYSA 3P1CA 2DVQA 4NRAA 4LDFA 3P5OA 3UV4A 1ZS5A 5I40A 5HFRA 5CUGA 4A9IA 4HBVA 5CQ7A 4LR6A 4QR4A 5AD3A 3U5PA 4CUQA 4XUBA 4Q0NA 4J1PA 3ONIA 4C66A 4UIUA 5E73A 3UVXA 3P1FA 4C67A 4QB3A 5E9IA 4YBMA 4YBTA 4YYJA 4UIZA 5L8UA 3U5OA 2YELA 5CQ8A 2I7KA 4A9LA 5FBXA 4O77A 4IR6A 5FG4A 4N4IA 5FE9A 4YYDA 3JVMA 4BHWA 5EWCA 5F61A 5DKDA 4HXLA 5DFBA 3MULA 4A9JA 2DVSA 1WUMA 4Z1QA 5E9LA 5F3AA 4QC3A 4HBYA 4BW1A 5A81A 5DYAA 5LKUA 5I1QA 2L85A 4TU6A 4TU4A 4PY6A 4OGJA 5C7NA 2E7NA 2MJVB 2F6JA 4O7CA 3UVYA 3U5MA 5FB0A 5K29A 3P1EA 4LZ2A 4ZW1A 3Q2FA 2YYNA 4UIWA 3AQAA 3O34A 5HRVA 2L84A 4QSQA 5D3RA 5DW1A 3ZYUA 5KTWA 5FE0A 4MEPA 5A5PA 5EWWA 4A9EA 4OUFA 5F36A 5C4QA 5G4SA 5L8TA 3DAIA 4QNSA 2I8NA 4MEQA 4WIVA 4NRBA 2RFJA 4NR5A 5A5RA 5FH7A 3G0JA 4NS5A 5HQ5A 3O35A 4ALHA 4ZQLA 5HLSA 5F25A 5HRWA 3MXFA 4UIYA 2R0VA 5CP5A 4TZ8A 5EISA 4O74A 4HXRA 3P1DA 5FH6A 4WHWA 5F60A 5HFQA 4MR4A 4HXKA 4LZSA 5DLZA 5J0DA 4QSSA 5FE6A 2DVRA 2RI7A 5KTXA 5CY9A 3DWYA 5LJ1A 2WP1A 5FE1A 2DATA 5CU8A 4YATA 5EGUA 2KTBB 5E9VA 4O71A 4HBXA 4UYGA 4IR4A 4PCIA 5DBMA 3QZSA 1F68A 4UYDA 4N4GA 4QUTA 1E6IA 5TCMA 3HMEA 5EPRA 2RNWA 5DYUA 3MB4A 4NQNA 3LQIA 4LYIA 5E0RA 4IR3A 5ENBA 5ETDA 4HXSA 5HCLA 2YDWA 5C89A 5KTUA 5FG6A 5C87A 4YABA 4QSWA 5F1LA 3GG3A 4O75A 5A7CA 2RS9B 4GPJA 5EA1A 5E74A 4O76A 5FE3A 3LQJA 2OO1A 5LVRA 5D0CA 3IU6A 2DKWA 3MUKA 4N3WA 5ENCA 1JM4B 5EU1A 4MEOA 2RNXA 4O7EA 4NR4A 5DY7A 1X0JA 4TQNA 5COIA 4ALGA 5LVQA 5IGMA 4FLPA 4QSRA 4O7AA 5CRMA 4CUPA 4J0SA 3JVJA 4NYXA 5A5NA 3JVKA 3HMFA 5CPEA 3LJWA 5E9KA 4PTBA 4LRGA 3O33A 4TTEA 4YY6A 1WUGA 3LQHA 5G4RA 4Q0OA 5DW2A 5I29A 4MR6A 5ENHA 2GRCA 4NUCA 5FH8A 2R10A 4QEWA 4QC1A 4NQMA 4HXPA 5ENEA 5CTLA 4HXOA 4NYVA 5D3SA 5LJ2A 4QYLA 2D82A 3MQMA 2DVVA 4YH3A 5F63A 4TZ2A 4QR3A 5C8GA 3SVHA 5HRXA 5D26A 5FDZA 4XUAA 5EPSA 5FFVA 5A85A 3K2JA 5CUBA 3UVDA 1JSPB 4MR3A 5CUAA 3S92A 4PCEA 3SVFA 5HJCA 4NR8A 4CFKA 4A9NA 5CQ3A 4NRCA 4AKNA 5IGNA 2L5EA 4XY8A 4IORA 5CGPA 3U5NA 4DONA 5BT3A 4YYIA 5CQ5A 4F3IA 5HQ6A 5ACYA 4PS5A 5ETBA 5I88A 4KV1A 5A5SA 4A9FA 4Z6HA 4CURA 5EI4A 4KCXA 4BW4A 4BW3A 3U5KA 2WP2A 4RVRA 2YEKA 3FKMX 5H85A 4CFLA 4QYDA 3JVLA 5CUDA 5CRZA 5EK9A 3AADA 3IU5A 4J3IA 5F62A 4IOOA 5D3LA 5L98A 5DFDA 5TB6A 3I3JA 5CQTA 4YYHA 5DKCA 2R0SA 4Z6IA 4O72A 4OGIA 5DX4A 5E3DA 4QSTA 4CUUA 2F6NA 4NUDA 5AD2A 3SVGA 4TT6A 3QZTA 5D3HA 5IG6A 5I7XA 5E3GA 5L96A 5AMFA 3QZVA 5D3JA 3HMHA 4QSUA 4NUEA 4YY4A 4CL9A 4PKLA 4LYWA 5AMEA 5HENA 4TT2A 3U5LA 5IIDA 2YEMA 3O36A 5L97A 5FB1A 5IGLA 4HXMA 4CLBA 5FE2A 5CQ4A 5FE4A 4QSXA 5D7XA
chains in the Genus database with same CATH superfamily
5EWVA 4UITA 5H1VA 5EP7A 5LKXA 4QBMA 5I7YA 4UIXA 5HQ7A 4QSPA 4NXJA 4Y03A 5E7DA 4NR7A 4UIVA 5D3PA 4XYAA 5A5QA 3NXBA 2OUOA 4LC2A 5CUCA 5FE7A 5D3TA 5F5ZA 4ZC9A 4J0RA 2R0YA 3MB3A 5DLXA 4NR6A 5HEMA 5E9YA 4YAXA 4TS8A 5II2A 4HBWA 5EWHA 3O37A 4CUSA 1N72A 5FE8A 4AI6A 5I86A 2E7OA 5ENFA 5I83A 5C85A 5I80A 5HELA 2YQDA 4IOQA 2FSAA 5BT5A 3VKGA 3UV2A 4O7FA 5FFWA 1EQFA 4YADA 4MENA 2OSSA 4YH4A 4QEUA 4UYHA 5D3NA 4Z93A 5DYCA 2H60A 5A83A 4YYKA 3G0LA 2N9GA 1PUOA 4UYFB 4YYMA 5DFCA 5I89A 3S91A 5KO4A 4TYLA 5CQ6A 4UYEA 4YBSA 5H1UA 4WHUA 4QZSA 4HXNA 4TT4A 4NYWA 4XY9A 5FFYA 4YYGA 5D25A 4AKGA 5A5OA 3Q2EA 2E3KA 3D7CA 4O70A 4Z1SA 5JI8A 1ZKRA 4MR5A 5CZGA 3RCWA 5JWMA 5LJ0A 3UW9A 5EM3A 2D9EA 5IGKA 4QY4A 5EWDA 2RNYA 5E9MA 4O78A 4IR5A 5ENJA 5IBNA 2LSPB 4A9HA 3UVWA 4N4FA 4NR9A 5KHMA 5F1HA 3LXJA 5D24A 4X2IA 5DYXA 5EV9A 3U5JA 4QEVA 2RO1A 4O7BA 4A9KA 5KU3A 2YW5A 5BT4A 4A9MA 4BW2A 3VKHA 5FE5A 5CQAA 5ENGA 5LUUA 5EICA 3UV5A 5CUEA 5CS8A 5DKHA 5L99A 5F2PA 3D1BA 5EPBA 5A82A 4YK0A 4QSVA 5EQ1A 5EVAA 4YC9A 3TLPA 4UYFA 4QUUA 5II1A 5LKTA 4KV4A 4BJXA 2DWWA 4LZRA 4A9OA 5FG5A 4YYNA 5H1TA 4QR5A 5CFWA 2NXBA 5LKZA 2G4AA 4N4HA 4CUTA 5HM0A 4E96A 5ENIA 4LYSA 3P1CA 2DVQA 4NRAA 4LDFA 3P5OA 3UV4A 1ZS5A 5I40A 5HFRA 5CUGA 4A9IA 4HBVA 5CQ7A 4LR6A 4QR4A 5AD3A 3U5PA 4CUQA 4XUBA 4Q0NA 4J1PA 3ONIA 4C66A 4UIUA 5E73A 3UVXA 3P1FA 4C67A 4QB3A 5E9IA 4YBMA 4YBTA 4YYJA 4UIZA 5L8UA 3U5OA 2YELA 5CQ8A 2I7KA 4A9LA 5FBXA 4O77A 4IR6A 5FG4A 4N4IA 5FE9A 4YYDA 3JVMA 4BHWA 5EWCA 5F61A 5DKDA 4HXLA 5DFBA 3MULA 4A9JA 2DVSA 1WUMA 4Z1QA 5E9LA 5F3AA 4QC3A 4HBYA 4BW1A 5A81A 5DYAA 5LKUA 5I1QA 2L85A 4TU6A 4TU4A 4PY6A 4OGJA 5C7NA 2E7NA 2MJVB 2F6JA 4O7CA 3UVYA 3U5MA 5FB0A 5K29A 3P1EA 4LZ2A 4ZW1A 3Q2FA 2YYNA 4UIWA 3AQAA 3O34A 5HRVA 2L84A 4QSQA 2EJNA 5D3RA 5DW1A 3ZYUA 5KTWA 5FE0A 4MEPA 5A5PA 5EWWA 4A9EA 4OUFA 5F36A 5C4QA 5G4SA 5L8TA 3DAIA 4QNSA 2I8NA 4MEQA 4WIVA 4NRBA 2RFJA 4NR5A 5A5RA 5FH7A 3G0JA 4NS5A 5HQ5A 3O35A 4ALHA 4ZQLA 5HLSA 5F25A 5HRWA 3MXFA 4UIYA 2R0VA 5CP5A 4TZ8A 5EISA 3ERRA 4O74A 4HXRA 3P1DA 5FH6A 4WHWA 5F60A 5HFQA 4MR4A 4HXKA 4LZSA 5DLZA 5J0DA 4QSSA 5FE6A 2DVRA 2RI7A 5KTXA 5CY9A 3DWYA 3D1DA 5LJ1A 2WP1A 4AKIA 5FE1A 2DATA 5CU8A 4YATA 5EGUA 2KTBB 5E9VA 4O71A 4HBXA 4UYGA 4IR4A 4PCIA 5DBMA 3QZSA 1F68A 4UYDA 4N4GA 4QUTA 1E6IA 5TCMA 3HMEA 5EPRA 2RNWA 5DYUA 3MB4A 4NQNA 3LQIA 4LYIA 5E0RA 4IR3A 5ENBA 5ETDA 4HXSA 5HCLA 2YDWA 5C89A 5KTUA 5FG6A 5C87A 4YABA 4QSWA 5F1LA 3GG3A 4O75A 5A7CA 2RS9B 4GPJA 5EA1A 5E74A 4O76A 5FE3A 3LQJA 2OO1A 5LVRA 5D0CA 3IU6A 2DKWA 3MUKA 4N3WA 5ENCA 1JM4B 5EU1A 4MEOA 2RNXA 4O7EA 4NR4A 5DY7A 1X0JA 4TQNA 5COIA 4ALGA 5LVQA 5IGMA 4FLPA 4QSRA 4O7AA 5CRMA 4CUPA 4J0SA 3JVJA 4NYXA 5A5NA 3JVKA 3HMFA 5CPEA 3LJWA 5E9KA 4PTBA 4LRGA 3O33A 4TTEA 4YY6A 1WUGA 3LQHA 5G4RA 4Q0OA 5DW2A 5I29A 4MR6A 5ENHA 2GRCA 4NUCA 5FH8A 2R10A 4QEWA 4QC1A 4NQMA 4HXPA 5ENEA 5CTLA 4HXOA 4NYVA 5D3SA 5LJ2A 4QYLA 2D82A 3MQMA 2DVVA 4YH3A 5F63A 4TZ2A 4QR3A 5C8GA 3SVHA 5HRXA 5D26A 5FDZA 4XUAA 5EPSA 5FFVA 5A85A 3K2JA 5CUBA 3UVDA 1JSPB 4MR3A 5CUAA 3S92A 4PCEA 4AKHA 3SVFA 5HJCA 4NR8A 4CFKA 4A9NA 5CQ3A 4NRCA 4AKNA 5IGNA 2L5EA 4XY8A 4IORA 5CGPA 3U5NA 4DONA 5BT3A 4YYIA 5CQ5A 4F3IA 5HQ6A 5ACYA 4PS5A 5ETBA 5I88A 4KV1A 5A5SA 4A9FA 4Z6HA 4CURA 5EI4A 4KCXA 4BW4A 4BW3A 3U5KA 2WP2A 4RVRA 2YEKA 3FKMX 5H85A 4CFLA 4QYDA 3JVLA 5CUDA 5CRZA 5EK9A 3AADA 3IU5A 4J3IA 5F62A 4IOOA 5D3LA 5L98A 5DFDA 5TB6A 3I3JA 5CQTA 4YYHA 5DKCA 2R0SA 4Z6IA 4O72A 4OGIA 5DX4A 5E3DA 4QSTA 4CUUA 2F6NA 4NUDA 5AD2A 3SVGA 4TT6A 3QZTA 5D3HA 5IG6A 5I7XA 5E3GA 5L96A 5AMFA 3QZVA 5D3JA 3HMHA 4QSUA 4NUEA 4YY4A 4CL9A 4PKLA 4LYWA 5AMEA 5HENA 4TT2A 3U5LA 5IIDA 2YEMA 3O36A 5L97A 5FB1A 5IGLA 4HXMA 4CLBA 5FE2A 5CQ4A 5FE4A 4QSXA 5D7XA
chains in the Genus database with same CATH topology
5EWVA 4UITA 5H1VA 5EP7A 5LKXA 4QBMA 5I7YA 4UIXA 5HQ7A 4QSPA 4NXJA 4Y03A 5E7DA 4NR7A 4UIVA 5D3PA 4XYAA 5A5QA 3NXBA 2OUOA 4LC2A 5CUCA 5FE7A 5D3TA 5F5ZA 4ZC9A 4J0RA 2R0YA 3MB3A 5DLXA 4NR6A 5HEMA 5E9YA 4YAXA 4TS8A 5II2A 4HBWA 5EWHA 3O37A 4CUSA 1N72A 5FE8A 5I86A 2E7OA 5ENFA 5I83A 5C85A 5I80A 5HELA 2YQDA 4IOQA 2FSAA 5BT5A 3UV2A 4O7FA 5FFWA 1EQFA 4YADA 4MENA 2OSSA 4YH4A 4QEUA 4UYHA 4Z93A 5D3NA 5DYCA 2H60A 5A83A 4YYKA 3G0LA 2N9GA 4UYFB 4YYMA 5DFCA 5I89A 3S91A 5KO4A 4TYLA 5CQ6A 4UYEA 4YBSA 5H1UA 4WHUA 4QZSA 4HXNA 4TT4A 4NYWA 4XY9A 5FFYA 4YYGA 5D25A 5A5OA 3Q2EA 2E3KA 3D7CA 4O70A 4Z1SA 5JI8A 4MR5A 5CZGA 3RCWA 5JWMA 5LJ0A 3UW9A 5EM3A 2D9EA 5IGKA 4QY4A 5EWDA 2RNYA 5E9MA 4O78A 4IR5A 5ENJA 5IBNA 2LSPB 4A9HA 3UVWA 4N4FA 4NR9A 5KHMA 5F1HA 3LXJA 5D24A 4X2IA 5DYXA 5EV9A 3U5JA 4QEVA 2RO1A 4O7BA 4A9KA 5KU3A 2YW5A 5BT4A 4A9MA 4BW2A 5FE5A 5CQAA 5ENGA 5LUUA 5EICA 3UV5A 5CUEA 5CS8A 5DKHA 5L99A 5F2PA 5EPBA 5A82A 4YK0A 4QSVA 5EQ1A 5EVAA 4YC9A 3TLPA 4UYFA 4QUUA 5II1A 5LKTA 4KV4A 4BJXA 2DWWA 4LZRA 4A9OA 5FG5A 4YYNA 5H1TA 4QR5A 5CFWA 2NXBA 5LKZA 2G4AA 4N4HA 4CUTA 5HM0A 4E96A 5ENIA 4LYSA 3P1CA 2DVQA 4NRAA 4LDFA 3P5OA 3UV4A 1ZS5A 5I40A 5HFRA 5CUGA 4A9IA 4HBVA 5CQ7A 4LR6A 4QR4A 5AD3A 3U5PA 4CUQA 4XUBA 4Q0NA 4J1PA 3ONIA 4C66A 4UIUA 5E73A 3UVXA 3P1FA 4C67A 4QB3A 5E9IA 4YBMA 4YBTA 4YYJA 4UIZA 5L8UA 3U5OA 2YELA 5CQ8A 2I7KA 4A9LA 5FBXA 4O77A 4IR6A 5FG4A 4N4IA 5FE9A 4YYDA 3JVMA 4BHWA 5EWCA 5F61A 5DKDA 4HXLA 5DFBA 3MULA 4A9JA 2DVSA 1WUMA 4Z1QA 5E9LA 5F3AA 4QC3A 4HBYA 4BW1A 5A81A 5DYAA 5LKUA 5I1QA 2L85A 4TU6A 4TU4A 4PY6A 4OGJA 5C7NA 2E7NA 2MJVB 2F6JA 4O7CA 3UVYA 3U5MA 5FB0A 5K29A 3P1EA 4LZ2A 4ZW1A 3Q2FA 2YYNA 4UIWA 3AQAA 3O34A 5HRVA 2L84A 4QSQA 5D3RA 5DW1A 3ZYUA 5KTWA 5FE0A 4MEPA 5A5PA 5EWWA 4A9EA 4OUFA 5F36A 5C4QA 5G4SA 5L8TA 3DAIA 4QNSA 2I8NA 4MEQA 4WIVA 4NRBA 2RFJA 4NR5A 5A5RA 5FH7A 3G0JA 4NS5A 5HQ5A 3O35A 4ALHA 4ZQLA 5HLSA 5F25A 5HRWA 3MXFA 4UIYA 2R0VA 5CP5A 4TZ8A 5EISA 4O74A 4HXRA 3P1DA 5FH6A 4WHWA 5F60A 5HFQA 4MR4A 4HXKA 4LZSA 5DLZA 5J0DA 4QSSA 5FE6A 2DVRA 2RI7A 5KTXA 5CY9A 3DWYA 5LJ1A 2WP1A 5FE1A 2DATA 5CU8A 4YATA 5EGUA 2KTBB 5E9VA 4O71A 4HBXA 4UYGA 4IR4A 4PCIA 5DBMA 3QZSA 1F68A 4UYDA 4N4GA 4QUTA 1E6IA 5TCMA 3HMEA 5EPRA 2RNWA 5DYUA 3MB4A 4NQNA 3LQIA 4LYIA 5E0RA 4IR3A 5ENBA 5ETDA 4HXSA 5HCLA 2YDWA 5C89A 5KTUA 5FG6A 5C87A 4YABA 4QSWA 5F1LA 3GG3A 4O75A 5A7CA 2RS9B 4GPJA 5EA1A 5E74A 4O76A 5FE3A 3LQJA 2OO1A 5LVRA 5D0CA 3IU6A 2DKWA 3MUKA 4N3WA 5ENCA 1JM4B 5EU1A 4MEOA 2RNXA 4O7EA 4NR4A 5DY7A 1X0JA 4TQNA 5COIA 4ALGA 5LVQA 5IGMA 4FLPA 4QSRA 4O7AA 5CRMA 4CUPA 4J0SA 3JVJA 4NYXA 5A5NA 3JVKA 3HMFA 5CPEA 3LJWA 5E9KA 4PTBA 4LRGA 3O33A 4TTEA 4YY6A 1WUGA 3LQHA 5G4RA 4Q0OA 5DW2A 5I29A 4MR6A 5ENHA 2GRCA 4NUCA 5FH8A 2R10A 4QEWA 4QC1A 4NQMA 4HXPA 5ENEA 5CTLA 4HXOA 4NYVA 5D3SA 5LJ2A 4QYLA 2D82A 3MQMA 2DVVA 4YH3A 5F63A 4TZ2A 4QR3A 5C8GA 3SVHA 5HRXA 5D26A 5FDZA 4XUAA 5EPSA 5FFVA 5A85A 3K2JA 5CUBA 3UVDA 1JSPB 4MR3A 5CUAA 3S92A 4PCEA 3SVFA 5HJCA 4NR8A 4CFKA 4A9NA 5CQ3A 4NRCA 4AKNA 5IGNA 2L5EA 4XY8A 4IORA 5CGPA 3U5NA 4DONA 5BT3A 4YYIA 5CQ5A 4F3IA 5HQ6A 5ACYA 4PS5A 5ETBA 5I88A 4KV1A 5A5SA 4A9FA 4Z6HA 4CURA 5EI4A 4KCXA 4BW4A 4BW3A 3U5KA 2WP2A 4RVRA 2YEKA 3FKMX 5H85A 4CFLA 4QYDA 3JVLA 5CUDA 5CRZA 5EK9A 3AADA 3IU5A 4J3IA 5F62A 4IOOA 5D3LA 5L98A 5DFDA 5TB6A 3I3JA 5CQTA 4YYHA 5DKCA 2R0SA 4Z6IA 4O72A 4OGIA 5DX4A 5E3DA 4QSTA 4CUUA 2F6NA 4NUDA 5AD2A 3SVGA 4TT6A 3QZTA 5D3HA 5IG6A 5I7XA 5E3GA 5L96A 5AMFA 3QZVA 5D3JA 3HMHA 4QSUA 4NUEA 4YY4A 4CL9A 4PKLA 4LYWA 5AMEA 5HENA 4TT2A 3U5LA 5IIDA 2YEMA 3O36A 5L97A 5FB1A 5IGLA 4HXMA 4CLBA 5FE2A 5CQ4A 5FE4A 4QSXA 5D7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWV A;  4UIT A;  5H1V A;  5EP7 A;  5LKX A;  4QBM A;  5I7Y A;  4UIX A;  5HQ7 A;  4QSP A;  4NXJ A;  4Y03 A;  5E7D A;  4NR7 A;  4UIV A;  5D3P A;  4XYA A;  5A5Q A;  3NXB A;  2OUO A;  4LC2 A;  5CUC A;  5FE7 A;  5D3T A;  5F5Z A;  4ZC9 A;  4J0R A;  2R0Y A;  3MB3 A;  5DLX A;  4NR6 A;  5HEM A;  5E9Y A;  4YAX A;  4TS8 A;  5II2 A;  4HBW A;  5EWH A;  3O37 A;  4CUS A;  1N72 A;  5FE8 A;  5I86 A;  2E7O A;  5ENF A;  5I83 A;  5C85 A;  5I80 A;  5HEL A;  2YQD A;  4IOQ A;  2FSA A;  5BT5 A;  3UV2 A;  4O7F A;  5FFW A;  1EQF A;  4YAD A;  4MEN A;  2OSS A;  4YH4 A;  4QEU A;  4UYH A;  4Z93 A;  5D3N A;  5DYC A;  2H60 A;  5A83 A;  4YYK A;  3G0L A;  2N9G A;  4UYF B;  4YYM A;  5DFC A;  5I89 A;  3S91 A;  5KO4 A;  4TYL A;  5CQ6 A;  4UYE A;  4YBS A;  5H1U A;  4WHU A;  4QZS A;  4HXN A;  4TT4 A;  4NYW A;  4XY9 A;  5FFY A;  4YYG A;  5D25 A;  5A5O A;  3Q2E A;  2E3K A;  3D7C A;  4O70 A;  4Z1S A;  5JI8 A;  4MR5 A;  5CZG A;  3RCW A;  5JWM A;  5LJ0 A;  3UW9 A;  5EM3 A;  2D9E A;  5IGK A;  4QY4 A;  5EWD A;  2RNY A;  5E9M A;  4O78 A;  4IR5 A;  5ENJ A;  5IBN A;  2LSP B;  4A9H A;  3UVW A;  4N4F A;  4NR9 A;  5KHM A;  5F1H A;  3LXJ A;  5D24 A;  4X2I A;  5DYX A;  5EV9 A;  3U5J A;  4QEV A;  2RO1 A;  4O7B A;  4A9K A;  5KU3 A;  2YW5 A;  5BT4 A;  4A9M A;  4BW2 A;  5FE5 A;  5CQA A;  5ENG A;  5LUU A;  5EIC A;  3UV5 A;  5CUE A;  5CS8 A;  5DKH A;  5L99 A;  5F2P A;  5EPB A;  5A82 A;  4YK0 A;  4QSV A;  5EQ1 A;  5EVA A;  4YC9 A;  3TLP A;  4UYF A;  4QUU A;  5II1 A;  5LKT A;  4KV4 A;  4BJX A;  2DWW A;  4LZR A;  4A9O A;  5FG5 A;  4YYN A;  5H1T A;  4QR5 A;  5CFW A;  2NXB A;  5LKZ A;  2G4A A;  4N4H A;  4CUT A;  5HM0 A;  4E96 A;  5ENI A;  4LYS A;  3P1C A;  2DVQ A;  4NRA A;  4LDF A;  3P5O A;  3UV4 A;  1ZS5 A;  5I40 A;  5HFR A;  5CUG A;  4A9I A;  4HBV A;  5CQ7 A;  4LR6 A;  4QR4 A;  5AD3 A;  3U5P A;  4CUQ A;  4XUB A;  4Q0N A;  4J1P A;  3ONI A;  4C66 A;  4UIU A;  5E73 A;  3UVX A;  3P1F A;  4C67 A;  4QB3 A;  5E9I A;  4YBM A;  4YBT A;  4YYJ A;  4UIZ A;  5L8U A;  3U5O A;  2YEL A;  5CQ8 A;  2I7K A;  4A9L A;  5FBX A;  4O77 A;  4IR6 A;  5FG4 A;  4N4I A;  5FE9 A;  4YYD A;  3JVM A;  4BHW A;  5EWC A;  5F61 A;  5DKD A;  4HXL A;  5DFB A;  3MUL A;  4A9J A;  2DVS A;  1WUM A;  4Z1Q A;  5E9L A;  5F3A A;  4QC3 A;  4HBY A;  4BW1 A;  5A81 A;  5DYA A;  5LKU A;  5I1Q A;  2L85 A;  4TU6 A;  4TU4 A;  4PY6 A;  4OGJ A;  5C7N A;  2E7N A;  2MJV B;  2F6J A;  4O7C A;  3UVY A;  3U5M A;  5FB0 A;  5K29 A;  3P1E A;  4LZ2 A;  4ZW1 A;  3Q2F A;  2YYN A;  4UIW A;  3AQA A;  3O34 A;  5HRV A;  2L84 A;  4QSQ A;  5D3R A;  5DW1 A;  3ZYU A;  5KTW A;  5FE0 A;  4MEP A;  5A5P A;  5EWW A;  4A9E A;  4OUF A;  5F36 A;  5C4Q A;  5G4S A;  5L8T A;  3DAI A;  4QNS A;  2I8N A;  4MEQ A;  4WIV A;  4NRB A;  2RFJ A;  4NR5 A;  5A5R A;  5FH7 A;  3G0J A;  4NS5 A;  5HQ5 A;  3O35 A;  4ALH A;  4ZQL A;  5HLS A;  5F25 A;  5HRW A;  3MXF A;  4UIY A;  2R0V A;  5CP5 A;  4TZ8 A;  5EIS A;  4O74 A;  4HXR A;  3P1D A;  5FH6 A;  4WHW A;  5F60 A;  5HFQ A;  4MR4 A;  4HXK A;  4LZS A;  5DLZ A;  5J0D A;  4QSS A;  5FE6 A;  2DVR A;  2RI7 A;  5KTX A;  5CY9 A;  3DWY A;  5LJ1 A;  2WP1 A;  5FE1 A;  2DAT A;  5CU8 A;  4YAT A;  5EGU A;  2KTB B;  5E9V A;  4O71 A;  4HBX A;  4UYG A;  4IR4 A;  4PCI A;  5DBM A;  3QZS A;  1F68 A;  4UYD A;  4N4G A;  4QUT A;  1E6I A;  5TCM A;  3HME A;  5EPR A;  2RNW A;  5DYU A;  3MB4 A;  4NQN A;  3LQI A;  4LYI A;  5E0R A;  4IR3 A;  5ENB A;  5ETD A;  4HXS A;  5HCL A;  2YDW A;  5C89 A;  5KTU A;  5FG6 A;  5C87 A;  4YAB A;  4QSW A;  5F1L A;  3GG3 A;  4O75 A;  5A7C A;  2RS9 B;  4GPJ A;  5EA1 A;  5E74 A;  4O76 A;  5FE3 A;  3LQJ A;  2OO1 A;  5LVR A;  5D0C A;  3IU6 A;  2DKW A;  3MUK A;  4N3W A;  5ENC A;  1JM4 B;  5EU1 A;  4MEO A;  2RNX A;  4O7E A;  4NR4 A;  5DY7 A;  1X0J A;  4TQN A;  5COI A;  4ALG A;  5LVQ A;  5IGM A;  4FLP A;  4QSR A;  4O7A A;  5CRM A;  4CUP A;  4J0S A;  3JVJ A;  4NYX A;  5A5N A;  3JVK A;  3HMF A;  5CPE A;  3LJW A;  5E9K A;  4PTB A;  4LRG A;  3O33 A;  4TTE A;  4YY6 A;  1WUG A;  3LQH A;  5G4R A;  4Q0O A;  5DW2 A;  5I29 A;  4MR6 A;  5ENH A;  2GRC A;  4NUC A;  5FH8 A;  2R10 A;  4QEW A;  4QC1 A;  4NQM A;  4HXP A;  5ENE A;  5CTL A;  4HXO A;  4NYV A;  5D3S A;  5LJ2 A;  4QYL A;  2D82 A;  3MQM A;  2DVV A;  4YH3 A;  5F63 A;  4TZ2 A;  4QR3 A;  5C8G A;  3SVH A;  5HRX A;  5D26 A;  5FDZ A;  4XUA A;  5EPS A;  5FFV A;  5A85 A;  3K2J A;  5CUB A;  3UVD A;  1JSP B;  4MR3 A;  5CUA A;  3S92 A;  4PCE A;  3SVF A;  5HJC A;  4NR8 A;  4CFK A;  4A9N A;  5CQ3 A;  4NRC A;  4AKN A;  5IGN A;  2L5E A;  4XY8 A;  4IOR A;  5CGP A;  3U5N A;  4DON A;  5BT3 A;  4YYI A;  5CQ5 A;  4F3I A;  5HQ6 A;  5ACY A;  4PS5 A;  5ETB A;  5I88 A;  4KV1 A;  5A5S A;  4A9F A;  4Z6H A;  4CUR A;  5EI4 A;  4KCX A;  4BW4 A;  4BW3 A;  3U5K A;  2WP2 A;  4RVR A;  2YEK A;  3FKM X;  5H85 A;  4CFL A;  4QYD A;  3JVL A;  5CUD A;  5CRZ A;  5EK9 A;  3AAD A;  3IU5 A;  4J3I A;  5F62 A;  4IOO A;  5D3L A;  5L98 A;  5DFD A;  5TB6 A;  3I3J A;  5CQT A;  4YYH A;  5DKC A;  2R0S A;  4Z6I A;  4O72 A;  4OGI A;  5DX4 A;  5E3D A;  4QST A;  4CUU A;  2F6N A;  4NUD A;  5AD2 A;  3SVG A;  4TT6 A;  3QZT A;  5D3H A;  5IG6 A;  5I7X A;  5E3G A;  5L96 A;  5AMF A;  3QZV A;  5D3J A;  3HMH A;  4QSU A;  4NUE A;  4YY4 A;  4CL9 A;  4PKL A;  4LYW A;  5AME A;  5HEN A;  4TT2 A;  3U5L A;  5IID A;  2YEM A;  3O36 A;  5L97 A;  5FB1 A;  5IGL A;  4HXM A;  4CLB A;  5FE2 A;  5CQ4 A;  5FE4 A;  4QSX A;  5D7X A; 
#chains in the Genus database with same CATH topology
 5EWV A;  4UIT A;  5H1V A;  5EP7 A;  5LKX A;  4QBM A;  5I7Y A;  4UIX A;  5HQ7 A;  4QSP A;  4NXJ A;  4Y03 A;  5E7D A;  4NR7 A;  4UIV A;  5D3P A;  4XYA A;  5A5Q A;  3NXB A;  2OUO A;  4LC2 A;  5CUC A;  5FE7 A;  5D3T A;  5F5Z A;  4ZC9 A;  4J0R A;  2R0Y A;  3MB3 A;  5DLX A;  4NR6 A;  5HEM A;  5E9Y A;  4YAX A;  4TS8 A;  5II2 A;  4HBW A;  5EWH A;  3O37 A;  4CUS A;  1N72 A;  5FE8 A;  4AI6 A;  5I86 A;  2E7O A;  5ENF A;  5I83 A;  5C85 A;  5I80 A;  5HEL A;  2YQD A;  4IOQ A;  2FSA A;  5BT5 A;  3VKG A;  3UV2 A;  4O7F A;  5FFW A;  1EQF A;  4YAD A;  4MEN A;  2OSS A;  4YH4 A;  4QEU A;  4UYH A;  5D3N A;  4Z93 A;  5DYC A;  2H60 A;  5A83 A;  4YYK A;  3G0L A;  2N9G A;  1PUO A;  4UYF B;  4YYM A;  5DFC A;  5I89 A;  3S91 A;  5KO4 A;  4TYL A;  5CQ6 A;  4UYE A;  4YBS A;  5H1U A;  4WHU A;  4QZS A;  4HXN A;  4TT4 A;  4NYW A;  4XY9 A;  5FFY A;  4YYG A;  5D25 A;  4AKG A;  5A5O A;  3Q2E A;  2E3K A;  3D7C A;  4O70 A;  4Z1S A;  5JI8 A;  1ZKR A;  4MR5 A;  5CZG A;  3RCW A;  5JWM A;  5LJ0 A;  3UW9 A;  5EM3 A;  2D9E A;  5IGK A;  4QY4 A;  5EWD A;  2RNY A;  5E9M A;  4O78 A;  4IR5 A;  5ENJ A;  5IBN A;  2LSP B;  4A9H A;  3UVW A;  4N4F A;  4NR9 A;  5KHM A;  5F1H A;  3LXJ A;  5D24 A;  4X2I A;  5DYX A;  5EV9 A;  3U5J A;  4QEV A;  2RO1 A;  4O7B A;  4A9K A;  5KU3 A;  2YW5 A;  5BT4 A;  4A9M A;  4BW2 A;  3VKH A;  5FE5 A;  5CQA A;  5ENG A;  5LUU A;  5EIC A;  3UV5 A;  5CUE A;  5CS8 A;  5DKH A;  5L99 A;  5F2P A;  3D1B A;  5EPB A;  5A82 A;  4YK0 A;  4QSV A;  5EQ1 A;  5EVA A;  4YC9 A;  3TLP A;  4UYF A;  4QUU A;  5II1 A;  5LKT A;  4KV4 A;  4BJX A;  2DWW A;  4LZR A;  4A9O A;  5FG5 A;  4YYN A;  5H1T A;  4QR5 A;  5CFW A;  2NXB A;  5LKZ A;  2G4A A;  4N4H A;  4CUT A;  5HM0 A;  4E96 A;  5ENI A;  4LYS A;  3P1C A;  2DVQ A;  4NRA A;  4LDF A;  3P5O A;  3UV4 A;  1ZS5 A;  5I40 A;  5HFR A;  5CUG A;  4A9I A;  4HBV A;  5CQ7 A;  4LR6 A;  4QR4 A;  5AD3 A;  3U5P A;  4CUQ A;  4XUB A;  4Q0N A;  4J1P A;  3ONI A;  4C66 A;  4UIU A;  5E73 A;  3UVX A;  3P1F A;  4C67 A;  4QB3 A;  5E9I A;  4YBM A;  4YBT A;  4YYJ A;  4UIZ A;  5L8U A;  3U5O A;  2YEL A;  5CQ8 A;  2I7K A;  4A9L A;  5FBX A;  4O77 A;  4IR6 A;  5FG4 A;  4N4I A;  5FE9 A;  4YYD A;  3JVM A;  4BHW A;  5EWC A;  5F61 A;  5DKD A;  4HXL A;  5DFB A;  3MUL A;  4A9J A;  2DVS A;  1WUM A;  4Z1Q A;  5E9L A;  5F3A A;  4QC3 A;  4HBY A;  4BW1 A;  5A81 A;  5DYA A;  5LKU A;  5I1Q A;  2L85 A;  4TU6 A;  4TU4 A;  4PY6 A;  4OGJ A;  5C7N A;  2E7N A;  2MJV B;  2F6J A;  4O7C A;  3UVY A;  3U5M A;  5FB0 A;  5K29 A;  3P1E A;  4LZ2 A;  4ZW1 A;  3Q2F A;  2YYN A;  4UIW A;  3AQA A;  3O34 A;  5HRV A;  2L84 A;  4QSQ A;  2EJN A;  5D3R A;  5DW1 A;  3ZYU A;  5KTW A;  5FE0 A;  4MEP A;  5A5P A;  5EWW A;  4A9E A;  4OUF A;  5F36 A;  5C4Q A;  5G4S A;  5L8T A;  3DAI A;  4QNS A;  2I8N A;  4MEQ A;  4WIV A;  4NRB A;  2RFJ A;  4NR5 A;  5A5R A;  5FH7 A;  3G0J A;  4NS5 A;  5HQ5 A;  3O35 A;  4ALH A;  4ZQL A;  5HLS A;  5F25 A;  5HRW A;  3MXF A;  4UIY A;  2R0V A;  5CP5 A;  4TZ8 A;  5EIS A;  3ERR A;  4O74 A;  4HXR A;  3P1D A;  5FH6 A;  4WHW A;  5F60 A;  5HFQ A;  4MR4 A;  4HXK A;  4LZS A;  5DLZ A;  5J0D A;  4QSS A;  5FE6 A;  2DVR A;  2RI7 A;  5KTX A;  5CY9 A;  3DWY A;  3D1D A;  5LJ1 A;  2WP1 A;  4AKI A;  5FE1 A;  2DAT A;  5CU8 A;  4YAT A;  5EGU A;  2KTB B;  5E9V A;  4O71 A;  4HBX A;  4UYG A;  4IR4 A;  4PCI A;  5DBM A;  3QZS A;  1F68 A;  4UYD A;  4N4G A;  4QUT A;  1E6I A;  5TCM A;  3HME A;  5EPR A;  2RNW A;  5DYU A;  3MB4 A;  4NQN A;  3LQI A;  4LYI A;  5E0R A;  4IR3 A;  5ENB A;  5ETD A;  4HXS A;  5HCL A;  2YDW A;  5C89 A;  5KTU A;  5FG6 A;  5C87 A;  4YAB A;  4QSW A;  5F1L A;  3GG3 A;  4O75 A;  5A7C A;  2RS9 B;  4GPJ A;  5EA1 A;  5E74 A;  4O76 A;  5FE3 A;  3LQJ A;  2OO1 A;  5LVR A;  5D0C A;  3IU6 A;  2DKW A;  3MUK A;  4N3W A;  5ENC A;  1JM4 B;  5EU1 A;  4MEO A;  2RNX A;  4O7E A;  4NR4 A;  5DY7 A;  1X0J A;  4TQN A;  5COI A;  4ALG A;  5LVQ A;  5IGM A;  4FLP A;  4QSR A;  4O7A A;  5CRM A;  4CUP A;  4J0S A;  3JVJ A;  4NYX A;  5A5N A;  3JVK A;  3HMF A;  5CPE A;  3LJW A;  5E9K A;  4PTB A;  4LRG A;  3O33 A;  4TTE A;  4YY6 A;  1WUG A;  3LQH A;  5G4R A;  4Q0O A;  5DW2 A;  5I29 A;  4MR6 A;  5ENH A;  2GRC A;  4NUC A;  5FH8 A;  2R10 A;  4QEW A;  4QC1 A;  4NQM A;  4HXP A;  5ENE A;  5CTL A;  4HXO A;  4NYV A;  5D3S A;  5LJ2 A;  4QYL A;  2D82 A;  3MQM A;  2DVV A;  4YH3 A;  5F63 A;  4TZ2 A;  4QR3 A;  5C8G A;  3SVH A;  5HRX A;  5D26 A;  5FDZ A;  4XUA A;  5EPS A;  5FFV A;  5A85 A;  3K2J A;  5CUB A;  3UVD A;  1JSP B;  4MR3 A;  5CUA A;  3S92 A;  4PCE A;  4AKH A;  3SVF A;  5HJC A;  4NR8 A;  4CFK A;  4A9N A;  5CQ3 A;  4NRC A;  4AKN A;  5IGN A;  2L5E A;  4XY8 A;  4IOR A;  5CGP A;  3U5N A;  4DON A;  5BT3 A;  4YYI A;  5CQ5 A;  4F3I A;  5HQ6 A;  5ACY A;  4PS5 A;  5ETB A;  5I88 A;  4KV1 A;  5A5S A;  4A9F A;  4Z6H A;  4CUR A;  5EI4 A;  4KCX A;  4BW4 A;  4BW3 A;  3U5K A;  2WP2 A;  4RVR A;  2YEK A;  3FKM X;  5H85 A;  4CFL A;  4QYD A;  3JVL A;  5CUD A;  5CRZ A;  5EK9 A;  3AAD A;  3IU5 A;  4J3I A;  5F62 A;  4IOO A;  5D3L A;  5L98 A;  5DFD A;  5TB6 A;  3I3J A;  5CQT A;  4YYH A;  5DKC A;  2R0S A;  4Z6I A;  4O72 A;  4OGI A;  5DX4 A;  5E3D A;  4QST A;  4CUU A;  2F6N A;  4NUD A;  5AD2 A;  3SVG A;  4TT6 A;  3QZT A;  5D3H A;  5IG6 A;  5I7X A;  5E3G A;  5L96 A;  5AMF A;  3QZV A;  5D3J A;  3HMH A;  4QSU A;  4NUE A;  4YY4 A;  4CL9 A;  4PKL A;  4LYW A;  5AME A;  5HEN A;  4TT2 A;  3U5L A;  5IID A;  2YEM A;  3O36 A;  5L97 A;  5FB1 A;  5IGL A;  4HXM A;  4CLB A;  5FE2 A;  5CQ4 A;  5FE4 A;  4QSX A;  5D7X A; 
#chains in the Genus database with same CATH homology
 5EWV A;  4UIT A;  5H1V A;  5EP7 A;  5LKX A;  4QBM A;  5I7Y A;  4UIX A;  5HQ7 A;  4QSP A;  4NXJ A;  4Y03 A;  5E7D A;  4NR7 A;  4UIV A;  5D3P A;  4XYA A;  5A5Q A;  3NXB A;  2OUO A;  4LC2 A;  5CUC A;  5FE7 A;  5D3T A;  5F5Z A;  4ZC9 A;  4J0R A;  2R0Y A;  3MB3 A;  5DLX A;  4NR6 A;  5HEM A;  5E9Y A;  4YAX A;  4TS8 A;  5II2 A;  4HBW A;  5EWH A;  3O37 A;  4CUS A;  1N72 A;  5FE8 A;  5I86 A;  2E7O A;  5ENF A;  5I83 A;  5C85 A;  5I80 A;  5HEL A;  2YQD A;  4IOQ A;  2FSA A;  5BT5 A;  3UV2 A;  4O7F A;  5FFW A;  1EQF A;  4YAD A;  4MEN A;  2OSS A;  4YH4 A;  4QEU A;  4UYH A;  4Z93 A;  5D3N A;  5DYC A;  2H60 A;  5A83 A;  4YYK A;  3G0L A;  2N9G A;  4UYF B;  4YYM A;  5DFC A;  5I89 A;  3S91 A;  5KO4 A;  4TYL A;  5CQ6 A;  4UYE A;  4YBS A;  5H1U A;  4WHU A;  4QZS A;  4HXN A;  4TT4 A;  4NYW A;  4XY9 A;  5FFY A;  4YYG A;  5D25 A;  5A5O A;  3Q2E A;  2E3K A;  3D7C A;  4O70 A;  4Z1S A;  5JI8 A;  4MR5 A;  5CZG A;  3RCW A;  5JWM A;  5LJ0 A;  3UW9 A;  5EM3 A;  2D9E A;  5IGK A;  4QY4 A;  5EWD A;  2RNY A;  5E9M A;  4O78 A;  4IR5 A;  5ENJ A;  5IBN A;  2LSP B;  4A9H A;  3UVW A;  4N4F A;  4NR9 A;  5KHM A;  5F1H A;  3LXJ A;  5D24 A;  4X2I A;  5DYX A;  5EV9 A;  3U5J A;  4QEV A;  2RO1 A;  4O7B A;  4A9K A;  5KU3 A;  2YW5 A;  5BT4 A;  4A9M A;  4BW2 A;  5FE5 A;  5CQA A;  5ENG A;  5LUU A;  5EIC A;  3UV5 A;  5CUE A;  5CS8 A;  5DKH A;  5L99 A;  5F2P A;  5EPB A;  5A82 A;  4YK0 A;  4QSV A;  5EQ1 A;  5EVA A;  4YC9 A;  3TLP A;  4UYF A;  4QUU A;  5II1 A;  5LKT A;  4KV4 A;  4BJX A;  2DWW A;  4LZR A;  4A9O A;  5FG5 A;  4YYN A;  5H1T A;  4QR5 A;  5CFW A;  2NXB A;  5LKZ A;  2G4A A;  4N4H A;  4CUT A;  5HM0 A;  4E96 A;  5ENI A;  4LYS A;  3P1C A;  2DVQ A;  4NRA A;  4LDF A;  3P5O A;  3UV4 A;  1ZS5 A;  5I40 A;  5HFR A;  5CUG A;  4A9I A;  4HBV A;  5CQ7 A;  4LR6 A;  4QR4 A;  5AD3 A;  3U5P A;  4CUQ A;  4XUB A;  4Q0N A;  4J1P A;  3ONI A;  4C66 A;  4UIU A;  5E73 A;  3UVX A;  3P1F A;  4C67 A;  4QB3 A;  5E9I A;  4YBM A;  4YBT A;  4YYJ A;  4UIZ A;  5L8U A;  3U5O A;  2YEL A;  5CQ8 A;  2I7K A;  4A9L A;  5FBX A;  4O77 A;  4IR6 A;  5FG4 A;  4N4I A;  5FE9 A;  4YYD A;  3JVM A;  4BHW A;  5EWC A;  5F61 A;  5DKD A;  4HXL A;  5DFB A;  3MUL A;  4A9J A;  2DVS A;  1WUM A;  4Z1Q A;  5E9L A;  5F3A A;  4QC3 A;  4HBY A;  4BW1 A;  5A81 A;  5DYA A;  5LKU A;  5I1Q A;  2L85 A;  4TU6 A;  4TU4 A;  4PY6 A;  4OGJ A;  5C7N A;  2E7N A;  2MJV B;  2F6J A;  4O7C A;  3UVY A;  3U5M A;  5FB0 A;  5K29 A;  3P1E A;  4LZ2 A;  4ZW1 A;  3Q2F A;  2YYN A;  4UIW A;  3AQA A;  3O34 A;  5HRV A;  2L84 A;  4QSQ A;  5D3R A;  5DW1 A;  3ZYU A;  5KTW A;  5FE0 A;  4MEP A;  5A5P A;  5EWW A;  4A9E A;  4OUF A;  5F36 A;  5C4Q A;  5G4S A;  5L8T A;  3DAI A;  4QNS A;  2I8N A;  4MEQ A;  4WIV A;  4NRB A;  2RFJ A;  4NR5 A;  5A5R A;  5FH7 A;  3G0J A;  4NS5 A;  5HQ5 A;  3O35 A;  4ALH A;  4ZQL A;  5HLS A;  5F25 A;  5HRW A;  3MXF A;  4UIY A;  2R0V A;  5CP5 A;  4TZ8 A;  5EIS A;  4O74 A;  4HXR A;  3P1D A;  5FH6 A;  4WHW A;  5F60 A;  5HFQ A;  4MR4 A;  4HXK A;  4LZS A;  5DLZ A;  5J0D A;  4QSS A;  5FE6 A;  2DVR A;  2RI7 A;  5KTX A;  5CY9 A;  3DWY A;  5LJ1 A;  2WP1 A;  5FE1 A;  2DAT A;  5CU8 A;  4YAT A;  5EGU A;  2KTB B;  5E9V A;  4O71 A;  4HBX A;  4UYG A;  4IR4 A;  4PCI A;  5DBM A;  3QZS A;  1F68 A;  4UYD A;  4N4G A;  4QUT A;  1E6I A;  5TCM A;  3HME A;  5EPR A;  2RNW A;  5DYU A;  3MB4 A;  4NQN A;  3LQI A;  4LYI A;  5E0R A;  4IR3 A;  5ENB A;  5ETD A;  4HXS A;  5HCL A;  2YDW A;  5C89 A;  5KTU A;  5FG6 A;  5C87 A;  4YAB A;  4QSW A;  5F1L A;  3GG3 A;  4O75 A;  5A7C A;  2RS9 B;  4GPJ A;  5EA1 A;  5E74 A;  4O76 A;  5FE3 A;  3LQJ A;  2OO1 A;  5LVR A;  5D0C A;  3IU6 A;  2DKW A;  3MUK A;  4N3W A;  5ENC A;  1JM4 B;  5EU1 A;  4MEO A;  2RNX A;  4O7E A;  4NR4 A;  5DY7 A;  1X0J A;  4TQN A;  5COI A;  4ALG A;  5LVQ A;  5IGM A;  4FLP A;  4QSR A;  4O7A A;  5CRM A;  4CUP A;  4J0S A;  3JVJ A;  4NYX A;  5A5N A;  3JVK A;  3HMF A;  5CPE A;  3LJW A;  5E9K A;  4PTB A;  4LRG A;  3O33 A;  4TTE A;  4YY6 A;  1WUG A;  3LQH A;  5G4R A;  4Q0O A;  5DW2 A;  5I29 A;  4MR6 A;  5ENH A;  2GRC A;  4NUC A;  5FH8 A;  2R10 A;  4QEW A;  4QC1 A;  4NQM A;  4HXP A;  5ENE A;  5CTL A;  4HXO A;  4NYV A;  5D3S A;  5LJ2 A;  4QYL A;  2D82 A;  3MQM A;  2DVV A;  4YH3 A;  5F63 A;  4TZ2 A;  4QR3 A;  5C8G A;  3SVH A;  5HRX A;  5D26 A;  5FDZ A;  4XUA A;  5EPS A;  5FFV A;  5A85 A;  3K2J A;  5CUB A;  3UVD A;  1JSP B;  4MR3 A;  5CUA A;  3S92 A;  4PCE A;  3SVF A;  5HJC A;  4NR8 A;  4CFK A;  4A9N A;  5CQ3 A;  4NRC A;  4AKN A;  5IGN A;  2L5E A;  4XY8 A;  4IOR A;  5CGP A;  3U5N A;  4DON A;  5BT3 A;  4YYI A;  5CQ5 A;  4F3I A;  5HQ6 A;  5ACY A;  4PS5 A;  5ETB A;  5I88 A;  4KV1 A;  5A5S A;  4A9F A;  4Z6H A;  4CUR A;  5EI4 A;  4KCX A;  4BW4 A;  4BW3 A;  3U5K A;  2WP2 A;  4RVR A;  2YEK A;  3FKM X;  5H85 A;  4CFL A;  4QYD A;  3JVL A;  5CUD A;  5CRZ A;  5EK9 A;  3AAD A;  3IU5 A;  4J3I A;  5F62 A;  4IOO A;  5D3L A;  5L98 A;  5DFD A;  5TB6 A;  3I3J A;  5CQT A;  4YYH A;  5DKC A;  2R0S A;  4Z6I A;  4O72 A;  4OGI A;  5DX4 A;  5E3D A;  4QST A;  4CUU A;  2F6N A;  4NUD A;  5AD2 A;  3SVG A;  4TT6 A;  3QZT A;  5D3H A;  5IG6 A;  5I7X A;  5E3G A;  5L96 A;  5AMF A;  3QZV A;  5D3J A;  3HMH A;  4QSU A;  4NUE A;  4YY4 A;  4CL9 A;  4PKL A;  4LYW A;  5AME A;  5HEN A;  4TT2 A;  3U5L A;  5IID A;  2YEM A;  3O36 A;  5L97 A;  5FB1 A;  5IGL A;  4HXM A;  4CLB A;  5FE2 A;  5CQ4 A;  5FE4 A;  4QSX A;  5D7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...