3SVHA

Crystal structure of the bromdomain of human crebbp in complex with a 3,5-dimethylisoxazol ligand
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
117
structure length
117
Chain Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Crystal Structure of the bromdomain of human CREBBP in complex with a 3,5-dimethylisoxazol ligand
rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 43
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3svhA00
5I83A 5FE2A 4C67A 4HXKA 5CQ8A 5CQ7A 5L8UA 4J1PA 4QBMA 5CUDA 4XUBA 3DWYA 5HFRA 3O36A 2YEMA 4MR6A 4TU4A 5F1HA 5FE5A 3MQMA 2YELA 4HXSA 2R0VA 3RCWA 1N72A 5IGMA 1ZS5A 5I7XA 5CGPA 2L85A 5L99A 5LVQA 5A5PA 2DVVA 4QYLA 3U5PA 4MR5A 3LXJA 4QZSA 4MEPA 5CZGA 4O7BA 5EI4A 5FBXA 5H1TA 4O7AA 4XUAA 5FE0A 5LJ0A 4NUCA 5F5ZA 5I88A 4ZC9A 2YEKA 5EWDA 5H1UA 3UW9A 4C66A 4QSVA 2MJVB 3UVXA 3Q2FA 4E96A 3P1CA 2RNYA 5F63A 2DVRA 5FB0A 3K2JA 4N3WA 5CPEA 3MULA 4TU6A 4OUFA 4UIXA 3NXBA 4Z6HA 2R0SA 2RO1A 5CQ5A 4HXRA 4BW2A 5E9KA 4BHWA 4UIWA 5HEMA 5FE6A 3HMEA 4OGJA 4A9MA 4NRBA 4CUSA 4UYHA 4QSXA 2YYNA 5HRWA 4J0SA 5KTWA 2L5EA 4O70A 4QSQA 5BT4A 2N9GA 5D3JA 4PY6A 3O34A 5HJCA 5EWCA 5C87A 4CURA 5F61A 5ENEA 5E0RA 5TB6A 5HQ6A 3U5JA 2NXBA 2DATA 5L8TA 4UYEA 5ETDA 4YBMA 5F36A 5LKTA 4KCXA 4O71A 3HMHA 2F6NA 2RNWA 4BW3A 4NR6A 5LVRA 2E3KA 5I7YA 5KO4A 4QC1A 5F25A 4QSTA 5D3PA 3S91A 4TT2A 5DFDA 4CL9A 4PS5A 4O7EA 4GPJA 4O7FA 4UYFB 5L97A 3P5OA 4LYIA 5COIA 5EVAA 4QEUA 5CY9A 3MB4A 3GG3A 4ALHA 4BW1A 5E3DA 5DYAA 4YK0A 3MXFA 4LR6A 5FH6A 5EM3A 4UITA 5JI8A 2DVQA 4TS8A 2I8NA 4J3IA 4CUPA 5DFBA 3LQIA 4XY8A 4LDFA 5KU3A 2F6JA 4NR5A 4A9HA 5H1VA 5D24A 3UVYA 3MUKA 5A7CA 4UYDA 5TCMA 2OSSA 5FE1A 5D3HA 3JVLA 5CP5A 3UVWA 4Z93A 5KTUA 4N4HA 4YYKA 3SVGA 3O33A 5C8GA 2RNXA 5CS8A 5DKCA 3U5MA 4IOOA 4MENA 4UIZA 4TYLA 4XYAA 3U5OA 5C85A 5I1QA 2RI7A 4Z1SA 4NUEA 4ZW1A 5CQTA 3U5LA 5ACYA 4LYSA 3LQHA 4O74A 2GRCA 4PTBA 4Z6IA 5DYXA 3U5KA 2E7NA 5FG5A 4A9LA 4HBYA 5E9YA 5F2PA 3JVJA 2DKWA 3IU5A 5C89A 5KHMA 4O77A 5AD2A 4KV4A 4O78A 4N4FA 3TLPA 5JWMA 5A5OA 3QZSA 2H60A 5CUEA 4A9EA 1JSPB 4NR7A 3IU6A 3DAIA 5CUBA 4NR8A 4UIVA 5HM0A 3O37A 5D26A 5AD3A 5FG4A 4QNSA 1F68A 1WUMA 3AQAA 4YH4A 3Q2EA 4UYGA 4Q0NA 4O76A 5D7XA 4ZQLA 4HXNA 4YYNA 4NYVA 5HENA 4YABA 3HMFA 3QZVA 4IORA 5EWHA 5EP7A 4MR4A 2WP2A 5A83A 5FDZA 4UIUA 4QUTA 4YATA 4FLPA 4MR3A 2I7KA 5DY7A 5ENCA 4A9OA 4YYMA 3P1DA 2YDWA 5IBNA 2WP1A 4A9JA 5E9VA 5ENFA 4NYWA 5ENJA 3LJWA 5G4RA 4CUQA 2YW5A 4NXJA 5CTLA 4QSUA 5DKHA 5F1LA 5C4QA 2L84A 4TT6A 3S92A 4PCEA 4J0RA 5CRZA 4CFLA 5I89A 5E74A 2YQDA 4LC2A 1EQFA 4TTEA 5EICA 4YBTA 5ENHA 5DYUA 5LKZA 5FFYA 4O7CA 5EA1A 4Y03A 5HLSA 4QC3A 4QSWA 5A85A 3ZYUA 5E7DA 4YYDA 2D82A 2FSAA 2DVSA 4NR9A 5CFWA 4QY4A 5H85A 4RVRA 5LJ1A 4HXOA 3UVDA 4HBWA 3SVHA 4QSPA 5EK9A 5FE7A 5D25A 4ALGA 4NYXA 5CQAA 5HRVA 5CQ6A 3P1EA 4XY9A 4DONA 2D9EA 5KTXA 4CFKA 5I40A 3MB3A 5A82A 4QB3A 4OGIA 4LZ2A 3ONIA 4TQNA 2RFJA 4O75A 3JVMA 5AMFA 4CUTA 5CQ3A 3QZTA 4CLBA 4NS5A 5E9LA 4NQNA 5CU8A 4QR5A 5ENBA 5FH7A 5DW1A 4YYIA 4LYWA 4KV1A 4AKNA 5FE9A 5LUUA 5CUGA 4QEWA 5LKXA 5IG6A 5HQ7A 5ENGA 4MEOA 5EPSA 4IOQA 3I3JA 5EPRA 4F3IA 5I29A 5F60A 4QR3A 4MEQA 4YY6A 4HBXA 4HBVA 5DLZA 5DYCA 4A9NA 5EQ1A 4A9KA 2RS9B 4QR4A 5E73A 2OO1A 4YAXA 4LZRA 3UV4A 5HCLA 5DLXA 4TT4A 5ETBA 5L96A 3FKMX 1X0JA 5E9IA 3UV5A 4BW4A 5G4SA 4NUDA 4HXLA 4QSRA 5EGUA 4IR4A 5A5SA 4YBSA 4IR6A 4QSSA 5LJ2A 3G0LA 5CQ4A 4UYFA 3U5NA 5A5RA 2KTBB 5F3AA 5D0CA 3G0JA 5DFCA 5E9MA 5HFQA 3AADA 5C7NA 1WUGA 4YH3A 5DKDA 5II2A 5D3LA 1JM4B 4BJXA 5A5QA 4N4IA 5HRXA 4NQMA 5IGLA 5BT5A 5LKUA 4UIYA 4IR3A 4QUUA 3O35A 5I80A 5EISA 3LQJA 5EWWA 2R10A 5CRMA 3UV2A 4LRGA 5D3NA 5ENIA 5DW2A 5D3TA 5L98A 5IGKA 4PKLA 5A5NA 2R0YA 4LZSA 5CUCA 5FH8A 5A81A 5IGNA 3SVFA 5DBMA 5EU1A 4NRAA 4HXPA 5HELA 5CUAA 4X2IA 5D3SA 5EPBA 3JVKA 4WIVA 4YYJA 2E7OA 4QEVA 5I86A 4WHUA 5EWVA 5FE3A 4TZ2A 5K29A 4O72A 5FFWA 4A9FA 5FB1A 4QYDA 5DX4A 4YY4A 4CUUA 4YYHA 4YADA 4YC9A 4IR5A 3P1FA 4NRCA 4TZ8A 1E6IA 5F62A 5D3RA 5E3GA 3D7CA 5FFVA 5BT3A 2LSPB 5HQ5A 2G4AA 4WHWA 5AMEA 5EV9A 2OUOA 5FG6A 5IIDA 5J0DA 4Q0OA 4N4GA 4YYGA 2DWWA 4NR4A 5FE4A 4PCIA 4HXMA 5FE8A 5II1A 4A9IA 4Z1QA
chains in the Genus database with same CATH superfamily
5I83A 5FE2A 4C67A 4HXKA 5CQ8A 5CQ7A 5L8UA 4J1PA 4QBMA 5CUDA 4XUBA 3DWYA 5HFRA 3O36A 2YEMA 4MR6A 4TU4A 5F1HA 5FE5A 3MQMA 2YELA 4HXSA 2R0VA 3RCWA 1N72A 5IGMA 1ZS5A 5I7XA 5CGPA 2L85A 5L99A 5LVQA 5A5PA 2DVVA 4QYLA 3U5PA 4MR5A 3LXJA 4QZSA 4MEPA 5CZGA 4O7BA 5EI4A 5FBXA 5H1TA 4O7AA 4XUAA 5FE0A 5LJ0A 4NUCA 5F5ZA 5I88A 4ZC9A 2YEKA 5EWDA 5H1UA 3UW9A 4C66A 3ERRA 4QSVA 2MJVB 3UVXA 3Q2FA 4E96A 3P1CA 2RNYA 5F63A 2DVRA 5FB0A 3K2JA 4N3WA 5CPEA 3MULA 4TU6A 4OUFA 4UIXA 3NXBA 4Z6HA 2R0SA 2RO1A 5CQ5A 4HXRA 4BW2A 5E9KA 4BHWA 4UIWA 5HEMA 5FE6A 3HMEA 4OGJA 4A9MA 4NRBA 4CUSA 4UYHA 4QSXA 2YYNA 5HRWA 4J0SA 5KTWA 2L5EA 4O70A 4QSQA 5BT4A 2N9GA 5D3JA 2EJNA 3O34A 4PY6A 5EWCA 5HJCA 5C87A 5F61A 4CURA 5ENEA 5E0RA 5TB6A 5HQ6A 3U5JA 2NXBA 2DATA 5L8TA 4UYEA 5ETDA 4YBMA 5F36A 5LKTA 4KCXA 4O71A 3HMHA 2F6NA 2RNWA 4BW3A 4NR6A 5LVRA 2E3KA 5I7YA 5KO4A 4QC1A 5F25A 4QSTA 5D3PA 3S91A 4TT2A 5DFDA 4CL9A 3VKGA 4PS5A 1ZKRA 4O7EA 4GPJA 4O7FA 4UYFB 5L97A 3P5OA 4LYIA 5COIA 5EVAA 4QEUA 5CY9A 3MB4A 3GG3A 4ALHA 4BW1A 5E3DA 5DYAA 4YK0A 3MXFA 4LR6A 5FH6A 5EM3A 4UITA 5JI8A 2DVQA 4TS8A 2I8NA 4J3IA 4CUPA 5DFBA 3LQIA 4XY8A 4LDFA 5KU3A 2F6JA 4NR5A 4A9HA 5H1VA 5D24A 3UVYA 3MUKA 5A7CA 4UYDA 5TCMA 2OSSA 5FE1A 5D3HA 3JVLA 5CP5A 3UVWA 4Z93A 5KTUA 4N4HA 4YYKA 3SVGA 3O33A 5C8GA 2RNXA 5CS8A 5DKCA 3U5MA 4IOOA 4MENA 4UIZA 4TYLA 4XYAA 3U5OA 5C85A 5I1QA 2RI7A 4Z1SA 4NUEA 4ZW1A 5CQTA 3U5LA 5ACYA 4LYSA 3LQHA 4O74A 2GRCA 4PTBA 4Z6IA 5DYXA 3U5KA 2E7NA 5FG5A 4A9LA 4HBYA 5E9YA 5F2PA 3JVJA 2DKWA 3IU5A 5C89A 5KHMA 4O77A 5AD2A 4KV4A 4O78A 4N4FA 3TLPA 5JWMA 5A5OA 3QZSA 2H60A 5CUEA 4A9EA 1JSPB 4NR7A 3IU6A 3DAIA 5CUBA 4NR8A 4UIVA 5HM0A 3O37A 5D26A 5AD3A 5FG4A 4QNSA 1F68A 1WUMA 3AQAA 4YH4A 3Q2EA 4UYGA 4Q0NA 4O76A 5D7XA 4ZQLA 4HXNA 4YYNA 4NYVA 5HENA 4YABA 3HMFA 3QZVA 4IORA 5EWHA 5EP7A 4MR4A 2WP2A 5A83A 5FDZA 4UIUA 4QUTA 4YATA 4FLPA 4MR3A 2I7KA 5DY7A 1PUOA 5ENCA 4A9OA 4YYMA 3P1DA 2YDWA 5IBNA 2WP1A 4A9JA 5E9VA 5ENFA 4NYWA 5ENJA 3LJWA 5G4RA 4CUQA 2YW5A 4NXJA 5CTLA 4QSUA 5DKHA 5F1LA 5C4QA 2L84A 4TT6A 3S92A 4PCEA 4J0RA 5CRZA 4CFLA 5I89A 5E74A 2YQDA 4LC2A 1EQFA 4TTEA 5EICA 4YBTA 5ENHA 5DYUA 5LKZA 5FFYA 4AI6A 4O7CA 5EA1A 4Y03A 5HLSA 4QC3A 4QSWA 5A85A 3ZYUA 5E7DA 4YYDA 2D82A 2FSAA 2DVSA 4NR9A 5CFWA 4QY4A 5H85A 4RVRA 5LJ1A 4HXOA 3UVDA 4HBWA 3SVHA 4QSPA 5EK9A 5FE7A 5D25A 4ALGA 4NYXA 5CQAA 5HRVA 5CQ6A 3P1EA 4XY9A 4DONA 2D9EA 5KTXA 4CFKA 5I40A 3MB3A 5A82A 4QB3A 4OGIA 4LZ2A 3ONIA 4TQNA 2RFJA 4O75A 3JVMA 5AMFA 3D1BA 4CUTA 5CQ3A 3QZTA 4CLBA 4NS5A 5E9LA 4NQNA 5CU8A 4QR5A 5ENBA 5FH7A 5DW1A 4YYIA 4LYWA 4KV1A 4AKNA 5FE9A 5LUUA 5CUGA 4QEWA 5LKXA 5IG6A 5HQ7A 5ENGA 4MEOA 5EPSA 4IOQA 3I3JA 5EPRA 4F3IA 5I29A 5F60A 4QR3A 4MEQA 4YY6A 4HBXA 4HBVA 5DLZA 5DYCA 4A9NA 5EQ1A 4A9KA 2RS9B 4QR4A 5E73A 2OO1A 4YAXA 4LZRA 3UV4A 5HCLA 5DLXA 4TT4A 5ETBA 5L96A 3FKMX 1X0JA 5E9IA 3UV5A 4BW4A 5G4SA 4NUDA 4AKHA 4HXLA 4QSRA 5EGUA 4IR4A 5A5SA 4YBSA 4IR6A 4QSSA 5LJ2A 3G0LA 5CQ4A 4UYFA 3U5NA 5A5RA 2KTBB 5F3AA 5D0CA 3G0JA 5DFCA 5E9MA 5HFQA 3AADA 5C7NA 1WUGA 4YH3A 5DKDA 5II2A 5D3LA 1JM4B 4BJXA 5A5QA 4N4IA 3VKHA 5HRXA 4NQMA 5IGLA 5BT5A 5LKUA 4UIYA 4IR3A 4QUUA 3O35A 5I80A 5EISA 3LQJA 5EWWA 2R10A 5CRMA 3UV2A 4LRGA 5D3NA 5ENIA 5DW2A 5D3TA 5L98A 5IGKA 4PKLA 3D1DA 5A5NA 2R0YA 4LZSA 5CUCA 5FH8A 5A81A 5IGNA 3SVFA 5DBMA 5EU1A 4NRAA 4HXPA 5HELA 5CUAA 4X2IA 5D3SA 5EPBA 3JVKA 4WIVA 4YYJA 2E7OA 4QEVA 5I86A 4WHUA 5EWVA 5FE3A 4TZ2A 5K29A 4O72A 5FFWA 4A9FA 5FB1A 4QYDA 5DX4A 4YY4A 4CUUA 4YYHA 4YADA 4YC9A 4IR5A 3P1FA 4NRCA 4TZ8A 1E6IA 5F62A 5D3RA 5E3GA 3D7CA 5FFVA 5BT3A 2LSPB 5HQ5A 2G4AA 4WHWA 5AMEA 4AKIA 5EV9A 2OUOA 5FG6A 5IIDA 5J0DA 4Q0OA 4N4GA 4YYGA 2DWWA 4NR4A 5FE4A 4PCIA 4HXMA 5FE8A 5II1A 4AKGA 4A9IA 4Z1QA
chains in the Genus database with same CATH topology
5I83A 5FE2A 4C67A 4HXKA 5CQ8A 5CQ7A 5L8UA 4J1PA 4QBMA 5CUDA 4XUBA 3DWYA 5HFRA 3O36A 2YEMA 4MR6A 4TU4A 5F1HA 5FE5A 3MQMA 2YELA 4HXSA 2R0VA 3RCWA 1N72A 5IGMA 1ZS5A 5I7XA 5CGPA 2L85A 5L99A 5LVQA 5A5PA 2DVVA 4QYLA 3U5PA 4MR5A 3LXJA 4QZSA 4MEPA 5CZGA 4O7BA 5EI4A 5FBXA 5H1TA 4O7AA 4XUAA 5FE0A 5LJ0A 4NUCA 5F5ZA 5I88A 4ZC9A 2YEKA 5EWDA 5H1UA 3UW9A 4C66A 4QSVA 2MJVB 3UVXA 3Q2FA 4E96A 3P1CA 2RNYA 5F63A 2DVRA 5FB0A 3K2JA 4N3WA 5CPEA 3MULA 4TU6A 4OUFA 4UIXA 3NXBA 4Z6HA 2R0SA 2RO1A 5CQ5A 4HXRA 4BW2A 5E9KA 4BHWA 4UIWA 5HEMA 5FE6A 3HMEA 4OGJA 4A9MA 4NRBA 4CUSA 4UYHA 4QSXA 2YYNA 5HRWA 4J0SA 5KTWA 2L5EA 4O70A 4QSQA 5BT4A 2N9GA 5D3JA 4PY6A 3O34A 5HJCA 5EWCA 5C87A 4CURA 5F61A 5ENEA 5E0RA 5TB6A 5HQ6A 3U5JA 2NXBA 2DATA 5L8TA 4UYEA 5ETDA 4YBMA 5F36A 5LKTA 4KCXA 4O71A 3HMHA 2F6NA 2RNWA 4BW3A 4NR6A 5LVRA 2E3KA 5I7YA 5KO4A 4QC1A 5F25A 4QSTA 5D3PA 3S91A 4TT2A 5DFDA 4CL9A 4PS5A 4O7EA 4GPJA 4O7FA 4UYFB 5L97A 3P5OA 4LYIA 5COIA 5EVAA 4QEUA 5CY9A 3MB4A 3GG3A 4ALHA 4BW1A 5E3DA 5DYAA 4YK0A 3MXFA 4LR6A 5FH6A 5EM3A 4UITA 5JI8A 2DVQA 4TS8A 2I8NA 4J3IA 4CUPA 5DFBA 3LQIA 4XY8A 4LDFA 5KU3A 2F6JA 4NR5A 4A9HA 5H1VA 5D24A 3UVYA 3MUKA 5A7CA 4UYDA 5TCMA 2OSSA 5FE1A 5D3HA 3JVLA 5CP5A 3UVWA 4Z93A 5KTUA 4N4HA 4YYKA 3SVGA 3O33A 5C8GA 2RNXA 5CS8A 5DKCA 3U5MA 4IOOA 4MENA 4UIZA 4TYLA 4XYAA 3U5OA 5C85A 5I1QA 2RI7A 4Z1SA 4NUEA 4ZW1A 5CQTA 3U5LA 5ACYA 4LYSA 3LQHA 4O74A 2GRCA 4PTBA 4Z6IA 5DYXA 3U5KA 2E7NA 5FG5A 4A9LA 4HBYA 5E9YA 5F2PA 3JVJA 2DKWA 3IU5A 5C89A 5KHMA 4O77A 5AD2A 4KV4A 4O78A 4N4FA 3TLPA 5JWMA 5A5OA 3QZSA 2H60A 5CUEA 4A9EA 1JSPB 4NR7A 3IU6A 3DAIA 5CUBA 4NR8A 4UIVA 5HM0A 3O37A 5D26A 5AD3A 5FG4A 4QNSA 1F68A 1WUMA 3AQAA 4YH4A 3Q2EA 4UYGA 4Q0NA 4O76A 5D7XA 4ZQLA 4HXNA 4YYNA 4NYVA 5HENA 4YABA 3HMFA 3QZVA 4IORA 5EWHA 5EP7A 4MR4A 2WP2A 5A83A 5FDZA 4UIUA 4QUTA 4YATA 4FLPA 4MR3A 2I7KA 5DY7A 5ENCA 4A9OA 4YYMA 3P1DA 2YDWA 5IBNA 2WP1A 4A9JA 5E9VA 5ENFA 4NYWA 5ENJA 3LJWA 5G4RA 4CUQA 2YW5A 4NXJA 5CTLA 4QSUA 5DKHA 5F1LA 5C4QA 2L84A 4TT6A 3S92A 4PCEA 4J0RA 5CRZA 4CFLA 5I89A 5E74A 2YQDA 4LC2A 1EQFA 4TTEA 5EICA 4YBTA 5ENHA 5DYUA 5LKZA 5FFYA 4O7CA 5EA1A 4Y03A 5HLSA 4QC3A 4QSWA 5A85A 3ZYUA 5E7DA 4YYDA 2D82A 2FSAA 2DVSA 4NR9A 5CFWA 4QY4A 5H85A 4RVRA 5LJ1A 4HXOA 3UVDA 4HBWA 3SVHA 4QSPA 5EK9A 5FE7A 5D25A 4ALGA 4NYXA 5CQAA 5HRVA 5CQ6A 3P1EA 4XY9A 4DONA 2D9EA 5KTXA 4CFKA 5I40A 3MB3A 5A82A 4QB3A 4OGIA 4LZ2A 3ONIA 4TQNA 2RFJA 4O75A 3JVMA 5AMFA 4CUTA 5CQ3A 3QZTA 4CLBA 4NS5A 5E9LA 4NQNA 5CU8A 4QR5A 5ENBA 5FH7A 5DW1A 4YYIA 4LYWA 4KV1A 4AKNA 5FE9A 5LUUA 5CUGA 4QEWA 5LKXA 5IG6A 5HQ7A 5ENGA 4MEOA 5EPSA 4IOQA 3I3JA 5EPRA 4F3IA 5I29A 5F60A 4QR3A 4MEQA 4YY6A 4HBXA 4HBVA 5DLZA 5DYCA 4A9NA 5EQ1A 4A9KA 2RS9B 4QR4A 5E73A 2OO1A 4YAXA 4LZRA 3UV4A 5HCLA 5DLXA 4TT4A 5ETBA 5L96A 3FKMX 1X0JA 5E9IA 3UV5A 4BW4A 5G4SA 4NUDA 4HXLA 4QSRA 5EGUA 4IR4A 5A5SA 4YBSA 4IR6A 4QSSA 5LJ2A 3G0LA 5CQ4A 4UYFA 3U5NA 5A5RA 2KTBB 5F3AA 5D0CA 3G0JA 5DFCA 5E9MA 5HFQA 3AADA 5C7NA 1WUGA 4YH3A 5DKDA 5II2A 5D3LA 1JM4B 4BJXA 5A5QA 4N4IA 5HRXA 4NQMA 5IGLA 5BT5A 5LKUA 4UIYA 4IR3A 4QUUA 3O35A 5I80A 5EISA 3LQJA 5EWWA 2R10A 5CRMA 3UV2A 4LRGA 5D3NA 5ENIA 5DW2A 5D3TA 5L98A 5IGKA 4PKLA 5A5NA 2R0YA 4LZSA 5CUCA 5FH8A 5A81A 5IGNA 3SVFA 5DBMA 5EU1A 4NRAA 4HXPA 5HELA 5CUAA 4X2IA 5D3SA 5EPBA 3JVKA 4WIVA 4YYJA 2E7OA 4QEVA 5I86A 4WHUA 5EWVA 5FE3A 4TZ2A 5K29A 4O72A 5FFWA 4A9FA 5FB1A 4QYDA 5DX4A 4YY4A 4CUUA 4YYHA 4YADA 4YC9A 4IR5A 3P1FA 4NRCA 4TZ8A 1E6IA 5F62A 5D3RA 5E3GA 3D7CA 5FFVA 5BT3A 2LSPB 5HQ5A 2G4AA 4WHWA 5AMEA 5EV9A 2OUOA 5FG6A 5IIDA 5J0DA 4Q0OA 4N4GA 4YYGA 2DWWA 4NR4A 5FE4A 4PCIA 4HXMA 5FE8A 5II1A 4A9IA 4Z1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I83 A;  5FE2 A;  4C67 A;  4HXK A;  5CQ8 A;  5CQ7 A;  5L8U A;  4J1P A;  4QBM A;  5CUD A;  4XUB A;  3DWY A;  5HFR A;  3O36 A;  2YEM A;  4MR6 A;  4TU4 A;  5F1H A;  5FE5 A;  3MQM A;  2YEL A;  4HXS A;  2R0V A;  3RCW A;  1N72 A;  5IGM A;  1ZS5 A;  5I7X A;  5CGP A;  2L85 A;  5L99 A;  5LVQ A;  5A5P A;  2DVV A;  4QYL A;  3U5P A;  4MR5 A;  3LXJ A;  4QZS A;  4MEP A;  5CZG A;  4O7B A;  5EI4 A;  5FBX A;  5H1T A;  4O7A A;  4XUA A;  5FE0 A;  5LJ0 A;  4NUC A;  5F5Z A;  5I88 A;  4ZC9 A;  2YEK A;  5EWD A;  5H1U A;  3UW9 A;  4C66 A;  4QSV A;  2MJV B;  3UVX A;  3Q2F A;  4E96 A;  3P1C A;  2RNY A;  5F63 A;  2DVR A;  5FB0 A;  3K2J A;  4N3W A;  5CPE A;  3MUL A;  4TU6 A;  4OUF A;  4UIX A;  3NXB A;  4Z6H A;  2R0S A;  2RO1 A;  5CQ5 A;  4HXR A;  4BW2 A;  5E9K A;  4BHW A;  4UIW A;  5HEM A;  5FE6 A;  3HME A;  4OGJ A;  4A9M A;  4NRB A;  4CUS A;  4UYH A;  4QSX A;  2YYN A;  5HRW A;  4J0S A;  5KTW A;  2L5E A;  4O70 A;  4QSQ A;  5BT4 A;  2N9G A;  5D3J A;  4PY6 A;  3O34 A;  5HJC A;  5EWC A;  5C87 A;  4CUR A;  5F61 A;  5ENE A;  5E0R A;  5TB6 A;  5HQ6 A;  3U5J A;  2NXB A;  2DAT A;  5L8T A;  4UYE A;  5ETD A;  4YBM A;  5F36 A;  5LKT A;  4KCX A;  4O71 A;  3HMH A;  2F6N A;  2RNW A;  4BW3 A;  4NR6 A;  5LVR A;  2E3K A;  5I7Y A;  5KO4 A;  4QC1 A;  5F25 A;  4QST A;  5D3P A;  3S91 A;  4TT2 A;  5DFD A;  4CL9 A;  4PS5 A;  4O7E A;  4GPJ A;  4O7F A;  4UYF B;  5L97 A;  3P5O A;  4LYI A;  5COI A;  5EVA A;  4QEU A;  5CY9 A;  3MB4 A;  3GG3 A;  4ALH A;  4BW1 A;  5E3D A;  5DYA A;  4YK0 A;  3MXF A;  4LR6 A;  5FH6 A;  5EM3 A;  4UIT A;  5JI8 A;  2DVQ A;  4TS8 A;  2I8N A;  4J3I A;  4CUP A;  5DFB A;  3LQI A;  4XY8 A;  4LDF A;  5KU3 A;  2F6J A;  4NR5 A;  4A9H A;  5H1V A;  5D24 A;  3UVY A;  3MUK A;  5A7C A;  4UYD A;  5TCM A;  2OSS A;  5FE1 A;  5D3H A;  3JVL A;  5CP5 A;  3UVW A;  4Z93 A;  5KTU A;  4N4H A;  4YYK A;  3SVG A;  3O33 A;  5C8G A;  2RNX A;  5CS8 A;  5DKC A;  3U5M A;  4IOO A;  4MEN A;  4UIZ A;  4TYL A;  4XYA A;  3U5O A;  5C85 A;  5I1Q A;  2RI7 A;  4Z1S A;  4NUE A;  4ZW1 A;  5CQT A;  3U5L A;  5ACY A;  4LYS A;  3LQH A;  4O74 A;  2GRC A;  4PTB A;  4Z6I A;  5DYX A;  3U5K A;  2E7N A;  5FG5 A;  4A9L A;  4HBY A;  5E9Y A;  5F2P A;  3JVJ A;  2DKW A;  3IU5 A;  5C89 A;  5KHM A;  4O77 A;  5AD2 A;  4KV4 A;  4O78 A;  4N4F A;  3TLP A;  5JWM A;  5A5O A;  3QZS A;  2H60 A;  5CUE A;  4A9E A;  1JSP B;  4NR7 A;  3IU6 A;  3DAI A;  5CUB A;  4NR8 A;  4UIV A;  5HM0 A;  3O37 A;  5D26 A;  5AD3 A;  5FG4 A;  4QNS A;  1F68 A;  1WUM A;  3AQA A;  4YH4 A;  3Q2E A;  4UYG A;  4Q0N A;  4O76 A;  5D7X A;  4ZQL A;  4HXN A;  4YYN A;  4NYV A;  5HEN A;  4YAB A;  3HMF A;  3QZV A;  4IOR A;  5EWH A;  5EP7 A;  4MR4 A;  2WP2 A;  5A83 A;  5FDZ A;  4UIU A;  4QUT A;  4YAT A;  4FLP A;  4MR3 A;  2I7K A;  5DY7 A;  5ENC A;  4A9O A;  4YYM A;  3P1D A;  2YDW A;  5IBN A;  2WP1 A;  4A9J A;  5E9V A;  5ENF A;  4NYW A;  5ENJ A;  3LJW A;  5G4R A;  4CUQ A;  2YW5 A;  4NXJ A;  5CTL A;  4QSU A;  5DKH A;  5F1L A;  5C4Q A;  2L84 A;  4TT6 A;  3S92 A;  4PCE A;  4J0R A;  5CRZ A;  4CFL A;  5I89 A;  5E74 A;  2YQD A;  4LC2 A;  1EQF A;  4TTE A;  5EIC A;  4YBT A;  5ENH A;  5DYU A;  5LKZ A;  5FFY A;  4O7C A;  5EA1 A;  4Y03 A;  5HLS A;  4QC3 A;  4QSW A;  5A85 A;  3ZYU A;  5E7D A;  4YYD A;  2D82 A;  2FSA A;  2DVS A;  4NR9 A;  5CFW A;  4QY4 A;  5H85 A;  4RVR A;  5LJ1 A;  4HXO A;  3UVD A;  4HBW A;  3SVH A;  4QSP A;  5EK9 A;  5FE7 A;  5D25 A;  4ALG A;  4NYX A;  5CQA A;  5HRV A;  5CQ6 A;  3P1E A;  4XY9 A;  4DON A;  2D9E A;  5KTX A;  4CFK A;  5I40 A;  3MB3 A;  5A82 A;  4QB3 A;  4OGI A;  4LZ2 A;  3ONI A;  4TQN A;  2RFJ A;  4O75 A;  3JVM A;  5AMF A;  4CUT A;  5CQ3 A;  3QZT A;  4CLB A;  4NS5 A;  5E9L A;  4NQN A;  5CU8 A;  4QR5 A;  5ENB A;  5FH7 A;  5DW1 A;  4YYI A;  4LYW A;  4KV1 A;  4AKN A;  5FE9 A;  5LUU A;  5CUG A;  4QEW A;  5LKX A;  5IG6 A;  5HQ7 A;  5ENG A;  4MEO A;  5EPS A;  4IOQ A;  3I3J A;  5EPR A;  4F3I A;  5I29 A;  5F60 A;  4QR3 A;  4MEQ A;  4YY6 A;  4HBX A;  4HBV A;  5DLZ A;  5DYC A;  4A9N A;  5EQ1 A;  4A9K A;  2RS9 B;  4QR4 A;  5E73 A;  2OO1 A;  4YAX A;  4LZR A;  3UV4 A;  5HCL A;  5DLX A;  4TT4 A;  5ETB A;  5L96 A;  3FKM X;  1X0J A;  5E9I A;  3UV5 A;  4BW4 A;  5G4S A;  4NUD A;  4HXL A;  4QSR A;  5EGU A;  4IR4 A;  5A5S A;  4YBS A;  4IR6 A;  4QSS A;  5LJ2 A;  3G0L A;  5CQ4 A;  4UYF A;  3U5N A;  5A5R A;  2KTB B;  5F3A A;  5D0C A;  3G0J A;  5DFC A;  5E9M A;  5HFQ A;  3AAD A;  5C7N A;  1WUG A;  4YH3 A;  5DKD A;  5II2 A;  5D3L A;  1JM4 B;  4BJX A;  5A5Q A;  4N4I A;  5HRX A;  4NQM A;  5IGL A;  5BT5 A;  5LKU A;  4UIY A;  4IR3 A;  4QUU A;  3O35 A;  5I80 A;  5EIS A;  3LQJ A;  5EWW A;  2R10 A;  5CRM A;  3UV2 A;  4LRG A;  5D3N A;  5ENI A;  5DW2 A;  5D3T A;  5L98 A;  5IGK A;  4PKL A;  5A5N A;  2R0Y A;  4LZS A;  5CUC A;  5FH8 A;  5A81 A;  5IGN A;  3SVF A;  5DBM A;  5EU1 A;  4NRA A;  4HXP A;  5HEL A;  5CUA A;  4X2I A;  5D3S A;  5EPB A;  3JVK A;  4WIV A;  4YYJ A;  2E7O A;  4QEV A;  5I86 A;  4WHU A;  5EWV A;  5FE3 A;  4TZ2 A;  5K29 A;  4O72 A;  5FFW A;  4A9F A;  5FB1 A;  4QYD A;  5DX4 A;  4YY4 A;  4CUU A;  4YYH A;  4YAD A;  4YC9 A;  4IR5 A;  3P1F A;  4NRC A;  4TZ8 A;  1E6I A;  5F62 A;  5D3R A;  5E3G A;  3D7C A;  5FFV A;  5BT3 A;  2LSP B;  5HQ5 A;  2G4A A;  4WHW A;  5AME A;  5EV9 A;  2OUO A;  5FG6 A;  5IID A;  5J0D A;  4Q0O A;  4N4G A;  4YYG A;  2DWW A;  4NR4 A;  5FE4 A;  4PCI A;  4HXM A;  5FE8 A;  5II1 A;  4A9I A;  4Z1Q A; 
#chains in the Genus database with same CATH topology
 5I83 A;  5FE2 A;  4C67 A;  4HXK A;  5CQ8 A;  5CQ7 A;  5L8U A;  4J1P A;  4QBM A;  5CUD A;  4XUB A;  3DWY A;  5HFR A;  3O36 A;  2YEM A;  4MR6 A;  4TU4 A;  5F1H A;  5FE5 A;  3MQM A;  2YEL A;  4HXS A;  2R0V A;  3RCW A;  1N72 A;  5IGM A;  1ZS5 A;  5I7X A;  5CGP A;  2L85 A;  5L99 A;  5LVQ A;  5A5P A;  2DVV A;  4QYL A;  3U5P A;  4MR5 A;  3LXJ A;  4QZS A;  4MEP A;  5CZG A;  4O7B A;  5EI4 A;  5FBX A;  5H1T A;  4O7A A;  4XUA A;  5FE0 A;  5LJ0 A;  4NUC A;  5F5Z A;  5I88 A;  4ZC9 A;  2YEK A;  5EWD A;  5H1U A;  3UW9 A;  4C66 A;  3ERR A;  4QSV A;  2MJV B;  3UVX A;  3Q2F A;  4E96 A;  3P1C A;  2RNY A;  5F63 A;  2DVR A;  5FB0 A;  3K2J A;  4N3W A;  5CPE A;  3MUL A;  4TU6 A;  4OUF A;  4UIX A;  3NXB A;  4Z6H A;  2R0S A;  2RO1 A;  5CQ5 A;  4HXR A;  4BW2 A;  5E9K A;  4BHW A;  4UIW A;  5HEM A;  5FE6 A;  3HME A;  4OGJ A;  4A9M A;  4NRB A;  4CUS A;  4UYH A;  4QSX A;  2YYN A;  5HRW A;  4J0S A;  5KTW A;  2L5E A;  4O70 A;  4QSQ A;  5BT4 A;  2N9G A;  5D3J A;  2EJN A;  3O34 A;  4PY6 A;  5EWC A;  5HJC A;  5C87 A;  5F61 A;  4CUR A;  5ENE A;  5E0R A;  5TB6 A;  5HQ6 A;  3U5J A;  2NXB A;  2DAT A;  5L8T A;  4UYE A;  5ETD A;  4YBM A;  5F36 A;  5LKT A;  4KCX A;  4O71 A;  3HMH A;  2F6N A;  2RNW A;  4BW3 A;  4NR6 A;  5LVR A;  2E3K A;  5I7Y A;  5KO4 A;  4QC1 A;  5F25 A;  4QST A;  5D3P A;  3S91 A;  4TT2 A;  5DFD A;  4CL9 A;  3VKG A;  4PS5 A;  1ZKR A;  4O7E A;  4GPJ A;  4O7F A;  4UYF B;  5L97 A;  3P5O A;  4LYI A;  5COI A;  5EVA A;  4QEU A;  5CY9 A;  3MB4 A;  3GG3 A;  4ALH A;  4BW1 A;  5E3D A;  5DYA A;  4YK0 A;  3MXF A;  4LR6 A;  5FH6 A;  5EM3 A;  4UIT A;  5JI8 A;  2DVQ A;  4TS8 A;  2I8N A;  4J3I A;  4CUP A;  5DFB A;  3LQI A;  4XY8 A;  4LDF A;  5KU3 A;  2F6J A;  4NR5 A;  4A9H A;  5H1V A;  5D24 A;  3UVY A;  3MUK A;  5A7C A;  4UYD A;  5TCM A;  2OSS A;  5FE1 A;  5D3H A;  3JVL A;  5CP5 A;  3UVW A;  4Z93 A;  5KTU A;  4N4H A;  4YYK A;  3SVG A;  3O33 A;  5C8G A;  2RNX A;  5CS8 A;  5DKC A;  3U5M A;  4IOO A;  4MEN A;  4UIZ A;  4TYL A;  4XYA A;  3U5O A;  5C85 A;  5I1Q A;  2RI7 A;  4Z1S A;  4NUE A;  4ZW1 A;  5CQT A;  3U5L A;  5ACY A;  4LYS A;  3LQH A;  4O74 A;  2GRC A;  4PTB A;  4Z6I A;  5DYX A;  3U5K A;  2E7N A;  5FG5 A;  4A9L A;  4HBY A;  5E9Y A;  5F2P A;  3JVJ A;  2DKW A;  3IU5 A;  5C89 A;  5KHM A;  4O77 A;  5AD2 A;  4KV4 A;  4O78 A;  4N4F A;  3TLP A;  5JWM A;  5A5O A;  3QZS A;  2H60 A;  5CUE A;  4A9E A;  1JSP B;  4NR7 A;  3IU6 A;  3DAI A;  5CUB A;  4NR8 A;  4UIV A;  5HM0 A;  3O37 A;  5D26 A;  5AD3 A;  5FG4 A;  4QNS A;  1F68 A;  1WUM A;  3AQA A;  4YH4 A;  3Q2E A;  4UYG A;  4Q0N A;  4O76 A;  5D7X A;  4ZQL A;  4HXN A;  4YYN A;  4NYV A;  5HEN A;  4YAB A;  3HMF A;  3QZV A;  4IOR A;  5EWH A;  5EP7 A;  4MR4 A;  2WP2 A;  5A83 A;  5FDZ A;  4UIU A;  4QUT A;  4YAT A;  4FLP A;  4MR3 A;  2I7K A;  5DY7 A;  1PUO A;  5ENC A;  4A9O A;  4YYM A;  3P1D A;  2YDW A;  5IBN A;  2WP1 A;  4A9J A;  5E9V A;  5ENF A;  4NYW A;  5ENJ A;  3LJW A;  5G4R A;  4CUQ A;  2YW5 A;  4NXJ A;  5CTL A;  4QSU A;  5DKH A;  5F1L A;  5C4Q A;  2L84 A;  4TT6 A;  3S92 A;  4PCE A;  4J0R A;  5CRZ A;  4CFL A;  5I89 A;  5E74 A;  2YQD A;  4LC2 A;  1EQF A;  4TTE A;  5EIC A;  4YBT A;  5ENH A;  5DYU A;  5LKZ A;  5FFY A;  4AI6 A;  4O7C A;  5EA1 A;  4Y03 A;  5HLS A;  4QC3 A;  4QSW A;  5A85 A;  3ZYU A;  5E7D A;  4YYD A;  2D82 A;  2FSA A;  2DVS A;  4NR9 A;  5CFW A;  4QY4 A;  5H85 A;  4RVR A;  5LJ1 A;  4HXO A;  3UVD A;  4HBW A;  3SVH A;  4QSP A;  5EK9 A;  5FE7 A;  5D25 A;  4ALG A;  4NYX A;  5CQA A;  5HRV A;  5CQ6 A;  3P1E A;  4XY9 A;  4DON A;  2D9E A;  5KTX A;  4CFK A;  5I40 A;  3MB3 A;  5A82 A;  4QB3 A;  4OGI A;  4LZ2 A;  3ONI A;  4TQN A;  2RFJ A;  4O75 A;  3JVM A;  5AMF A;  3D1B A;  4CUT A;  5CQ3 A;  3QZT A;  4CLB A;  4NS5 A;  5E9L A;  4NQN A;  5CU8 A;  4QR5 A;  5ENB A;  5FH7 A;  5DW1 A;  4YYI A;  4LYW A;  4KV1 A;  4AKN A;  5FE9 A;  5LUU A;  5CUG A;  4QEW A;  5LKX A;  5IG6 A;  5HQ7 A;  5ENG A;  4MEO A;  5EPS A;  4IOQ A;  3I3J A;  5EPR A;  4F3I A;  5I29 A;  5F60 A;  4QR3 A;  4MEQ A;  4YY6 A;  4HBX A;  4HBV A;  5DLZ A;  5DYC A;  4A9N A;  5EQ1 A;  4A9K A;  2RS9 B;  4QR4 A;  5E73 A;  2OO1 A;  4YAX A;  4LZR A;  3UV4 A;  5HCL A;  5DLX A;  4TT4 A;  5ETB A;  5L96 A;  3FKM X;  1X0J A;  5E9I A;  3UV5 A;  4BW4 A;  5G4S A;  4NUD A;  4AKH A;  4HXL A;  4QSR A;  5EGU A;  4IR4 A;  5A5S A;  4YBS A;  4IR6 A;  4QSS A;  5LJ2 A;  3G0L A;  5CQ4 A;  4UYF A;  3U5N A;  5A5R A;  2KTB B;  5F3A A;  5D0C A;  3G0J A;  5DFC A;  5E9M A;  5HFQ A;  3AAD A;  5C7N A;  1WUG A;  4YH3 A;  5DKD A;  5II2 A;  5D3L A;  1JM4 B;  4BJX A;  5A5Q A;  4N4I A;  3VKH A;  5HRX A;  4NQM A;  5IGL A;  5BT5 A;  5LKU A;  4UIY A;  4IR3 A;  4QUU A;  3O35 A;  5I80 A;  5EIS A;  3LQJ A;  5EWW A;  2R10 A;  5CRM A;  3UV2 A;  4LRG A;  5D3N A;  5ENI A;  5DW2 A;  5D3T A;  5L98 A;  5IGK A;  4PKL A;  3D1D A;  5A5N A;  2R0Y A;  4LZS A;  5CUC A;  5FH8 A;  5A81 A;  5IGN A;  3SVF A;  5DBM A;  5EU1 A;  4NRA A;  4HXP A;  5HEL A;  5CUA A;  4X2I A;  5D3S A;  5EPB A;  3JVK A;  4WIV A;  4YYJ A;  2E7O A;  4QEV A;  5I86 A;  4WHU A;  5EWV A;  5FE3 A;  4TZ2 A;  5K29 A;  4O72 A;  5FFW A;  4A9F A;  5FB1 A;  4QYD A;  5DX4 A;  4YY4 A;  4CUU A;  4YYH A;  4YAD A;  4YC9 A;  4IR5 A;  3P1F A;  4NRC A;  4TZ8 A;  1E6I A;  5F62 A;  5D3R A;  5E3G A;  3D7C A;  5FFV A;  5BT3 A;  2LSP B;  5HQ5 A;  2G4A A;  4WHW A;  5AME A;  4AKI A;  5EV9 A;  2OUO A;  5FG6 A;  5IID A;  5J0D A;  4Q0O A;  4N4G A;  4YYG A;  2DWW A;  4NR4 A;  5FE4 A;  4PCI A;  4HXM A;  5FE8 A;  5II1 A;  4AKG A;  4A9I A;  4Z1Q A; 
#chains in the Genus database with same CATH homology
 5I83 A;  5FE2 A;  4C67 A;  4HXK A;  5CQ8 A;  5CQ7 A;  5L8U A;  4J1P A;  4QBM A;  5CUD A;  4XUB A;  3DWY A;  5HFR A;  3O36 A;  2YEM A;  4MR6 A;  4TU4 A;  5F1H A;  5FE5 A;  3MQM A;  2YEL A;  4HXS A;  2R0V A;  3RCW A;  1N72 A;  5IGM A;  1ZS5 A;  5I7X A;  5CGP A;  2L85 A;  5L99 A;  5LVQ A;  5A5P A;  2DVV A;  4QYL A;  3U5P A;  4MR5 A;  3LXJ A;  4QZS A;  4MEP A;  5CZG A;  4O7B A;  5EI4 A;  5FBX A;  5H1T A;  4O7A A;  4XUA A;  5FE0 A;  5LJ0 A;  4NUC A;  5F5Z A;  5I88 A;  4ZC9 A;  2YEK A;  5EWD A;  5H1U A;  3UW9 A;  4C66 A;  4QSV A;  2MJV B;  3UVX A;  3Q2F A;  4E96 A;  3P1C A;  2RNY A;  5F63 A;  2DVR A;  5FB0 A;  3K2J A;  4N3W A;  5CPE A;  3MUL A;  4TU6 A;  4OUF A;  4UIX A;  3NXB A;  4Z6H A;  2R0S A;  2RO1 A;  5CQ5 A;  4HXR A;  4BW2 A;  5E9K A;  4BHW A;  4UIW A;  5HEM A;  5FE6 A;  3HME A;  4OGJ A;  4A9M A;  4NRB A;  4CUS A;  4UYH A;  4QSX A;  2YYN A;  5HRW A;  4J0S A;  5KTW A;  2L5E A;  4O70 A;  4QSQ A;  5BT4 A;  2N9G A;  5D3J A;  4PY6 A;  3O34 A;  5HJC A;  5EWC A;  5C87 A;  4CUR A;  5F61 A;  5ENE A;  5E0R A;  5TB6 A;  5HQ6 A;  3U5J A;  2NXB A;  2DAT A;  5L8T A;  4UYE A;  5ETD A;  4YBM A;  5F36 A;  5LKT A;  4KCX A;  4O71 A;  3HMH A;  2F6N A;  2RNW A;  4BW3 A;  4NR6 A;  5LVR A;  2E3K A;  5I7Y A;  5KO4 A;  4QC1 A;  5F25 A;  4QST A;  5D3P A;  3S91 A;  4TT2 A;  5DFD A;  4CL9 A;  4PS5 A;  4O7E A;  4GPJ A;  4O7F A;  4UYF B;  5L97 A;  3P5O A;  4LYI A;  5COI A;  5EVA A;  4QEU A;  5CY9 A;  3MB4 A;  3GG3 A;  4ALH A;  4BW1 A;  5E3D A;  5DYA A;  4YK0 A;  3MXF A;  4LR6 A;  5FH6 A;  5EM3 A;  4UIT A;  5JI8 A;  2DVQ A;  4TS8 A;  2I8N A;  4J3I A;  4CUP A;  5DFB A;  3LQI A;  4XY8 A;  4LDF A;  5KU3 A;  2F6J A;  4NR5 A;  4A9H A;  5H1V A;  5D24 A;  3UVY A;  3MUK A;  5A7C A;  4UYD A;  5TCM A;  2OSS A;  5FE1 A;  5D3H A;  3JVL A;  5CP5 A;  3UVW A;  4Z93 A;  5KTU A;  4N4H A;  4YYK A;  3SVG A;  3O33 A;  5C8G A;  2RNX A;  5CS8 A;  5DKC A;  3U5M A;  4IOO A;  4MEN A;  4UIZ A;  4TYL A;  4XYA A;  3U5O A;  5C85 A;  5I1Q A;  2RI7 A;  4Z1S A;  4NUE A;  4ZW1 A;  5CQT A;  3U5L A;  5ACY A;  4LYS A;  3LQH A;  4O74 A;  2GRC A;  4PTB A;  4Z6I A;  5DYX A;  3U5K A;  2E7N A;  5FG5 A;  4A9L A;  4HBY A;  5E9Y A;  5F2P A;  3JVJ A;  2DKW A;  3IU5 A;  5C89 A;  5KHM A;  4O77 A;  5AD2 A;  4KV4 A;  4O78 A;  4N4F A;  3TLP A;  5JWM A;  5A5O A;  3QZS A;  2H60 A;  5CUE A;  4A9E A;  1JSP B;  4NR7 A;  3IU6 A;  3DAI A;  5CUB A;  4NR8 A;  4UIV A;  5HM0 A;  3O37 A;  5D26 A;  5AD3 A;  5FG4 A;  4QNS A;  1F68 A;  1WUM A;  3AQA A;  4YH4 A;  3Q2E A;  4UYG A;  4Q0N A;  4O76 A;  5D7X A;  4ZQL A;  4HXN A;  4YYN A;  4NYV A;  5HEN A;  4YAB A;  3HMF A;  3QZV A;  4IOR A;  5EWH A;  5EP7 A;  4MR4 A;  2WP2 A;  5A83 A;  5FDZ A;  4UIU A;  4QUT A;  4YAT A;  4FLP A;  4MR3 A;  2I7K A;  5DY7 A;  5ENC A;  4A9O A;  4YYM A;  3P1D A;  2YDW A;  5IBN A;  2WP1 A;  4A9J A;  5E9V A;  5ENF A;  4NYW A;  5ENJ A;  3LJW A;  5G4R A;  4CUQ A;  2YW5 A;  4NXJ A;  5CTL A;  4QSU A;  5DKH A;  5F1L A;  5C4Q A;  2L84 A;  4TT6 A;  3S92 A;  4PCE A;  4J0R A;  5CRZ A;  4CFL A;  5I89 A;  5E74 A;  2YQD A;  4LC2 A;  1EQF A;  4TTE A;  5EIC A;  4YBT A;  5ENH A;  5DYU A;  5LKZ A;  5FFY A;  4O7C A;  5EA1 A;  4Y03 A;  5HLS A;  4QC3 A;  4QSW A;  5A85 A;  3ZYU A;  5E7D A;  4YYD A;  2D82 A;  2FSA A;  2DVS A;  4NR9 A;  5CFW A;  4QY4 A;  5H85 A;  4RVR A;  5LJ1 A;  4HXO A;  3UVD A;  4HBW A;  3SVH A;  4QSP A;  5EK9 A;  5FE7 A;  5D25 A;  4ALG A;  4NYX A;  5CQA A;  5HRV A;  5CQ6 A;  3P1E A;  4XY9 A;  4DON A;  2D9E A;  5KTX A;  4CFK A;  5I40 A;  3MB3 A;  5A82 A;  4QB3 A;  4OGI A;  4LZ2 A;  3ONI A;  4TQN A;  2RFJ A;  4O75 A;  3JVM A;  5AMF A;  4CUT A;  5CQ3 A;  3QZT A;  4CLB A;  4NS5 A;  5E9L A;  4NQN A;  5CU8 A;  4QR5 A;  5ENB A;  5FH7 A;  5DW1 A;  4YYI A;  4LYW A;  4KV1 A;  4AKN A;  5FE9 A;  5LUU A;  5CUG A;  4QEW A;  5LKX A;  5IG6 A;  5HQ7 A;  5ENG A;  4MEO A;  5EPS A;  4IOQ A;  3I3J A;  5EPR A;  4F3I A;  5I29 A;  5F60 A;  4QR3 A;  4MEQ A;  4YY6 A;  4HBX A;  4HBV A;  5DLZ A;  5DYC A;  4A9N A;  5EQ1 A;  4A9K A;  2RS9 B;  4QR4 A;  5E73 A;  2OO1 A;  4YAX A;  4LZR A;  3UV4 A;  5HCL A;  5DLX A;  4TT4 A;  5ETB A;  5L96 A;  3FKM X;  1X0J A;  5E9I A;  3UV5 A;  4BW4 A;  5G4S A;  4NUD A;  4HXL A;  4QSR A;  5EGU A;  4IR4 A;  5A5S A;  4YBS A;  4IR6 A;  4QSS A;  5LJ2 A;  3G0L A;  5CQ4 A;  4UYF A;  3U5N A;  5A5R A;  2KTB B;  5F3A A;  5D0C A;  3G0J A;  5DFC A;  5E9M A;  5HFQ A;  3AAD A;  5C7N A;  1WUG A;  4YH3 A;  5DKD A;  5II2 A;  5D3L A;  1JM4 B;  4BJX A;  5A5Q A;  4N4I A;  5HRX A;  4NQM A;  5IGL A;  5BT5 A;  5LKU A;  4UIY A;  4IR3 A;  4QUU A;  3O35 A;  5I80 A;  5EIS A;  3LQJ A;  5EWW A;  2R10 A;  5CRM A;  3UV2 A;  4LRG A;  5D3N A;  5ENI A;  5DW2 A;  5D3T A;  5L98 A;  5IGK A;  4PKL A;  5A5N A;  2R0Y A;  4LZS A;  5CUC A;  5FH8 A;  5A81 A;  5IGN A;  3SVF A;  5DBM A;  5EU1 A;  4NRA A;  4HXP A;  5HEL A;  5CUA A;  4X2I A;  5D3S A;  5EPB A;  3JVK A;  4WIV A;  4YYJ A;  2E7O A;  4QEV A;  5I86 A;  4WHU A;  5EWV A;  5FE3 A;  4TZ2 A;  5K29 A;  4O72 A;  5FFW A;  4A9F A;  5FB1 A;  4QYD A;  5DX4 A;  4YY4 A;  4CUU A;  4YYH A;  4YAD A;  4YC9 A;  4IR5 A;  3P1F A;  4NRC A;  4TZ8 A;  1E6I A;  5F62 A;  5D3R A;  5E3G A;  3D7C A;  5FFV A;  5BT3 A;  2LSP B;  5HQ5 A;  2G4A A;  4WHW A;  5AME A;  5EV9 A;  2OUO A;  5FG6 A;  5IID A;  5J0D A;  4Q0O A;  4N4G A;  4YYG A;  2DWW A;  4NR4 A;  5FE4 A;  4PCI A;  4HXM A;  5FE8 A;  5II1 A;  4A9I A;  4Z1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...