5DYCA

Crystal structure of the human brpf1 bromodomain in complex with seed6
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5dycA00
4N4IA 5CUEA 2FSAA 5I89A 4IR3A 4GPJA 5D7XA 4YBSA 3QZVA 2RI7A 4O71A 5EP7A 5L97A 4IOQA 2RNWA 2I8NA 5D3RA 5E7DA 5FE3A 2F6NA 5FBXA 5HELA 5IGLA 4YYMA 4NR4A 3O36A 4TT2A 5COIA 5DLXA 3S92A 4TZ8A 4QSQA 4QBMA 4QSUA 5CQ8A 5BT4A 4PS5A 5DKDA 5DFBA 3HMFA 5DYCA 4WHWA 4KV1A 4N4GA 4PTBA 3TLPA 3UVDA 3P1CA 4CURA 2RFJA 5L8TA 2RS9B 5D3HA 2D82A 5HQ5A 4QSTA 5E74A 4MEPA 4NUEA 4YYHA 5E9MA 1WUGA 4QEVA 5DBMA 4Z6HA 5D3LA 4Q0NA 4A9HA 4A9FA 3UV4A 5H1VA 5CUDA 4O70A 5LJ0A 5IBNA 5I83A 3Q2FA 5A83A 1EQFA 4QY4A 4NYWA 4TS8A 5F25A 1ZS5A 5HM0A 4TYLA 5CQ6A 5FH8A 5I88A 4IR4A 5HQ7A 5C87A 5A5NA 5HFQA 3UVXA 4J0RA 5CRMA 5HCLA 4HBWA 5FH7A 5CY9A 4UYGA 3JVKA 5DYAA 2E3KA 5EI4A 5E9KA 5F5ZA 4CUUA 4MEOA 4IOOA 4UYDA 4E96A 4WHUA 2R0SA 5FE9A 5D24A 4XUBA 5LVRA 4NRCA 5CZGA 3S91A 4FLPA 5G4RA 5A5OA 5F3AA 2WP1A 5I86A 4HXOA 4TT6A 4YK0A 4O7FA 2MJVB 3O34A 5HLSA 4UIUA 5ENFA 4ZQLA 4QSVA 3QZSA 3U5JA 5F36A 3JVJA 5HEMA 5A81A 2OUOA 5E9YA 5IIDA 2E7OA 4NR9A 5EPBA 5AD3A 4QEUA 3DWYA 5ENCA 5TCMA 5C85A 5IGKA 4PY6A 4J0SA 4LRGA 4OGJA 5EPRA 5C89A 5IGMA 5D25A 5KO4A 4N3WA 4QR4A 4QR3A 5FE0A 5F1LA 4QSPA 5ENBA 2DATA 3IU6A 4MR5A 5DKHA 5LJ1A 4CUSA 4MR6A 4QSXA 5CTLA 4O7CA 4HXKA 3HMHA 3U5OA 5JWMA 2DVQA 4TZ2A 2D9EA 5DYXA 5FG4A 5LJ2A 4YBTA 5E3GA 5FE8A 5H1UA 5ENHA 2L85A 5D3JA 5CS8A 4CUQA 5E9VA 5IG6A 5AD2A 3JVLA 5HRWA 5I29A 4A9JA 2N9GA 4QC1A 5LKUA 4NR7A 5CQ3A 4Y03A 2R0YA 4CFKA 4A9OA 3O33A 5LKZA 5FE5A 4QSWA 4XY8A 5HRVA 5FG6A 4NR8A 5CUGA 5CU8A 5F63A 4A9NA 4BW3A 4NQNA 5FFYA 5D0CA 5CP5A 5FG5A 2LSPB 4A9IA 4YC9A 4YADA 4Z1QA 4YY6A 4O74A 3NXBA 4UYHA 4NRAA 5DFDA 5CUAA 4UYEA 4QEWA 2F6JA 4QB3A 4CL9A 5I7XA 2E7NA 5LKTA 5G4SA 5E9IA 5ACYA 4KV4A 2WP2A 5D3PA 1JM4B 5D26A 5HJCA 4CUPA 5ETBA 3SVHA 4CFLA 2R0VA 3U5NA 3O35A 4IORA 5FE6A 5FB0A 4CUTA 5E3DA 4QYLA 4YYGA 4O72A 5E9LA 4BJXA 4NXJA 4PCEA 3UW9A 2I7KA 4O78A 2OO1A 4UITA 5E0RA 4XUAA 5C7NA 4HBXA 4YYKA 5F62A 5EU1A 3QZTA 4LZRA 5KHMA 4NR5A 4HXMA 4YYNA 3ONIA 5EWCA 4IR6A 4XY9A 4C66A 2RNXA 4UIWA 5F1HA 4J3IA 4X2IA 1JSPB 5CRZA 3I3JA 4QUTA 4AKNA 5CFWA 5FE2A 4YABA 5BT3A 4ALGA 4UYFB 3U5KA 2DVVA 4HXPA 4Q0OA 5CUBA 5EV9A 5CGPA 5KTWA 5EICA 4HXRA 3G0LA 2L5EA 3K2JA 5TB6A 4TT4A 5JI8A 5A5PA 5ENIA 4LYSA 5CQ5A 5I7YA 2H60A 5FB1A 3D7CA 4YBMA 4DONA 2YYNA 4IR5A 5J0DA 4YY4A 4Z6IA 5AMFA 5DLZA 3FKMX 4MENA 5FFVA 5L8UA 3SVFA 3P1EA 4NYXA 5EGUA 5L96A 5I1QA 5HENA 3HMEA 4Z1SA 1N72A 2OSSA 5I80A 4TQNA 3LQIA 4N4HA 4QC3A 3AADA 5KTUA 3UVYA 5F2PA 2YW5A 4UIYA 4UIVA 5LUUA 4C67A 4QR5A 3GG3A 4OUFA 5L99A 5EWWA 3MB3A 5A82A 3LJWA 2DWWA 2YEKA 4NUCA 5D3TA 5FFWA 2NXBA 3UV5A 5FDZA 3RCWA 4UIZA 4YH3A 4O76A 4ALHA 4CLBA 3IU5A 2YDWA 5EM3A 3LQJA 5A5QA 5C8GA 4MR4A 5K29A 4NQMA 5DKCA 5EK9A 4A9MA 4O7EA 4YAXA 5DYUA 4BHWA 3AQAA 5I40A 3P1FA 4NRBA 5A5SA 5CQTA 4ZC9A 5LKXA 3UV2A 4KCXA 4NUDA 5ENEA 4OGIA 3MQMA 4YYJA 5AMEA 5ETDA 4LR6A 4NR6A 4QUUA 5H1TA 4LDFA 4LC2A 4ZW1A 5DFCA 4QNSA 4TTEA 5DW2A 4TU6A 3JVMA 4J1PA 5C4QA 4PCIA 4NS5A 5CPEA 3ZYUA 2YQDA 4N4FA 5KU3A 2KTBB 2GRCA 3MUKA 5CQ7A 5L98A 2YELA 5EPSA 3MB4A 4TU4A 4LYWA 5CQAA 4QZSA 3LXJA 4HXNA 3U5LA 1X0JA 5LVQA 4Z93A 4O7AA 4LZSA 4QSRA 4XYAA 3G0JA 3O37A 3LQHA 5HRXA 5ENGA 5E73A 4WIVA 5II1A 5HQ6A 5EA1A 2RNYA 5D3SA 4HXLA 5A7CA 4A9LA 4YH4A 4O75A 2G4AA 1E6IA 3U5MA 5EWVA 4MR3A 5HFRA 3UVWA 2R10A 5F60A 4YYDA 4A9EA 5A85A 4NYVA 4PKLA 3P1DA 4O7BA 5IGNA 4A9KA 1F68A 5D3NA 5KTXA 4HXSA 4UYFA 5EVAA 5II2A 5EISA 4QYDA 4MEQA 5DW1A 2YEMA 2L84A 3MXFA 5FE1A 2DVRA 5EWHA 3SVGA 3DAIA 2RO1A 5FE7A 5FH6A 5EQ1A 5FE4A 4F3IA 5F61A 2DKWA 5CQ4A 4BW2A 4O77A 3MULA 4BW1A 5BT5A 5H85A 3Q2EA 4HBYA 4UIXA 4LYIA 4LZ2A 5CUCA 5A5RA 4RVRA 3U5PA 4BW4A 5DY7A 1WUMA 3P5OA 5DX4A 4QSSA 4YYIA 4HBVA 2DVSA 4YATA 5EWDA 5ENJA
chains in the Genus database with same CATH superfamily
4N4IA 5CUEA 2FSAA 5I89A 4IR3A 4GPJA 5D7XA 4YBSA 3QZVA 2RI7A 4O71A 5EP7A 5L97A 4IOQA 2RNWA 2I8NA 5D3RA 5E7DA 5FE3A 2F6NA 5FBXA 5HELA 5IGLA 4YYMA 3VKHA 4NR4A 3O36A 4TT2A 5COIA 5DLXA 3S92A 4TZ8A 4QSQA 4QBMA 4QSUA 5CQ8A 5BT4A 4PS5A 5DKDA 5DFBA 3HMFA 5DYCA 4WHWA 4KV1A 4N4GA 4PTBA 3TLPA 3UVDA 2EJNA 3P1CA 4CURA 2RFJA 5L8TA 2RS9B 5D3HA 2D82A 5HQ5A 4QSTA 5E74A 4MEPA 4NUEA 4YYHA 5E9MA 1WUGA 4QEVA 5DBMA 4Z6HA 5D3LA 4Q0NA 4A9HA 4A9FA 3UV4A 5H1VA 5CUDA 4O70A 5LJ0A 5IBNA 5I83A 3Q2FA 5A83A 1EQFA 4QY4A 4NYWA 4TS8A 5F25A 1ZS5A 5HM0A 4TYLA 5CQ6A 5FH8A 5I88A 4IR4A 5HQ7A 3VKGA 5C87A 5A5NA 5HFQA 3UVXA 4J0RA 5CRMA 5HCLA 4HBWA 5FH7A 5CY9A 4UYGA 3JVKA 5DYAA 2E3KA 3ERRA 5EI4A 5E9KA 5F5ZA 4CUUA 4MEOA 4IOOA 4UYDA 4E96A 4WHUA 2R0SA 5FE9A 5D24A 4XUBA 5LVRA 4NRCA 5CZGA 3S91A 4FLPA 5G4RA 5A5OA 5F3AA 2WP1A 5I86A 4HXOA 4TT6A 4YK0A 4O7FA 2MJVB 3O34A 5HLSA 4UIUA 5ENFA 4ZQLA 4QSVA 3QZSA 3U5JA 5F36A 3JVJA 5HEMA 5A81A 2OUOA 5E9YA 5IIDA 2E7OA 4NR9A 5EPBA 5AD3A 4QEUA 3DWYA 5ENCA 5TCMA 5C85A 5IGKA 4PY6A 4J0SA 4LRGA 4OGJA 5EPRA 5C89A 5IGMA 5D25A 5KO4A 4N3WA 4QR4A 4QR3A 5FE0A 5F1LA 4QSPA 5ENBA 2DATA 3IU6A 4MR5A 5DKHA 5LJ1A 4CUSA 4MR6A 4QSXA 5CTLA 4O7CA 4HXKA 3HMHA 3U5OA 5JWMA 2DVQA 4TZ2A 2D9EA 5DYXA 5FG4A 5LJ2A 4YBTA 5E3GA 5FE8A 5H1UA 5ENHA 2L85A 5D3JA 5CS8A 4CUQA 5E9VA 5IG6A 5AD2A 3JVLA 5HRWA 4AKHA 5I29A 4A9JA 2N9GA 4QC1A 1ZKRA 5LKUA 4NR7A 5CQ3A 4Y03A 2R0YA 4CFKA 4A9OA 3O33A 5LKZA 5FE5A 4QSWA 4XY8A 5HRVA 5FG6A 4NR8A 5CUGA 5CU8A 5F63A 4A9NA 4BW3A 4NQNA 5FFYA 5D0CA 5CP5A 5FG5A 2LSPB 4A9IA 4YC9A 4YADA 4Z1QA 4YY6A 4O74A 3NXBA 4UYHA 4NRAA 5DFDA 5CUAA 4UYEA 4QEWA 2F6JA 4QB3A 4CL9A 5I7XA 2E7NA 5LKTA 5G4SA 5E9IA 5ACYA 4KV4A 2WP2A 5D3PA 1JM4B 5D26A 5HJCA 4CUPA 5ETBA 3SVHA 4CFLA 2R0VA 3U5NA 3O35A 4IORA 5FE6A 5FB0A 4CUTA 5E3DA 4QYLA 4YYGA 4O72A 5E9LA 4BJXA 4NXJA 4PCEA 3UW9A 2I7KA 4O78A 2OO1A 4UITA 5E0RA 4XUAA 5C7NA 4HBXA 4YYKA 5F62A 5EU1A 3QZTA 4LZRA 5KHMA 4NR5A 4AKGA 4HXMA 4YYNA 3ONIA 5EWCA 4IR6A 4XY9A 4C66A 2RNXA 4UIWA 5F1HA 4J3IA 4X2IA 1JSPB 5CRZA 3I3JA 4QUTA 4AKNA 4AKIA 5CFWA 5FE2A 4YABA 5BT3A 4ALGA 4UYFB 3U5KA 2DVVA 4HXPA 4Q0OA 5CUBA 5EV9A 5CGPA 5KTWA 5EICA 4HXRA 3G0LA 2L5EA 3K2JA 5TB6A 4TT4A 5JI8A 5A5PA 5ENIA 4LYSA 5CQ5A 5I7YA 2H60A 5FB1A 3D7CA 4YBMA 4DONA 2YYNA 4IR5A 5J0DA 4YY4A 4Z6IA 5AMFA 5DLZA 3FKMX 4MENA 5FFVA 5L8UA 3SVFA 3P1EA 4NYXA 5EGUA 5L96A 5I1QA 5HENA 3HMEA 4Z1SA 1N72A 2OSSA 5I80A 4TQNA 3LQIA 4N4HA 4QC3A 3AADA 5KTUA 3UVYA 5F2PA 2YW5A 4UIYA 4UIVA 5LUUA 4C67A 4QR5A 3GG3A 4OUFA 5L99A 5EWWA 3MB3A 5A82A 3LJWA 2DWWA 2YEKA 4NUCA 5D3TA 5FFWA 2NXBA 3UV5A 3D1DA 5FDZA 3RCWA 4UIZA 4YH3A 4O76A 4ALHA 4CLBA 3IU5A 2YDWA 5EM3A 4AI6A 3LQJA 5A5QA 5C8GA 4MR4A 5K29A 4NQMA 5DKCA 5EK9A 4A9MA 4O7EA 4YAXA 5DYUA 4BHWA 3AQAA 5I40A 3P1FA 4NRBA 5A5SA 5CQTA 4ZC9A 5LKXA 3UV2A 4KCXA 4NUDA 5ENEA 4OGIA 3MQMA 4YYJA 5AMEA 5ETDA 4LR6A 4NR6A 4QUUA 5H1TA 4LDFA 4LC2A 4ZW1A 5DFCA 4QNSA 4TTEA 5DW2A 4TU6A 3JVMA 4J1PA 5C4QA 4PCIA 4NS5A 5CPEA 3ZYUA 2YQDA 4N4FA 5KU3A 2KTBB 2GRCA 3MUKA 5CQ7A 5L98A 2YELA 5EPSA 3MB4A 4TU4A 4LYWA 5CQAA 4QZSA 1PUOA 3LXJA 4HXNA 3U5LA 1X0JA 5LVQA 4Z93A 4O7AA 4LZSA 4QSRA 4XYAA 3G0JA 3D1BA 3O37A 3LQHA 5HRXA 5ENGA 5E73A 4WIVA 5II1A 5HQ6A 5EA1A 2RNYA 5D3SA 4HXLA 5A7CA 4A9LA 4YH4A 4O75A 2G4AA 1E6IA 3U5MA 5EWVA 4MR3A 5HFRA 3UVWA 2R10A 5F60A 4YYDA 4A9EA 5A85A 4NYVA 4PKLA 3P1DA 4O7BA 5IGNA 4A9KA 1F68A 5D3NA 5KTXA 4HXSA 4UYFA 5EVAA 5II2A 5EISA 4QYDA 4MEQA 5DW1A 2YEMA 2L84A 3MXFA 5FE1A 2DVRA 5EWHA 3SVGA 3DAIA 2RO1A 5FE7A 5FH6A 5EQ1A 5FE4A 4F3IA 5F61A 2DKWA 5CQ4A 4BW2A 4O77A 3MULA 4BW1A 5BT5A 5H85A 3Q2EA 4HBYA 4UIXA 4LYIA 4LZ2A 5CUCA 5A5RA 4RVRA 3U5PA 4BW4A 5DY7A 1WUMA 3P5OA 5DX4A 4QSSA 4YYIA 4HBVA 2DVSA 4YATA 5EWDA 5ENJA
chains in the Genus database with same CATH topology
4N4IA 5CUEA 2FSAA 5I89A 4IR3A 4GPJA 5D7XA 4YBSA 3QZVA 2RI7A 4O71A 5EP7A 5L97A 4IOQA 2RNWA 2I8NA 5D3RA 5E7DA 5FE3A 2F6NA 5FBXA 5HELA 5IGLA 4YYMA 4NR4A 3O36A 4TT2A 5COIA 5DLXA 3S92A 4TZ8A 4QSQA 4QBMA 4QSUA 5CQ8A 5BT4A 4PS5A 5DKDA 5DFBA 3HMFA 5DYCA 4WHWA 4KV1A 4N4GA 4PTBA 3TLPA 3UVDA 3P1CA 4CURA 2RFJA 5L8TA 2RS9B 5D3HA 2D82A 5HQ5A 4QSTA 5E74A 4MEPA 4NUEA 4YYHA 5E9MA 1WUGA 4QEVA 5DBMA 4Z6HA 5D3LA 4Q0NA 4A9HA 4A9FA 3UV4A 5H1VA 5CUDA 4O70A 5LJ0A 5IBNA 5I83A 3Q2FA 5A83A 1EQFA 4QY4A 4NYWA 4TS8A 5F25A 1ZS5A 5HM0A 4TYLA 5CQ6A 5FH8A 5I88A 4IR4A 5HQ7A 5C87A 5A5NA 5HFQA 3UVXA 4J0RA 5CRMA 5HCLA 4HBWA 5FH7A 5CY9A 4UYGA 3JVKA 5DYAA 2E3KA 5EI4A 5E9KA 5F5ZA 4CUUA 4MEOA 4IOOA 4UYDA 4E96A 4WHUA 2R0SA 5FE9A 5D24A 4XUBA 5LVRA 4NRCA 5CZGA 3S91A 4FLPA 5G4RA 5A5OA 5F3AA 2WP1A 5I86A 4HXOA 4TT6A 4YK0A 4O7FA 2MJVB 3O34A 5HLSA 4UIUA 5ENFA 4ZQLA 4QSVA 3QZSA 3U5JA 5F36A 3JVJA 5HEMA 5A81A 2OUOA 5E9YA 5IIDA 2E7OA 4NR9A 5EPBA 5AD3A 4QEUA 3DWYA 5ENCA 5TCMA 5C85A 5IGKA 4PY6A 4J0SA 4LRGA 4OGJA 5EPRA 5C89A 5IGMA 5D25A 5KO4A 4N3WA 4QR4A 4QR3A 5FE0A 5F1LA 4QSPA 5ENBA 2DATA 3IU6A 4MR5A 5DKHA 5LJ1A 4CUSA 4MR6A 4QSXA 5CTLA 4O7CA 4HXKA 3HMHA 3U5OA 5JWMA 2DVQA 4TZ2A 2D9EA 5DYXA 5FG4A 5LJ2A 4YBTA 5E3GA 5FE8A 5H1UA 5ENHA 2L85A 5D3JA 5CS8A 4CUQA 5E9VA 5IG6A 5AD2A 3JVLA 5HRWA 5I29A 4A9JA 2N9GA 4QC1A 5LKUA 4NR7A 5CQ3A 4Y03A 2R0YA 4CFKA 4A9OA 3O33A 5LKZA 5FE5A 4QSWA 4XY8A 5HRVA 5FG6A 4NR8A 5CUGA 5CU8A 5F63A 4A9NA 4BW3A 4NQNA 5FFYA 5D0CA 5CP5A 5FG5A 2LSPB 4A9IA 4YC9A 4YADA 4Z1QA 4YY6A 4O74A 3NXBA 4UYHA 4NRAA 5DFDA 5CUAA 4UYEA 4QEWA 2F6JA 4QB3A 4CL9A 5I7XA 2E7NA 5LKTA 5G4SA 5E9IA 5ACYA 4KV4A 2WP2A 5D3PA 1JM4B 5D26A 5HJCA 4CUPA 5ETBA 3SVHA 4CFLA 2R0VA 3U5NA 3O35A 4IORA 5FE6A 5FB0A 4CUTA 5E3DA 4QYLA 4YYGA 4O72A 5E9LA 4BJXA 4NXJA 4PCEA 3UW9A 2I7KA 4O78A 2OO1A 4UITA 5E0RA 4XUAA 5C7NA 4HBXA 4YYKA 5F62A 5EU1A 3QZTA 4LZRA 5KHMA 4NR5A 4HXMA 4YYNA 3ONIA 5EWCA 4IR6A 4XY9A 4C66A 2RNXA 4UIWA 5F1HA 4J3IA 4X2IA 1JSPB 5CRZA 3I3JA 4QUTA 4AKNA 5CFWA 5FE2A 4YABA 5BT3A 4ALGA 4UYFB 3U5KA 2DVVA 4HXPA 4Q0OA 5CUBA 5EV9A 5CGPA 5KTWA 5EICA 4HXRA 3G0LA 2L5EA 3K2JA 5TB6A 4TT4A 5JI8A 5A5PA 5ENIA 4LYSA 5CQ5A 5I7YA 2H60A 5FB1A 3D7CA 4YBMA 4DONA 2YYNA 4IR5A 5J0DA 4YY4A 4Z6IA 5AMFA 5DLZA 3FKMX 4MENA 5FFVA 5L8UA 3SVFA 3P1EA 4NYXA 5EGUA 5L96A 5I1QA 5HENA 3HMEA 4Z1SA 1N72A 2OSSA 5I80A 4TQNA 3LQIA 4N4HA 4QC3A 3AADA 5KTUA 3UVYA 5F2PA 2YW5A 4UIYA 4UIVA 5LUUA 4C67A 4QR5A 3GG3A 4OUFA 5L99A 5EWWA 3MB3A 5A82A 3LJWA 2DWWA 2YEKA 4NUCA 5D3TA 5FFWA 2NXBA 3UV5A 5FDZA 3RCWA 4UIZA 4YH3A 4O76A 4ALHA 4CLBA 3IU5A 2YDWA 5EM3A 3LQJA 5A5QA 5C8GA 4MR4A 5K29A 4NQMA 5DKCA 5EK9A 4A9MA 4O7EA 4YAXA 5DYUA 4BHWA 3AQAA 5I40A 3P1FA 4NRBA 5A5SA 5CQTA 4ZC9A 5LKXA 3UV2A 4KCXA 4NUDA 5ENEA 4OGIA 3MQMA 4YYJA 5AMEA 5ETDA 4LR6A 4NR6A 4QUUA 5H1TA 4LDFA 4LC2A 4ZW1A 5DFCA 4QNSA 4TTEA 5DW2A 4TU6A 3JVMA 4J1PA 5C4QA 4PCIA 4NS5A 5CPEA 3ZYUA 2YQDA 4N4FA 5KU3A 2KTBB 2GRCA 3MUKA 5CQ7A 5L98A 2YELA 5EPSA 3MB4A 4TU4A 4LYWA 5CQAA 4QZSA 3LXJA 4HXNA 3U5LA 1X0JA 5LVQA 4Z93A 4O7AA 4LZSA 4QSRA 4XYAA 3G0JA 3O37A 3LQHA 5HRXA 5ENGA 5E73A 4WIVA 5II1A 5HQ6A 5EA1A 2RNYA 5D3SA 4HXLA 5A7CA 4A9LA 4YH4A 4O75A 2G4AA 1E6IA 3U5MA 5EWVA 4MR3A 5HFRA 3UVWA 2R10A 5F60A 4YYDA 4A9EA 5A85A 4NYVA 4PKLA 3P1DA 4O7BA 5IGNA 4A9KA 1F68A 5D3NA 5KTXA 4HXSA 4UYFA 5EVAA 5II2A 5EISA 4QYDA 4MEQA 5DW1A 2YEMA 2L84A 3MXFA 5FE1A 2DVRA 5EWHA 3SVGA 3DAIA 2RO1A 5FE7A 5FH6A 5EQ1A 5FE4A 4F3IA 5F61A 2DKWA 5CQ4A 4BW2A 4O77A 3MULA 4BW1A 5BT5A 5H85A 3Q2EA 4HBYA 4UIXA 4LYIA 4LZ2A 5CUCA 5A5RA 4RVRA 3U5PA 4BW4A 5DY7A 1WUMA 3P5OA 5DX4A 4QSSA 4YYIA 4HBVA 2DVSA 4YATA 5EWDA 5ENJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4I A;  5CUE A;  2FSA A;  5I89 A;  4IR3 A;  4GPJ A;  5D7X A;  4YBS A;  3QZV A;  2RI7 A;  4O71 A;  5EP7 A;  5L97 A;  4IOQ A;  2RNW A;  2I8N A;  5D3R A;  5E7D A;  5FE3 A;  2F6N A;  5FBX A;  5HEL A;  5IGL A;  4YYM A;  4NR4 A;  3O36 A;  4TT2 A;  5COI A;  5DLX A;  3S92 A;  4TZ8 A;  4QSQ A;  4QBM A;  4QSU A;  5CQ8 A;  5BT4 A;  4PS5 A;  5DKD A;  5DFB A;  3HMF A;  5DYC A;  4WHW A;  4KV1 A;  4N4G A;  4PTB A;  3TLP A;  3UVD A;  3P1C A;  4CUR A;  2RFJ A;  5L8T A;  2RS9 B;  5D3H A;  2D82 A;  5HQ5 A;  4QST A;  5E74 A;  4MEP A;  4NUE A;  4YYH A;  5E9M A;  1WUG A;  4QEV A;  5DBM A;  4Z6H A;  5D3L A;  4Q0N A;  4A9H A;  4A9F A;  3UV4 A;  5H1V A;  5CUD A;  4O70 A;  5LJ0 A;  5IBN A;  5I83 A;  3Q2F A;  5A83 A;  1EQF A;  4QY4 A;  4NYW A;  4TS8 A;  5F25 A;  1ZS5 A;  5HM0 A;  4TYL A;  5CQ6 A;  5FH8 A;  5I88 A;  4IR4 A;  5HQ7 A;  5C87 A;  5A5N A;  5HFQ A;  3UVX A;  4J0R A;  5CRM A;  5HCL A;  4HBW A;  5FH7 A;  5CY9 A;  4UYG A;  3JVK A;  5DYA A;  2E3K A;  5EI4 A;  5E9K A;  5F5Z A;  4CUU A;  4MEO A;  4IOO A;  4UYD A;  4E96 A;  4WHU A;  2R0S A;  5FE9 A;  5D24 A;  4XUB A;  5LVR A;  4NRC A;  5CZG A;  3S91 A;  4FLP A;  5G4R A;  5A5O A;  5F3A A;  2WP1 A;  5I86 A;  4HXO A;  4TT6 A;  4YK0 A;  4O7F A;  2MJV B;  3O34 A;  5HLS A;  4UIU A;  5ENF A;  4ZQL A;  4QSV A;  3QZS A;  3U5J A;  5F36 A;  3JVJ A;  5HEM A;  5A81 A;  2OUO A;  5E9Y A;  5IID A;  2E7O A;  4NR9 A;  5EPB A;  5AD3 A;  4QEU A;  3DWY A;  5ENC A;  5TCM A;  5C85 A;  5IGK A;  4PY6 A;  4J0S A;  4LRG A;  4OGJ A;  5EPR A;  5C89 A;  5IGM A;  5D25 A;  5KO4 A;  4N3W A;  4QR4 A;  4QR3 A;  5FE0 A;  5F1L A;  4QSP A;  5ENB A;  2DAT A;  3IU6 A;  4MR5 A;  5DKH A;  5LJ1 A;  4CUS A;  4MR6 A;  4QSX A;  5CTL A;  4O7C A;  4HXK A;  3HMH A;  3U5O A;  5JWM A;  2DVQ A;  4TZ2 A;  2D9E A;  5DYX A;  5FG4 A;  5LJ2 A;  4YBT A;  5E3G A;  5FE8 A;  5H1U A;  5ENH A;  2L85 A;  5D3J A;  5CS8 A;  4CUQ A;  5E9V A;  5IG6 A;  5AD2 A;  3JVL A;  5HRW A;  5I29 A;  4A9J A;  2N9G A;  4QC1 A;  5LKU A;  4NR7 A;  5CQ3 A;  4Y03 A;  2R0Y A;  4CFK A;  4A9O A;  3O33 A;  5LKZ A;  5FE5 A;  4QSW A;  4XY8 A;  5HRV A;  5FG6 A;  4NR8 A;  5CUG A;  5CU8 A;  5F63 A;  4A9N A;  4BW3 A;  4NQN A;  5FFY A;  5D0C A;  5CP5 A;  5FG5 A;  2LSP B;  4A9I A;  4YC9 A;  4YAD A;  4Z1Q A;  4YY6 A;  4O74 A;  3NXB A;  4UYH A;  4NRA A;  5DFD A;  5CUA A;  4UYE A;  4QEW A;  2F6J A;  4QB3 A;  4CL9 A;  5I7X A;  2E7N A;  5LKT A;  5G4S A;  5E9I A;  5ACY A;  4KV4 A;  2WP2 A;  5D3P A;  1JM4 B;  5D26 A;  5HJC A;  4CUP A;  5ETB A;  3SVH A;  4CFL A;  2R0V A;  3U5N A;  3O35 A;  4IOR A;  5FE6 A;  5FB0 A;  4CUT A;  5E3D A;  4QYL A;  4YYG A;  4O72 A;  5E9L A;  4BJX A;  4NXJ A;  4PCE A;  3UW9 A;  2I7K A;  4O78 A;  2OO1 A;  4UIT A;  5E0R A;  4XUA A;  5C7N A;  4HBX A;  4YYK A;  5F62 A;  5EU1 A;  3QZT A;  4LZR A;  5KHM A;  4NR5 A;  4HXM A;  4YYN A;  3ONI A;  5EWC A;  4IR6 A;  4XY9 A;  4C66 A;  2RNX A;  4UIW A;  5F1H A;  4J3I A;  4X2I A;  1JSP B;  5CRZ A;  3I3J A;  4QUT A;  4AKN A;  5CFW A;  5FE2 A;  4YAB A;  5BT3 A;  4ALG A;  4UYF B;  3U5K A;  2DVV A;  4HXP A;  4Q0O A;  5CUB A;  5EV9 A;  5CGP A;  5KTW A;  5EIC A;  4HXR A;  3G0L A;  2L5E A;  3K2J A;  5TB6 A;  4TT4 A;  5JI8 A;  5A5P A;  5ENI A;  4LYS A;  5CQ5 A;  5I7Y A;  2H60 A;  5FB1 A;  3D7C A;  4YBM A;  4DON A;  2YYN A;  4IR5 A;  5J0D A;  4YY4 A;  4Z6I A;  5AMF A;  5DLZ A;  3FKM X;  4MEN A;  5FFV A;  5L8U A;  3SVF A;  3P1E A;  4NYX A;  5EGU A;  5L96 A;  5I1Q A;  5HEN A;  3HME A;  4Z1S A;  1N72 A;  2OSS A;  5I80 A;  4TQN A;  3LQI A;  4N4H A;  4QC3 A;  3AAD A;  5KTU A;  3UVY A;  5F2P A;  2YW5 A;  4UIY A;  4UIV A;  5LUU A;  4C67 A;  4QR5 A;  3GG3 A;  4OUF A;  5L99 A;  5EWW A;  3MB3 A;  5A82 A;  3LJW A;  2DWW A;  2YEK A;  4NUC A;  5D3T A;  5FFW A;  2NXB A;  3UV5 A;  5FDZ A;  3RCW A;  4UIZ A;  4YH3 A;  4O76 A;  4ALH A;  4CLB A;  3IU5 A;  2YDW A;  5EM3 A;  3LQJ A;  5A5Q A;  5C8G A;  4MR4 A;  5K29 A;  4NQM A;  5DKC A;  5EK9 A;  4A9M A;  4O7E A;  4YAX A;  5DYU A;  4BHW A;  3AQA A;  5I40 A;  3P1F A;  4NRB A;  5A5S A;  5CQT A;  4ZC9 A;  5LKX A;  3UV2 A;  4KCX A;  4NUD A;  5ENE A;  4OGI A;  3MQM A;  4YYJ A;  5AME A;  5ETD A;  4LR6 A;  4NR6 A;  4QUU A;  5H1T A;  4LDF A;  4LC2 A;  4ZW1 A;  5DFC A;  4QNS A;  4TTE A;  5DW2 A;  4TU6 A;  3JVM A;  4J1P A;  5C4Q A;  4PCI A;  4NS5 A;  5CPE A;  3ZYU A;  2YQD A;  4N4F A;  5KU3 A;  2KTB B;  2GRC A;  3MUK A;  5CQ7 A;  5L98 A;  2YEL A;  5EPS A;  3MB4 A;  4TU4 A;  4LYW A;  5CQA A;  4QZS A;  3LXJ A;  4HXN A;  3U5L A;  1X0J A;  5LVQ A;  4Z93 A;  4O7A A;  4LZS A;  4QSR A;  4XYA A;  3G0J A;  3O37 A;  3LQH A;  5HRX A;  5ENG A;  5E73 A;  4WIV A;  5II1 A;  5HQ6 A;  5EA1 A;  2RNY A;  5D3S A;  4HXL A;  5A7C A;  4A9L A;  4YH4 A;  4O75 A;  2G4A A;  1E6I A;  3U5M A;  5EWV A;  4MR3 A;  5HFR A;  3UVW A;  2R10 A;  5F60 A;  4YYD A;  4A9E A;  5A85 A;  4NYV A;  4PKL A;  3P1D A;  4O7B A;  5IGN A;  4A9K A;  1F68 A;  5D3N A;  5KTX A;  4HXS A;  4UYF A;  5EVA A;  5II2 A;  5EIS A;  4QYD A;  4MEQ A;  5DW1 A;  2YEM A;  2L84 A;  3MXF A;  5FE1 A;  2DVR A;  5EWH A;  3SVG A;  3DAI A;  2RO1 A;  5FE7 A;  5FH6 A;  5EQ1 A;  5FE4 A;  4F3I A;  5F61 A;  2DKW A;  5CQ4 A;  4BW2 A;  4O77 A;  3MUL A;  4BW1 A;  5BT5 A;  5H85 A;  3Q2E A;  4HBY A;  4UIX A;  4LYI A;  4LZ2 A;  5CUC A;  5A5R A;  4RVR A;  3U5P A;  4BW4 A;  5DY7 A;  1WUM A;  3P5O A;  5DX4 A;  4QSS A;  4YYI A;  4HBV A;  2DVS A;  4YAT A;  5EWD A;  5ENJ A; 
#chains in the Genus database with same CATH topology
 4N4I A;  5CUE A;  2FSA A;  5I89 A;  4IR3 A;  4GPJ A;  5D7X A;  4YBS A;  3QZV A;  2RI7 A;  4O71 A;  5EP7 A;  5L97 A;  4IOQ A;  2RNW A;  2I8N A;  5D3R A;  5E7D A;  5FE3 A;  2F6N A;  5FBX A;  5HEL A;  5IGL A;  4YYM A;  3VKH A;  4NR4 A;  3O36 A;  4TT2 A;  5COI A;  5DLX A;  3S92 A;  4TZ8 A;  4QSQ A;  4QBM A;  4QSU A;  5CQ8 A;  5BT4 A;  4PS5 A;  5DKD A;  5DFB A;  3HMF A;  5DYC A;  4WHW A;  4KV1 A;  4N4G A;  4PTB A;  3TLP A;  3UVD A;  2EJN A;  3P1C A;  4CUR A;  2RFJ A;  5L8T A;  2RS9 B;  5D3H A;  2D82 A;  5HQ5 A;  4QST A;  5E74 A;  4MEP A;  4NUE A;  4YYH A;  5E9M A;  1WUG A;  4QEV A;  5DBM A;  4Z6H A;  5D3L A;  4Q0N A;  4A9H A;  4A9F A;  3UV4 A;  5H1V A;  5CUD A;  4O70 A;  5LJ0 A;  5IBN A;  5I83 A;  3Q2F A;  5A83 A;  1EQF A;  4QY4 A;  4NYW A;  4TS8 A;  5F25 A;  1ZS5 A;  5HM0 A;  4TYL A;  5CQ6 A;  5FH8 A;  5I88 A;  4IR4 A;  5HQ7 A;  3VKG A;  5C87 A;  5A5N A;  5HFQ A;  3UVX A;  4J0R A;  5CRM A;  5HCL A;  4HBW A;  5FH7 A;  5CY9 A;  4UYG A;  3JVK A;  5DYA A;  2E3K A;  3ERR A;  5EI4 A;  5E9K A;  5F5Z A;  4CUU A;  4MEO A;  4IOO A;  4UYD A;  4E96 A;  4WHU A;  2R0S A;  5FE9 A;  5D24 A;  4XUB A;  5LVR A;  4NRC A;  5CZG A;  3S91 A;  4FLP A;  5G4R A;  5A5O A;  5F3A A;  2WP1 A;  5I86 A;  4HXO A;  4TT6 A;  4YK0 A;  4O7F A;  2MJV B;  3O34 A;  5HLS A;  4UIU A;  5ENF A;  4ZQL A;  4QSV A;  3QZS A;  3U5J A;  5F36 A;  3JVJ A;  5HEM A;  5A81 A;  2OUO A;  5E9Y A;  5IID A;  2E7O A;  4NR9 A;  5EPB A;  5AD3 A;  4QEU A;  3DWY A;  5ENC A;  5TCM A;  5C85 A;  5IGK A;  4PY6 A;  4J0S A;  4LRG A;  4OGJ A;  5EPR A;  5C89 A;  5IGM A;  5D25 A;  5KO4 A;  4N3W A;  4QR4 A;  4QR3 A;  5FE0 A;  5F1L A;  4QSP A;  5ENB A;  2DAT A;  3IU6 A;  4MR5 A;  5DKH A;  5LJ1 A;  4CUS A;  4MR6 A;  4QSX A;  5CTL A;  4O7C A;  4HXK A;  3HMH A;  3U5O A;  5JWM A;  2DVQ A;  4TZ2 A;  2D9E A;  5DYX A;  5FG4 A;  5LJ2 A;  4YBT A;  5E3G A;  5FE8 A;  5H1U A;  5ENH A;  2L85 A;  5D3J A;  5CS8 A;  4CUQ A;  5E9V A;  5IG6 A;  5AD2 A;  3JVL A;  5HRW A;  4AKH A;  5I29 A;  4A9J A;  2N9G A;  4QC1 A;  1ZKR A;  5LKU A;  4NR7 A;  5CQ3 A;  4Y03 A;  2R0Y A;  4CFK A;  4A9O A;  3O33 A;  5LKZ A;  5FE5 A;  4QSW A;  4XY8 A;  5HRV A;  5FG6 A;  4NR8 A;  5CUG A;  5CU8 A;  5F63 A;  4A9N A;  4BW3 A;  4NQN A;  5FFY A;  5D0C A;  5CP5 A;  5FG5 A;  2LSP B;  4A9I A;  4YC9 A;  4YAD A;  4Z1Q A;  4YY6 A;  4O74 A;  3NXB A;  4UYH A;  4NRA A;  5DFD A;  5CUA A;  4UYE A;  4QEW A;  2F6J A;  4QB3 A;  4CL9 A;  5I7X A;  2E7N A;  5LKT A;  5G4S A;  5E9I A;  5ACY A;  4KV4 A;  2WP2 A;  5D3P A;  1JM4 B;  5D26 A;  5HJC A;  4CUP A;  5ETB A;  3SVH A;  4CFL A;  2R0V A;  3U5N A;  3O35 A;  4IOR A;  5FE6 A;  5FB0 A;  4CUT A;  5E3D A;  4QYL A;  4YYG A;  4O72 A;  5E9L A;  4BJX A;  4NXJ A;  4PCE A;  3UW9 A;  2I7K A;  4O78 A;  2OO1 A;  4UIT A;  5E0R A;  4XUA A;  5C7N A;  4HBX A;  4YYK A;  5F62 A;  5EU1 A;  3QZT A;  4LZR A;  5KHM A;  4NR5 A;  4AKG A;  4HXM A;  4YYN A;  3ONI A;  5EWC A;  4IR6 A;  4XY9 A;  4C66 A;  2RNX A;  4UIW A;  5F1H A;  4J3I A;  4X2I A;  1JSP B;  5CRZ A;  3I3J A;  4QUT A;  4AKN A;  4AKI A;  5CFW A;  5FE2 A;  4YAB A;  5BT3 A;  4ALG A;  4UYF B;  3U5K A;  2DVV A;  4HXP A;  4Q0O A;  5CUB A;  5EV9 A;  5CGP A;  5KTW A;  5EIC A;  4HXR A;  3G0L A;  2L5E A;  3K2J A;  5TB6 A;  4TT4 A;  5JI8 A;  5A5P A;  5ENI A;  4LYS A;  5CQ5 A;  5I7Y A;  2H60 A;  5FB1 A;  3D7C A;  4YBM A;  4DON A;  2YYN A;  4IR5 A;  5J0D A;  4YY4 A;  4Z6I A;  5AMF A;  5DLZ A;  3FKM X;  4MEN A;  5FFV A;  5L8U A;  3SVF A;  3P1E A;  4NYX A;  5EGU A;  5L96 A;  5I1Q A;  5HEN A;  3HME A;  4Z1S A;  1N72 A;  2OSS A;  5I80 A;  4TQN A;  3LQI A;  4N4H A;  4QC3 A;  3AAD A;  5KTU A;  3UVY A;  5F2P A;  2YW5 A;  4UIY A;  4UIV A;  5LUU A;  4C67 A;  4QR5 A;  3GG3 A;  4OUF A;  5L99 A;  5EWW A;  3MB3 A;  5A82 A;  3LJW A;  2DWW A;  2YEK A;  4NUC A;  5D3T A;  5FFW A;  2NXB A;  3UV5 A;  3D1D A;  5FDZ A;  3RCW A;  4UIZ A;  4YH3 A;  4O76 A;  4ALH A;  4CLB A;  3IU5 A;  2YDW A;  5EM3 A;  4AI6 A;  3LQJ A;  5A5Q A;  5C8G A;  4MR4 A;  5K29 A;  4NQM A;  5DKC A;  5EK9 A;  4A9M A;  4O7E A;  4YAX A;  5DYU A;  4BHW A;  3AQA A;  5I40 A;  3P1F A;  4NRB A;  5A5S A;  5CQT A;  4ZC9 A;  5LKX A;  3UV2 A;  4KCX A;  4NUD A;  5ENE A;  4OGI A;  3MQM A;  4YYJ A;  5AME A;  5ETD A;  4LR6 A;  4NR6 A;  4QUU A;  5H1T A;  4LDF A;  4LC2 A;  4ZW1 A;  5DFC A;  4QNS A;  4TTE A;  5DW2 A;  4TU6 A;  3JVM A;  4J1P A;  5C4Q A;  4PCI A;  4NS5 A;  5CPE A;  3ZYU A;  2YQD A;  4N4F A;  5KU3 A;  2KTB B;  2GRC A;  3MUK A;  5CQ7 A;  5L98 A;  2YEL A;  5EPS A;  3MB4 A;  4TU4 A;  4LYW A;  5CQA A;  4QZS A;  1PUO A;  3LXJ A;  4HXN A;  3U5L A;  1X0J A;  5LVQ A;  4Z93 A;  4O7A A;  4LZS A;  4QSR A;  4XYA A;  3G0J A;  3D1B A;  3O37 A;  3LQH A;  5HRX A;  5ENG A;  5E73 A;  4WIV A;  5II1 A;  5HQ6 A;  5EA1 A;  2RNY A;  5D3S A;  4HXL A;  5A7C A;  4A9L A;  4YH4 A;  4O75 A;  2G4A A;  1E6I A;  3U5M A;  5EWV A;  4MR3 A;  5HFR A;  3UVW A;  2R10 A;  5F60 A;  4YYD A;  4A9E A;  5A85 A;  4NYV A;  4PKL A;  3P1D A;  4O7B A;  5IGN A;  4A9K A;  1F68 A;  5D3N A;  5KTX A;  4HXS A;  4UYF A;  5EVA A;  5II2 A;  5EIS A;  4QYD A;  4MEQ A;  5DW1 A;  2YEM A;  2L84 A;  3MXF A;  5FE1 A;  2DVR A;  5EWH A;  3SVG A;  3DAI A;  2RO1 A;  5FE7 A;  5FH6 A;  5EQ1 A;  5FE4 A;  4F3I A;  5F61 A;  2DKW A;  5CQ4 A;  4BW2 A;  4O77 A;  3MUL A;  4BW1 A;  5BT5 A;  5H85 A;  3Q2E A;  4HBY A;  4UIX A;  4LYI A;  4LZ2 A;  5CUC A;  5A5R A;  4RVR A;  3U5P A;  4BW4 A;  5DY7 A;  1WUM A;  3P5O A;  5DX4 A;  4QSS A;  4YYI A;  4HBV A;  2DVS A;  4YAT A;  5EWD A;  5ENJ A; 
#chains in the Genus database with same CATH homology
 4N4I A;  5CUE A;  2FSA A;  5I89 A;  4IR3 A;  4GPJ A;  5D7X A;  4YBS A;  3QZV A;  2RI7 A;  4O71 A;  5EP7 A;  5L97 A;  4IOQ A;  2RNW A;  2I8N A;  5D3R A;  5E7D A;  5FE3 A;  2F6N A;  5FBX A;  5HEL A;  5IGL A;  4YYM A;  4NR4 A;  3O36 A;  4TT2 A;  5COI A;  5DLX A;  3S92 A;  4TZ8 A;  4QSQ A;  4QBM A;  4QSU A;  5CQ8 A;  5BT4 A;  4PS5 A;  5DKD A;  5DFB A;  3HMF A;  5DYC A;  4WHW A;  4KV1 A;  4N4G A;  4PTB A;  3TLP A;  3UVD A;  3P1C A;  4CUR A;  2RFJ A;  5L8T A;  2RS9 B;  5D3H A;  2D82 A;  5HQ5 A;  4QST A;  5E74 A;  4MEP A;  4NUE A;  4YYH A;  5E9M A;  1WUG A;  4QEV A;  5DBM A;  4Z6H A;  5D3L A;  4Q0N A;  4A9H A;  4A9F A;  3UV4 A;  5H1V A;  5CUD A;  4O70 A;  5LJ0 A;  5IBN A;  5I83 A;  3Q2F A;  5A83 A;  1EQF A;  4QY4 A;  4NYW A;  4TS8 A;  5F25 A;  1ZS5 A;  5HM0 A;  4TYL A;  5CQ6 A;  5FH8 A;  5I88 A;  4IR4 A;  5HQ7 A;  5C87 A;  5A5N A;  5HFQ A;  3UVX A;  4J0R A;  5CRM A;  5HCL A;  4HBW A;  5FH7 A;  5CY9 A;  4UYG A;  3JVK A;  5DYA A;  2E3K A;  5EI4 A;  5E9K A;  5F5Z A;  4CUU A;  4MEO A;  4IOO A;  4UYD A;  4E96 A;  4WHU A;  2R0S A;  5FE9 A;  5D24 A;  4XUB A;  5LVR A;  4NRC A;  5CZG A;  3S91 A;  4FLP A;  5G4R A;  5A5O A;  5F3A A;  2WP1 A;  5I86 A;  4HXO A;  4TT6 A;  4YK0 A;  4O7F A;  2MJV B;  3O34 A;  5HLS A;  4UIU A;  5ENF A;  4ZQL A;  4QSV A;  3QZS A;  3U5J A;  5F36 A;  3JVJ A;  5HEM A;  5A81 A;  2OUO A;  5E9Y A;  5IID A;  2E7O A;  4NR9 A;  5EPB A;  5AD3 A;  4QEU A;  3DWY A;  5ENC A;  5TCM A;  5C85 A;  5IGK A;  4PY6 A;  4J0S A;  4LRG A;  4OGJ A;  5EPR A;  5C89 A;  5IGM A;  5D25 A;  5KO4 A;  4N3W A;  4QR4 A;  4QR3 A;  5FE0 A;  5F1L A;  4QSP A;  5ENB A;  2DAT A;  3IU6 A;  4MR5 A;  5DKH A;  5LJ1 A;  4CUS A;  4MR6 A;  4QSX A;  5CTL A;  4O7C A;  4HXK A;  3HMH A;  3U5O A;  5JWM A;  2DVQ A;  4TZ2 A;  2D9E A;  5DYX A;  5FG4 A;  5LJ2 A;  4YBT A;  5E3G A;  5FE8 A;  5H1U A;  5ENH A;  2L85 A;  5D3J A;  5CS8 A;  4CUQ A;  5E9V A;  5IG6 A;  5AD2 A;  3JVL A;  5HRW A;  5I29 A;  4A9J A;  2N9G A;  4QC1 A;  5LKU A;  4NR7 A;  5CQ3 A;  4Y03 A;  2R0Y A;  4CFK A;  4A9O A;  3O33 A;  5LKZ A;  5FE5 A;  4QSW A;  4XY8 A;  5HRV A;  5FG6 A;  4NR8 A;  5CUG A;  5CU8 A;  5F63 A;  4A9N A;  4BW3 A;  4NQN A;  5FFY A;  5D0C A;  5CP5 A;  5FG5 A;  2LSP B;  4A9I A;  4YC9 A;  4YAD A;  4Z1Q A;  4YY6 A;  4O74 A;  3NXB A;  4UYH A;  4NRA A;  5DFD A;  5CUA A;  4UYE A;  4QEW A;  2F6J A;  4QB3 A;  4CL9 A;  5I7X A;  2E7N A;  5LKT A;  5G4S A;  5E9I A;  5ACY A;  4KV4 A;  2WP2 A;  5D3P A;  1JM4 B;  5D26 A;  5HJC A;  4CUP A;  5ETB A;  3SVH A;  4CFL A;  2R0V A;  3U5N A;  3O35 A;  4IOR A;  5FE6 A;  5FB0 A;  4CUT A;  5E3D A;  4QYL A;  4YYG A;  4O72 A;  5E9L A;  4BJX A;  4NXJ A;  4PCE A;  3UW9 A;  2I7K A;  4O78 A;  2OO1 A;  4UIT A;  5E0R A;  4XUA A;  5C7N A;  4HBX A;  4YYK A;  5F62 A;  5EU1 A;  3QZT A;  4LZR A;  5KHM A;  4NR5 A;  4HXM A;  4YYN A;  3ONI A;  5EWC A;  4IR6 A;  4XY9 A;  4C66 A;  2RNX A;  4UIW A;  5F1H A;  4J3I A;  4X2I A;  1JSP B;  5CRZ A;  3I3J A;  4QUT A;  4AKN A;  5CFW A;  5FE2 A;  4YAB A;  5BT3 A;  4ALG A;  4UYF B;  3U5K A;  2DVV A;  4HXP A;  4Q0O A;  5CUB A;  5EV9 A;  5CGP A;  5KTW A;  5EIC A;  4HXR A;  3G0L A;  2L5E A;  3K2J A;  5TB6 A;  4TT4 A;  5JI8 A;  5A5P A;  5ENI A;  4LYS A;  5CQ5 A;  5I7Y A;  2H60 A;  5FB1 A;  3D7C A;  4YBM A;  4DON A;  2YYN A;  4IR5 A;  5J0D A;  4YY4 A;  4Z6I A;  5AMF A;  5DLZ A;  3FKM X;  4MEN A;  5FFV A;  5L8U A;  3SVF A;  3P1E A;  4NYX A;  5EGU A;  5L96 A;  5I1Q A;  5HEN A;  3HME A;  4Z1S A;  1N72 A;  2OSS A;  5I80 A;  4TQN A;  3LQI A;  4N4H A;  4QC3 A;  3AAD A;  5KTU A;  3UVY A;  5F2P A;  2YW5 A;  4UIY A;  4UIV A;  5LUU A;  4C67 A;  4QR5 A;  3GG3 A;  4OUF A;  5L99 A;  5EWW A;  3MB3 A;  5A82 A;  3LJW A;  2DWW A;  2YEK A;  4NUC A;  5D3T A;  5FFW A;  2NXB A;  3UV5 A;  5FDZ A;  3RCW A;  4UIZ A;  4YH3 A;  4O76 A;  4ALH A;  4CLB A;  3IU5 A;  2YDW A;  5EM3 A;  3LQJ A;  5A5Q A;  5C8G A;  4MR4 A;  5K29 A;  4NQM A;  5DKC A;  5EK9 A;  4A9M A;  4O7E A;  4YAX A;  5DYU A;  4BHW A;  3AQA A;  5I40 A;  3P1F A;  4NRB A;  5A5S A;  5CQT A;  4ZC9 A;  5LKX A;  3UV2 A;  4KCX A;  4NUD A;  5ENE A;  4OGI A;  3MQM A;  4YYJ A;  5AME A;  5ETD A;  4LR6 A;  4NR6 A;  4QUU A;  5H1T A;  4LDF A;  4LC2 A;  4ZW1 A;  5DFC A;  4QNS A;  4TTE A;  5DW2 A;  4TU6 A;  3JVM A;  4J1P A;  5C4Q A;  4PCI A;  4NS5 A;  5CPE A;  3ZYU A;  2YQD A;  4N4F A;  5KU3 A;  2KTB B;  2GRC A;  3MUK A;  5CQ7 A;  5L98 A;  2YEL A;  5EPS A;  3MB4 A;  4TU4 A;  4LYW A;  5CQA A;  4QZS A;  3LXJ A;  4HXN A;  3U5L A;  1X0J A;  5LVQ A;  4Z93 A;  4O7A A;  4LZS A;  4QSR A;  4XYA A;  3G0J A;  3O37 A;  3LQH A;  5HRX A;  5ENG A;  5E73 A;  4WIV A;  5II1 A;  5HQ6 A;  5EA1 A;  2RNY A;  5D3S A;  4HXL A;  5A7C A;  4A9L A;  4YH4 A;  4O75 A;  2G4A A;  1E6I A;  3U5M A;  5EWV A;  4MR3 A;  5HFR A;  3UVW A;  2R10 A;  5F60 A;  4YYD A;  4A9E A;  5A85 A;  4NYV A;  4PKL A;  3P1D A;  4O7B A;  5IGN A;  4A9K A;  1F68 A;  5D3N A;  5KTX A;  4HXS A;  4UYF A;  5EVA A;  5II2 A;  5EIS A;  4QYD A;  4MEQ A;  5DW1 A;  2YEM A;  2L84 A;  3MXF A;  5FE1 A;  2DVR A;  5EWH A;  3SVG A;  3DAI A;  2RO1 A;  5FE7 A;  5FH6 A;  5EQ1 A;  5FE4 A;  4F3I A;  5F61 A;  2DKW A;  5CQ4 A;  4BW2 A;  4O77 A;  3MUL A;  4BW1 A;  5BT5 A;  5H85 A;  3Q2E A;  4HBY A;  4UIX A;  4LYI A;  4LZ2 A;  5CUC A;  5A5R A;  4RVR A;  3U5P A;  4BW4 A;  5DY7 A;  1WUM A;  3P5O A;  5DX4 A;  4QSS A;  4YYI A;  4HBV A;  2DVS A;  4YAT A;  5EWD A;  5ENJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...