3SVHA

Crystal structure of the bromdomain of human crebbp in complex with a 3,5-dimethylisoxazol ligand
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
117
structure length
117
Chain Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords CREB-binding protein
publication title Crystal Structure of the bromdomain of human CREBBP in complex with a 3,5-dimethylisoxazol ligand
rcsb
source organism Homo sapiens
total genus 43
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3svhA00
5FG5A 3ONIA 5FFWA 4UYFA 5ENJA 4N4GA 4TS8A 5LKXA 5CP5A 2F6JA 2FSAA 4WHUA 4QYLA 4QSWA 4YY6A 4BW4A 4QSVA 5CUBA 4Z6HA 4UYGA 5HQ7A 5CUAA 5I7XA 4YYKA 3U5NA 4BW1A 5ENBA 5FE6A 5D25A 5L98A 3DWYA 3U5JA 2R0YA 4CL9A 3JVLA 3Q2EA 5HELA 5ENFA 2YYNA 5A83A 5A5OA 3IU6A 2RNWA 4LR6A 4N4IA 4KCXA 4O75A 4QSTA 2DVRA 3RCWA 4CLBA 4F3IA 5FE0A 4ALGA 5E3DA 3UVWA 4PCIA 2D82A 4FLPA 5FH7A 5C4QA 5KTUA 1F68A 4ZW1A 4NR7A 4QC1A 4A9NA 5KTWA 3MULA 5IGNA 4ZQLA 4UYDA 3UV2A 2DVSA 5F62A 5DY7A 5LJ0A 5C7NA 4UIWA 4CUUA 4NQMA 2RNXA 2DKWA 2D9EA 5D0CA 5BT3A 5EU1A 3P1EA 3Q2FA 3SVGA 5HQ6A 4QSRA 5IBNA 4KV4A 5EPBA 5LVRA 5IGMA 5E9KA 5FG4A 5D3SA 4QNSA 4HBWA 5CQ6A 5EP7A 4PS5A 5DKCA 5CQTA 5FFYA 5F61A 4N4FA 2WP1A 5FE5A 4LZ2A 3MUKA 4GPJA 3NXBA 4LRGA 5I29A 5DYUA 5C8GA 4Z1SA 5A7CA 3SVHA 5AD3A 4XUBA 5CUGA 5E0RA 5E9VA 5DFCA 2GRCA 4KV1A 5L96A 3U5OA 5EK9A 3MXFA 5JI8A 4C67A 2YQDA 2DVVA 4O7FA 4Q0NA 4CUQA 1WUMA 5FBXA 5D3TA 2E7NA 4O70A 3UV4A 3UV5A 5L8UA 3UW9A 4NR6A 4J0SA 5A5RA 1JSPB 4MENA 2L85A 3MQMA 4NRCA 4OUFA 4QZSA 2NXBA 4NQNA 4Y03A 4MR6A 2OO1A 5FB1A 5CFWA 5CUCA 3JVKA 4PCEA 5F60A 5ACYA 5ENEA 5D3HA 1JM4B 3D7CA 4QEUA 4QYDA 4YH3A 5E9IA 5HFQA 3UVDA 4LZSA 4HXRA 5KO4A 5F63A 4QSUA 4ALHA 5I40A 5DLXA 5LUUA 5D3JA 3GG3A 5E9MA 5A5NA 4NUDA 5LKTA 4TT4A 5IGKA 4QC3A 5D26A 5G4RA 4YYIA 5EI4A 2G4AA 5E3GA 5FE2A 4J0RA 4O7EA 2F6NA 5I89A 4HBXA 3U5PA 4LC2A 5CPEA 2RNYA 5E74A 4MEQA 5HM0A 2RFJA 3TLPA 4MR3A 5L8TA 5DFBA 4A9OA 3AADA 4IR6A 5CQ7A 4Q0OA 2DATA 5C89A 3QZSA 5I80A 3LJWA 4NR4A 2R0SA 5DKHA 4HXOA 3HMHA 4UIYA 4J1PA 4OGJA 5FH6A 4PY6A 4NUCA 5CQ8A 2OSSA 5TB6A 5H1UA 5FE1A 4O72A 4QUTA 4NUEA 5HFRA 4O7BA 4IR3A 5D3RA 5EVAA 5F1HA 5HENA 5EISA 4RVRA 3O36A 4LZRA 3K2JA 4LDFA 4YBMA 5LJ1A 3UVYA 3QZVA 4YADA 1X0JA 5E73A 2DVQA 3SVFA 4TU4A 4YC9A 4QY4A 5BT5A 4XUAA 4O78A 4NRAA 4NR5A 4OGIA 4XY9A 4IOOA 2YELA 4WHWA 5EGUA 3UVXA 4TQNA 2DWWA 3MB4A 3U5LA 4O7CA 4A9KA 4YH4A 5F5ZA 3MB3A 4HXKA 3IU5A 4A9EA 5F3AA 5F25A 5CRZA 5HRXA 4NR9A 5LKUA 4NRBA 5L97A 4UIVA 5G4SA 5DW2A 4CURA 3QZTA 4QSXA 5D24A 4YAXA 3P1DA 4QEVA 5DYXA 3P1CA 5FE7A 4QSQA 4CFLA 4YYJA 3LQJA 3LXJA 5E9LA 5F1LA 5HCLA 5EWHA 5CRMA 4NXJA 2RI7A 4O7AA 5AD2A 4TTEA 5D3PA 5CQ3A 4AKNA 4IOQA 2RS9B 4LYSA 3U5KA 5I86A 4WIVA 5EA1A 5JWMA 2E7OA 5EWDA 4YYMA 5D3NA 4QUUA 2H60A 4A9LA 5DLZA 4O74A 5HLSA 4PTBA 5FFVA 5ENGA 5CGPA 5CQ5A 4Z93A 5E9YA 4N4HA 3S91A 2YDWA 4UIZA 4UYFB 5CQ4A 5AMFA 5FH8A 2I8NA 2WP2A 5DFDA 4NYWA 4CUSA 5CUEA 4X2IA 4BJXA 5ENCA 4HBVA 4A9MA 4CUTA 4Z1QA 4NR8A 5HQ5A 3S92A 4TZ8A 5F36A 5H85A 5C85A 5EPRA 4NS5A 4QBMA 5EM3A 5K29A 4BW2A 4YBTA 4DONA 4O71A 4YYGA 5J0DA 5DW1A 5IG6A 5A5QA 4A9JA 4YYHA 4UYEA 5I83A 5I88A 4BHWA 5CUDA 4YABA 4XYAA 4ZC9A 5FDZA 5I1QA 5IIDA 5BT4A 3O34A 4IORA 1EQFA 3U5MA 2R0VA 5DBMA 5DYCA 4YATA 4TT2A 5CZGA 4QR4A 4N3WA 2MJVB 5TCMA 5DX4A 5F2PA 4LYIA 5DYAA 2YEKA 3LQHA 4UIUA 5HRVA 4MR5A 5AMEA 1ZS5A 4O77A 4YY4A 2RO1A 2YEMA 5H1VA 5II1A 3I3JA 5A82A 5FE9A 5I7YA 4O76A 3P1FA 5FE3A 5E7DA 5A81A 5H1TA 5A5PA 4PKLA 5DKDA 4YYDA 3P5OA 5EICA 5HJCA 3HMFA 4A9HA 5FE8A 4MEPA 5EV9A 4E96A 5HRWA 5LKZA 5EPSA 5C87A 5CQAA 4CFKA 4QSSA 2OUOA 5A5SA 4TT6A 4QR3A 4NYXA 3O37A 4HBYA 4CUPA 5KHMA 5FB0A 4A9IA 4LYWA 5KTXA 5EWCA 2E3KA 4YK0A 5COIA 5D7XA 3G0JA 4UYHA 5EWWA 4MEOA 4YBSA 5KU3A 3G0LA 5II2A 5FG6A 3ZYUA 4YYNA 4NYVA 5CS8A 1WUGA 4HXLA 4UIXA 5EQ1A 2R10A 3AQAA 5ENHA 5LJ2A 5ETBA 5IGLA 2KTBB 2LSPB 3JVJA 3JVMA 4HXPA 3LQIA 3O35A 4MR4A 5A85A 3FKMX 5HEMA 4UITA 4C66A 5CTLA 4QB3A 4HXMA 1N72A 5FE4A 4HXNA 5LVQA 4IR4A 2L84A 5ETDA 4TYLA 4A9FA 3HMEA 4QR5A 3DAIA 5ENIA 3O33A 4HXSA 5CU8A 5CY9A 2L5EA 5EWVA 1E6IA 4BW3A 4TZ2A 2YW5A 5D3LA 4IR5A 2N9GA 4QSPA 5L99A 2I7KA 4TU6A 4Z6IA 4XY8A 4J3IA 4QEWA
chains in the Genus database with same CATH superfamily
5FG5A 3ONIA 5FFWA 4UYFA 5ENJA 4N4GA 4TS8A 5LKXA 5CP5A 2F6JA 2FSAA 4WHUA 4QYLA 4QSWA 4YY6A 4BW4A 4QSVA 5CUBA 4Z6HA 4UYGA 5HQ7A 5CUAA 5I7XA 4YYKA 3U5NA 4BW1A 5ENBA 5FE6A 5D25A 5L98A 3DWYA 3U5JA 2R0YA 4CL9A 3JVLA 3Q2EA 5HELA 5ENFA 2YYNA 5A83A 5A5OA 3IU6A 2RNWA 4LR6A 4N4IA 4KCXA 4O75A 4QSTA 2DVRA 3RCWA 4CLBA 4F3IA 5FE0A 4ALGA 5E3DA 4AKHA 3UVWA 4PCIA 2D82A 4FLPA 5FH7A 5C4QA 5KTUA 1F68A 4ZW1A 4NR7A 4QC1A 4A9NA 5KTWA 3MULA 5IGNA 4ZQLA 4UYDA 3UV2A 2DVSA 5F62A 5DY7A 5LJ0A 5C7NA 4UIWA 4CUUA 4NQMA 2RNXA 2DKWA 2D9EA 5D0CA 5BT3A 5EU1A 3P1EA 3Q2FA 4AKGA 3SVGA 5HQ6A 4QSRA 5IBNA 4KV4A 5EPBA 5LVRA 5IGMA 5E9KA 5FG4A 5D3SA 4QNSA 4HBWA 5CQ6A 5EP7A 4PS5A 5DKCA 5CQTA 5FFYA 5F61A 4N4FA 2WP1A 5FE5A 4LZ2A 3MUKA 4GPJA 3NXBA 4LRGA 5I29A 5DYUA 5C8GA 4Z1SA 5A7CA 3SVHA 5AD3A 4XUBA 5CUGA 5E0RA 5E9VA 5DFCA 2GRCA 4KV1A 5L96A 3U5OA 4AKIA 5EK9A 3MXFA 5JI8A 4C67A 2YQDA 2DVVA 4O7FA 4Q0NA 4CUQA 1WUMA 5FBXA 5D3TA 2E7NA 4O70A 3UV4A 3UV5A 5L8UA 3UW9A 4NR6A 4J0SA 5A5RA 1JSPB 4MENA 2L85A 3MQMA 4NRCA 4OUFA 4QZSA 2NXBA 4NQNA 4Y03A 4MR6A 2OO1A 5FB1A 5CFWA 5CUCA 3JVKA 4PCEA 5F60A 5ACYA 5ENEA 5D3HA 1JM4B 3D7CA 4QEUA 4QYDA 4YH3A 5E9IA 5HFQA 3UVDA 4LZSA 4HXRA 5KO4A 5F63A 4QSUA 4ALHA 5I40A 5DLXA 5LUUA 5D3JA 3GG3A 5E9MA 5A5NA 4NUDA 5LKTA 4TT4A 5IGKA 4QC3A 5D26A 5G4RA 4YYIA 5EI4A 2G4AA 5E3GA 5FE2A 4J0RA 4O7EA 1ZKRA 2F6NA 5I89A 4HBXA 3U5PA 4LC2A 5CPEA 2RNYA 5E74A 4MEQA 5HM0A 2RFJA 3TLPA 4MR3A 5L8TA 5DFBA 4A9OA 2EJNA 3AADA 4IR6A 5CQ7A 4Q0OA 2DATA 5C89A 3QZSA 5I80A 3LJWA 4NR4A 2R0SA 5DKHA 4HXOA 3HMHA 4UIYA 4J1PA 4OGJA 5FH6A 4PY6A 4NUCA 5CQ8A 2OSSA 5TB6A 5H1UA 5FE1A 4O72A 4QUTA 4NUEA 5HFRA 4O7BA 4IR3A 5D3RA 5EVAA 5F1HA 5HENA 5EISA 3VKGA 4RVRA 3O36A 4LZRA 3K2JA 4LDFA 4YBMA 5LJ1A 3UVYA 3QZVA 4YADA 1X0JA 5E73A 2DVQA 3SVFA 4TU4A 4YC9A 4QY4A 5BT5A 4XUAA 4O78A 4NRAA 4NR5A 4OGIA 4XY9A 3VKHA 4IOOA 2YELA 4WHWA 5EGUA 3UVXA 4TQNA 2DWWA 3MB4A 3U5LA 4O7CA 4A9KA 4YH4A 5F5ZA 3MB3A 4HXKA 3IU5A 4A9EA 5F3AA 5F25A 5CRZA 5HRXA 4NR9A 5LKUA 4NRBA 5L97A 4UIVA 5G4SA 5DW2A 4CURA 3QZTA 4QSXA 5D24A 4YAXA 3P1DA 3D1BA 4QEVA 5DYXA 3P1CA 5FE7A 4QSQA 4CFLA 4YYJA 3LQJA 3LXJA 5E9LA 5F1LA 5HCLA 5EWHA 5CRMA 4NXJA 2RI7A 4O7AA 5AD2A 4TTEA 5D3PA 5CQ3A 4AKNA 4IOQA 2RS9B 4LYSA 3U5KA 5I86A 4WIVA 5EA1A 5JWMA 2E7OA 5EWDA 4YYMA 5D3NA 4QUUA 2H60A 4A9LA 5DLZA 4O74A 5HLSA 4PTBA 5FFVA 5ENGA 5CGPA 5CQ5A 4Z93A 5E9YA 4N4HA 3S91A 2YDWA 4UIZA 3ERRA 4UYFB 5CQ4A 5AMFA 5FH8A 2I8NA 2WP2A 5DFDA 4NYWA 4CUSA 5CUEA 4X2IA 4BJXA 5ENCA 4HBVA 4A9MA 4CUTA 4Z1QA 4NR8A 5HQ5A 3S92A 4TZ8A 5F36A 5H85A 5C85A 5EPRA 4NS5A 4QBMA 5EM3A 5K29A 4BW2A 4YBTA 4DONA 4O71A 4YYGA 5J0DA 5DW1A 5IG6A 5A5QA 4A9JA 4YYHA 4UYEA 5I83A 5I88A 4BHWA 5CUDA 4YABA 4AI6A 4XYAA 4ZC9A 5FDZA 5I1QA 5IIDA 5BT4A 3O34A 4IORA 1EQFA 3U5MA 2R0VA 5DBMA 5DYCA 4YATA 4TT2A 5CZGA 4QR4A 4N3WA 2MJVB 5TCMA 5DX4A 5F2PA 4LYIA 5DYAA 2YEKA 3LQHA 4UIUA 5HRVA 4MR5A 5AMEA 1ZS5A 4O77A 4YY4A 2RO1A 2YEMA 5H1VA 5II1A 3I3JA 5A82A 5FE9A 5I7YA 4O76A 3P1FA 5FE3A 5E7DA 5A81A 5H1TA 5A5PA 4PKLA 5DKDA 4YYDA 3P5OA 5EICA 5HJCA 3HMFA 4A9HA 5FE8A 4MEPA 5EV9A 4E96A 5HRWA 5LKZA 5EPSA 5C87A 5CQAA 4CFKA 1PUOA 4QSSA 2OUOA 5A5SA 4TT6A 4QR3A 4NYXA 3O37A 4HBYA 4CUPA 5KHMA 5FB0A 4A9IA 4LYWA 5KTXA 5EWCA 2E3KA 4YK0A 5COIA 5D7XA 3G0JA 4UYHA 5EWWA 4MEOA 4YBSA 5KU3A 3G0LA 5II2A 5FG6A 3ZYUA 4YYNA 4NYVA 5CS8A 1WUGA 4HXLA 4UIXA 5EQ1A 2R10A 3AQAA 5ENHA 5LJ2A 5ETBA 5IGLA 2KTBB 2LSPB 3JVJA 3JVMA 4HXPA 3LQIA 3O35A 4MR4A 5A85A 3FKMX 5HEMA 4UITA 4C66A 5CTLA 4QB3A 4HXMA 1N72A 5FE4A 4HXNA 5LVQA 4IR4A 2L84A 5ETDA 4TYLA 4A9FA 3HMEA 4QR5A 3DAIA 5ENIA 3O33A 4HXSA 5CU8A 5CY9A 2L5EA 5EWVA 1E6IA 4BW3A 4TZ2A 2YW5A 3D1DA 5D3LA 4IR5A 2N9GA 4QSPA 5L99A 2I7KA 4TU6A 4Z6IA 4XY8A 4J3IA 4QEWA
chains in the Genus database with same CATH topology
5FG5A 3ONIA 5FFWA 4UYFA 5ENJA 4N4GA 4TS8A 5LKXA 5CP5A 2F6JA 2FSAA 4WHUA 4QYLA 4QSWA 4YY6A 4BW4A 4QSVA 5CUBA 4Z6HA 4UYGA 5HQ7A 5CUAA 5I7XA 4YYKA 3U5NA 4BW1A 5ENBA 5FE6A 5D25A 5L98A 3DWYA 3U5JA 2R0YA 4CL9A 3JVLA 3Q2EA 5HELA 5ENFA 2YYNA 5A83A 5A5OA 3IU6A 2RNWA 4LR6A 4N4IA 4KCXA 4O75A 4QSTA 2DVRA 3RCWA 4CLBA 4F3IA 5FE0A 4ALGA 5E3DA 3UVWA 4PCIA 2D82A 4FLPA 5FH7A 5C4QA 5KTUA 1F68A 4ZW1A 4NR7A 4QC1A 4A9NA 5KTWA 3MULA 5IGNA 4ZQLA 4UYDA 3UV2A 2DVSA 5F62A 5DY7A 5LJ0A 5C7NA 4UIWA 4CUUA 4NQMA 2RNXA 2DKWA 2D9EA 5D0CA 5BT3A 5EU1A 3P1EA 3Q2FA 3SVGA 5HQ6A 4QSRA 5IBNA 4KV4A 5EPBA 5LVRA 5IGMA 5E9KA 5FG4A 5D3SA 4QNSA 4HBWA 5CQ6A 5EP7A 4PS5A 5DKCA 5CQTA 5FFYA 5F61A 4N4FA 2WP1A 5FE5A 4LZ2A 3MUKA 4GPJA 3NXBA 4LRGA 5I29A 5DYUA 5C8GA 4Z1SA 5A7CA 3SVHA 5AD3A 4XUBA 5CUGA 5E0RA 5E9VA 5DFCA 2GRCA 4KV1A 5L96A 3U5OA 5EK9A 3MXFA 5JI8A 4C67A 2YQDA 2DVVA 4O7FA 4Q0NA 4CUQA 1WUMA 5FBXA 5D3TA 2E7NA 4O70A 3UV4A 3UV5A 5L8UA 3UW9A 4NR6A 4J0SA 5A5RA 1JSPB 4MENA 2L85A 3MQMA 4NRCA 4OUFA 4QZSA 2NXBA 4NQNA 4Y03A 4MR6A 2OO1A 5FB1A 5CFWA 5CUCA 3JVKA 4PCEA 5F60A 5ACYA 5ENEA 5D3HA 1JM4B 3D7CA 4QEUA 4QYDA 4YH3A 5E9IA 5HFQA 3UVDA 4LZSA 4HXRA 5KO4A 5F63A 4QSUA 4ALHA 5I40A 5DLXA 5LUUA 5D3JA 3GG3A 5E9MA 5A5NA 4NUDA 5LKTA 4TT4A 5IGKA 4QC3A 5D26A 5G4RA 4YYIA 5EI4A 2G4AA 5E3GA 5FE2A 4J0RA 4O7EA 2F6NA 5I89A 4HBXA 3U5PA 4LC2A 5CPEA 2RNYA 5E74A 4MEQA 5HM0A 2RFJA 3TLPA 4MR3A 5L8TA 5DFBA 4A9OA 3AADA 4IR6A 5CQ7A 4Q0OA 2DATA 5C89A 3QZSA 5I80A 3LJWA 4NR4A 2R0SA 5DKHA 4HXOA 3HMHA 4UIYA 4J1PA 4OGJA 5FH6A 4PY6A 4NUCA 5CQ8A 2OSSA 5TB6A 5H1UA 5FE1A 4O72A 4QUTA 4NUEA 5HFRA 4O7BA 4IR3A 5D3RA 5EVAA 5F1HA 5HENA 5EISA 4RVRA 3O36A 4LZRA 3K2JA 4LDFA 4YBMA 5LJ1A 3UVYA 3QZVA 4YADA 1X0JA 5E73A 2DVQA 3SVFA 4TU4A 4YC9A 4QY4A 5BT5A 4XUAA 4O78A 4NRAA 4NR5A 4OGIA 4XY9A 4IOOA 2YELA 4WHWA 5EGUA 3UVXA 4TQNA 2DWWA 3MB4A 3U5LA 4O7CA 4A9KA 4YH4A 5F5ZA 3MB3A 4HXKA 3IU5A 4A9EA 5F3AA 5F25A 5CRZA 5HRXA 4NR9A 5LKUA 4NRBA 5L97A 4UIVA 5G4SA 5DW2A 4CURA 3QZTA 4QSXA 5D24A 4YAXA 3P1DA 4QEVA 5DYXA 3P1CA 5FE7A 4QSQA 4CFLA 4YYJA 3LQJA 3LXJA 5E9LA 5F1LA 5HCLA 5EWHA 5CRMA 4NXJA 2RI7A 4O7AA 5AD2A 4TTEA 5D3PA 5CQ3A 4AKNA 4IOQA 2RS9B 4LYSA 3U5KA 5I86A 4WIVA 5EA1A 5JWMA 2E7OA 5EWDA 4YYMA 5D3NA 4QUUA 2H60A 4A9LA 5DLZA 4O74A 5HLSA 4PTBA 5FFVA 5ENGA 5CGPA 5CQ5A 4Z93A 5E9YA 4N4HA 3S91A 2YDWA 4UIZA 4UYFB 5CQ4A 5AMFA 5FH8A 2I8NA 2WP2A 5DFDA 4NYWA 4CUSA 5CUEA 4X2IA 4BJXA 5ENCA 4HBVA 4A9MA 4CUTA 4Z1QA 4NR8A 5HQ5A 3S92A 4TZ8A 5F36A 5H85A 5C85A 5EPRA 4NS5A 4QBMA 5EM3A 5K29A 4BW2A 4YBTA 4DONA 4O71A 4YYGA 5J0DA 5DW1A 5IG6A 5A5QA 4A9JA 4YYHA 4UYEA 5I83A 5I88A 4BHWA 5CUDA 4YABA 4XYAA 4ZC9A 5FDZA 5I1QA 5IIDA 5BT4A 3O34A 4IORA 1EQFA 3U5MA 2R0VA 5DBMA 5DYCA 4YATA 4TT2A 5CZGA 4QR4A 4N3WA 2MJVB 5TCMA 5DX4A 5F2PA 4LYIA 5DYAA 2YEKA 3LQHA 4UIUA 5HRVA 4MR5A 5AMEA 1ZS5A 4O77A 4YY4A 2RO1A 2YEMA 5H1VA 5II1A 3I3JA 5A82A 5FE9A 5I7YA 4O76A 3P1FA 5FE3A 5E7DA 5A81A 5H1TA 5A5PA 4PKLA 5DKDA 4YYDA 3P5OA 5EICA 5HJCA 3HMFA 4A9HA 5FE8A 4MEPA 5EV9A 4E96A 5HRWA 5LKZA 5EPSA 5C87A 5CQAA 4CFKA 4QSSA 2OUOA 5A5SA 4TT6A 4QR3A 4NYXA 3O37A 4HBYA 4CUPA 5KHMA 5FB0A 4A9IA 4LYWA 5KTXA 5EWCA 2E3KA 4YK0A 5COIA 5D7XA 3G0JA 4UYHA 5EWWA 4MEOA 4YBSA 5KU3A 3G0LA 5II2A 5FG6A 3ZYUA 4YYNA 4NYVA 5CS8A 1WUGA 4HXLA 4UIXA 5EQ1A 2R10A 3AQAA 5ENHA 5LJ2A 5ETBA 5IGLA 2KTBB 2LSPB 3JVJA 3JVMA 4HXPA 3LQIA 3O35A 4MR4A 5A85A 3FKMX 5HEMA 4UITA 4C66A 5CTLA 4QB3A 4HXMA 1N72A 5FE4A 4HXNA 5LVQA 4IR4A 2L84A 5ETDA 4TYLA 4A9FA 3HMEA 4QR5A 3DAIA 5ENIA 3O33A 4HXSA 5CU8A 5CY9A 2L5EA 5EWVA 1E6IA 4BW3A 4TZ2A 2YW5A 5D3LA 4IR5A 2N9GA 4QSPA 5L99A 2I7KA 4TU6A 4Z6IA 4XY8A 4J3IA 4QEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FG5 A;  3ONI A;  5FFW A;  4UYF A;  5ENJ A;  4N4G A;  4TS8 A;  5LKX A;  5CP5 A;  2F6J A;  2FSA A;  4WHU A;  4QYL A;  4QSW A;  4YY6 A;  4BW4 A;  4QSV A;  5CUB A;  4Z6H A;  4UYG A;  5HQ7 A;  5CUA A;  5I7X A;  4YYK A;  3U5N A;  4BW1 A;  5ENB A;  5FE6 A;  5D25 A;  5L98 A;  3DWY A;  3U5J A;  2R0Y A;  4CL9 A;  3JVL A;  3Q2E A;  5HEL A;  5ENF A;  2YYN A;  5A83 A;  5A5O A;  3IU6 A;  2RNW A;  4LR6 A;  4N4I A;  4KCX A;  4O75 A;  4QST A;  2DVR A;  3RCW A;  4CLB A;  4F3I A;  5FE0 A;  4ALG A;  5E3D A;  3UVW A;  4PCI A;  2D82 A;  4FLP A;  5FH7 A;  5C4Q A;  5KTU A;  1F68 A;  4ZW1 A;  4NR7 A;  4QC1 A;  4A9N A;  5KTW A;  3MUL A;  5IGN A;  4ZQL A;  4UYD A;  3UV2 A;  2DVS A;  5F62 A;  5DY7 A;  5LJ0 A;  5C7N A;  4UIW A;  4CUU A;  4NQM A;  2RNX A;  2DKW A;  2D9E A;  5D0C A;  5BT3 A;  5EU1 A;  3P1E A;  3Q2F A;  3SVG A;  5HQ6 A;  4QSR A;  5IBN A;  4KV4 A;  5EPB A;  5LVR A;  5IGM A;  5E9K A;  5FG4 A;  5D3S A;  4QNS A;  4HBW A;  5CQ6 A;  5EP7 A;  4PS5 A;  5DKC A;  5CQT A;  5FFY A;  5F61 A;  4N4F A;  2WP1 A;  5FE5 A;  4LZ2 A;  3MUK A;  4GPJ A;  3NXB A;  4LRG A;  5I29 A;  5DYU A;  5C8G A;  4Z1S A;  5A7C A;  3SVH A;  5AD3 A;  4XUB A;  5CUG A;  5E0R A;  5E9V A;  5DFC A;  2GRC A;  4KV1 A;  5L96 A;  3U5O A;  5EK9 A;  3MXF A;  5JI8 A;  4C67 A;  2YQD A;  2DVV A;  4O7F A;  4Q0N A;  4CUQ A;  1WUM A;  5FBX A;  5D3T A;  2E7N A;  4O70 A;  3UV4 A;  3UV5 A;  5L8U A;  3UW9 A;  4NR6 A;  4J0S A;  5A5R A;  1JSP B;  4MEN A;  2L85 A;  3MQM A;  4NRC A;  4OUF A;  4QZS A;  2NXB A;  4NQN A;  4Y03 A;  4MR6 A;  2OO1 A;  5FB1 A;  5CFW A;  5CUC A;  3JVK A;  4PCE A;  5F60 A;  5ACY A;  5ENE A;  5D3H A;  1JM4 B;  3D7C A;  4QEU A;  4QYD A;  4YH3 A;  5E9I A;  5HFQ A;  3UVD A;  4LZS A;  4HXR A;  5KO4 A;  5F63 A;  4QSU A;  4ALH A;  5I40 A;  5DLX A;  5LUU A;  5D3J A;  3GG3 A;  5E9M A;  5A5N A;  4NUD A;  5LKT A;  4TT4 A;  5IGK A;  4QC3 A;  5D26 A;  5G4R A;  4YYI A;  5EI4 A;  2G4A A;  5E3G A;  5FE2 A;  4J0R A;  4O7E A;  2F6N A;  5I89 A;  4HBX A;  3U5P A;  4LC2 A;  5CPE A;  2RNY A;  5E74 A;  4MEQ A;  5HM0 A;  2RFJ A;  3TLP A;  4MR3 A;  5L8T A;  5DFB A;  4A9O A;  3AAD A;  4IR6 A;  5CQ7 A;  4Q0O A;  2DAT A;  5C89 A;  3QZS A;  5I80 A;  3LJW A;  4NR4 A;  2R0S A;  5DKH A;  4HXO A;  3HMH A;  4UIY A;  4J1P A;  4OGJ A;  5FH6 A;  4PY6 A;  4NUC A;  5CQ8 A;  2OSS A;  5TB6 A;  5H1U A;  5FE1 A;  4O72 A;  4QUT A;  4NUE A;  5HFR A;  4O7B A;  4IR3 A;  5D3R A;  5EVA A;  5F1H A;  5HEN A;  5EIS A;  4RVR A;  3O36 A;  4LZR A;  3K2J A;  4LDF A;  4YBM A;  5LJ1 A;  3UVY A;  3QZV A;  4YAD A;  1X0J A;  5E73 A;  2DVQ A;  3SVF A;  4TU4 A;  4YC9 A;  4QY4 A;  5BT5 A;  4XUA A;  4O78 A;  4NRA A;  4NR5 A;  4OGI A;  4XY9 A;  4IOO A;  2YEL A;  4WHW A;  5EGU A;  3UVX A;  4TQN A;  2DWW A;  3MB4 A;  3U5L A;  4O7C A;  4A9K A;  4YH4 A;  5F5Z A;  3MB3 A;  4HXK A;  3IU5 A;  4A9E A;  5F3A A;  5F25 A;  5CRZ A;  5HRX A;  4NR9 A;  5LKU A;  4NRB A;  5L97 A;  4UIV A;  5G4S A;  5DW2 A;  4CUR A;  3QZT A;  4QSX A;  5D24 A;  4YAX A;  3P1D A;  4QEV A;  5DYX A;  3P1C A;  5FE7 A;  4QSQ A;  4CFL A;  4YYJ A;  3LQJ A;  3LXJ A;  5E9L A;  5F1L A;  5HCL A;  5EWH A;  5CRM A;  4NXJ A;  2RI7 A;  4O7A A;  5AD2 A;  4TTE A;  5D3P A;  5CQ3 A;  4AKN A;  4IOQ A;  2RS9 B;  4LYS A;  3U5K A;  5I86 A;  4WIV A;  5EA1 A;  5JWM A;  2E7O A;  5EWD A;  4YYM A;  5D3N A;  4QUU A;  2H60 A;  4A9L A;  5DLZ A;  4O74 A;  5HLS A;  4PTB A;  5FFV A;  5ENG A;  5CGP A;  5CQ5 A;  4Z93 A;  5E9Y A;  4N4H A;  3S91 A;  2YDW A;  4UIZ A;  4UYF B;  5CQ4 A;  5AMF A;  5FH8 A;  2I8N A;  2WP2 A;  5DFD A;  4NYW A;  4CUS A;  5CUE A;  4X2I A;  4BJX A;  5ENC A;  4HBV A;  4A9M A;  4CUT A;  4Z1Q A;  4NR8 A;  5HQ5 A;  3S92 A;  4TZ8 A;  5F36 A;  5H85 A;  5C85 A;  5EPR A;  4NS5 A;  4QBM A;  5EM3 A;  5K29 A;  4BW2 A;  4YBT A;  4DON A;  4O71 A;  4YYG A;  5J0D A;  5DW1 A;  5IG6 A;  5A5Q A;  4A9J A;  4YYH A;  4UYE A;  5I83 A;  5I88 A;  4BHW A;  5CUD A;  4YAB A;  4XYA A;  4ZC9 A;  5FDZ A;  5I1Q A;  5IID A;  5BT4 A;  3O34 A;  4IOR A;  1EQF A;  3U5M A;  2R0V A;  5DBM A;  5DYC A;  4YAT A;  4TT2 A;  5CZG A;  4QR4 A;  4N3W A;  2MJV B;  5TCM A;  5DX4 A;  5F2P A;  4LYI A;  5DYA A;  2YEK A;  3LQH A;  4UIU A;  5HRV A;  4MR5 A;  5AME A;  1ZS5 A;  4O77 A;  4YY4 A;  2RO1 A;  2YEM A;  5H1V A;  5II1 A;  3I3J A;  5A82 A;  5FE9 A;  5I7Y A;  4O76 A;  3P1F A;  5FE3 A;  5E7D A;  5A81 A;  5H1T A;  5A5P A;  4PKL A;  5DKD A;  4YYD A;  3P5O A;  5EIC A;  5HJC A;  3HMF A;  4A9H A;  5FE8 A;  4MEP A;  5EV9 A;  4E96 A;  5HRW A;  5LKZ A;  5EPS A;  5C87 A;  5CQA A;  4CFK A;  4QSS A;  2OUO A;  5A5S A;  4TT6 A;  4QR3 A;  4NYX A;  3O37 A;  4HBY A;  4CUP A;  5KHM A;  5FB0 A;  4A9I A;  4LYW A;  5KTX A;  5EWC A;  2E3K A;  4YK0 A;  5COI A;  5D7X A;  3G0J A;  4UYH A;  5EWW A;  4MEO A;  4YBS A;  5KU3 A;  3G0L A;  5II2 A;  5FG6 A;  3ZYU A;  4YYN A;  4NYV A;  5CS8 A;  1WUG A;  4HXL A;  4UIX A;  5EQ1 A;  2R10 A;  3AQA A;  5ENH A;  5LJ2 A;  5ETB A;  5IGL A;  2KTB B;  2LSP B;  3JVJ A;  3JVM A;  4HXP A;  3LQI A;  3O35 A;  4MR4 A;  5A85 A;  3FKM X;  5HEM A;  4UIT A;  4C66 A;  5CTL A;  4QB3 A;  4HXM A;  1N72 A;  5FE4 A;  4HXN A;  5LVQ A;  4IR4 A;  2L84 A;  5ETD A;  4TYL A;  4A9F A;  3HME A;  4QR5 A;  3DAI A;  5ENI A;  3O33 A;  4HXS A;  5CU8 A;  5CY9 A;  2L5E A;  5EWV A;  1E6I A;  4BW3 A;  4TZ2 A;  2YW5 A;  5D3L A;  4IR5 A;  2N9G A;  4QSP A;  5L99 A;  2I7K A;  4TU6 A;  4Z6I A;  4XY8 A;  4J3I A;  4QEW A; 
#chains in the Genus database with same CATH topology
 5FG5 A;  3ONI A;  5FFW A;  4UYF A;  5ENJ A;  4N4G A;  4TS8 A;  5LKX A;  5CP5 A;  2F6J A;  2FSA A;  4WHU A;  4QYL A;  4QSW A;  4YY6 A;  4BW4 A;  4QSV A;  5CUB A;  4Z6H A;  4UYG A;  5HQ7 A;  5CUA A;  5I7X A;  4YYK A;  3U5N A;  4BW1 A;  5ENB A;  5FE6 A;  5D25 A;  5L98 A;  3DWY A;  3U5J A;  2R0Y A;  4CL9 A;  3JVL A;  3Q2E A;  5HEL A;  5ENF A;  2YYN A;  5A83 A;  5A5O A;  3IU6 A;  2RNW A;  4LR6 A;  4N4I A;  4KCX A;  4O75 A;  4QST A;  2DVR A;  3RCW A;  4CLB A;  4F3I A;  5FE0 A;  4ALG A;  5E3D A;  4AKH A;  3UVW A;  4PCI A;  2D82 A;  4FLP A;  5FH7 A;  5C4Q A;  5KTU A;  1F68 A;  4ZW1 A;  4NR7 A;  4QC1 A;  4A9N A;  5KTW A;  3MUL A;  5IGN A;  4ZQL A;  4UYD A;  3UV2 A;  2DVS A;  5F62 A;  5DY7 A;  5LJ0 A;  5C7N A;  4UIW A;  4CUU A;  4NQM A;  2RNX A;  2DKW A;  2D9E A;  5D0C A;  5BT3 A;  5EU1 A;  3P1E A;  3Q2F A;  4AKG A;  3SVG A;  5HQ6 A;  4QSR A;  5IBN A;  4KV4 A;  5EPB A;  5LVR A;  5IGM A;  5E9K A;  5FG4 A;  5D3S A;  4QNS A;  4HBW A;  5CQ6 A;  5EP7 A;  4PS5 A;  5DKC A;  5CQT A;  5FFY A;  5F61 A;  4N4F A;  2WP1 A;  5FE5 A;  4LZ2 A;  3MUK A;  4GPJ A;  3NXB A;  4LRG A;  5I29 A;  5DYU A;  5C8G A;  4Z1S A;  5A7C A;  3SVH A;  5AD3 A;  4XUB A;  5CUG A;  5E0R A;  5E9V A;  5DFC A;  2GRC A;  4KV1 A;  5L96 A;  3U5O A;  4AKI A;  5EK9 A;  3MXF A;  5JI8 A;  4C67 A;  2YQD A;  2DVV A;  4O7F A;  4Q0N A;  4CUQ A;  1WUM A;  5FBX A;  5D3T A;  2E7N A;  4O70 A;  3UV4 A;  3UV5 A;  5L8U A;  3UW9 A;  4NR6 A;  4J0S A;  5A5R A;  1JSP B;  4MEN A;  2L85 A;  3MQM A;  4NRC A;  4OUF A;  4QZS A;  2NXB A;  4NQN A;  4Y03 A;  4MR6 A;  2OO1 A;  5FB1 A;  5CFW A;  5CUC A;  3JVK A;  4PCE A;  5F60 A;  5ACY A;  5ENE A;  5D3H A;  1JM4 B;  3D7C A;  4QEU A;  4QYD A;  4YH3 A;  5E9I A;  5HFQ A;  3UVD A;  4LZS A;  4HXR A;  5KO4 A;  5F63 A;  4QSU A;  4ALH A;  5I40 A;  5DLX A;  5LUU A;  5D3J A;  3GG3 A;  5E9M A;  5A5N A;  4NUD A;  5LKT A;  4TT4 A;  5IGK A;  4QC3 A;  5D26 A;  5G4R A;  4YYI A;  5EI4 A;  2G4A A;  5E3G A;  5FE2 A;  4J0R A;  4O7E A;  1ZKR A;  2F6N A;  5I89 A;  4HBX A;  3U5P A;  4LC2 A;  5CPE A;  2RNY A;  5E74 A;  4MEQ A;  5HM0 A;  2RFJ A;  3TLP A;  4MR3 A;  5L8T A;  5DFB A;  4A9O A;  2EJN A;  3AAD A;  4IR6 A;  5CQ7 A;  4Q0O A;  2DAT A;  5C89 A;  3QZS A;  5I80 A;  3LJW A;  4NR4 A;  2R0S A;  5DKH A;  4HXO A;  3HMH A;  4UIY A;  4J1P A;  4OGJ A;  5FH6 A;  4PY6 A;  4NUC A;  5CQ8 A;  2OSS A;  5TB6 A;  5H1U A;  5FE1 A;  4O72 A;  4QUT A;  4NUE A;  5HFR A;  4O7B A;  4IR3 A;  5D3R A;  5EVA A;  5F1H A;  5HEN A;  5EIS A;  3VKG A;  4RVR A;  3O36 A;  4LZR A;  3K2J A;  4LDF A;  4YBM A;  5LJ1 A;  3UVY A;  3QZV A;  4YAD A;  1X0J A;  5E73 A;  2DVQ A;  3SVF A;  4TU4 A;  4YC9 A;  4QY4 A;  5BT5 A;  4XUA A;  4O78 A;  4NRA A;  4NR5 A;  4OGI A;  4XY9 A;  3VKH A;  4IOO A;  2YEL A;  4WHW A;  5EGU A;  3UVX A;  4TQN A;  2DWW A;  3MB4 A;  3U5L A;  4O7C A;  4A9K A;  4YH4 A;  5F5Z A;  3MB3 A;  4HXK A;  3IU5 A;  4A9E A;  5F3A A;  5F25 A;  5CRZ A;  5HRX A;  4NR9 A;  5LKU A;  4NRB A;  5L97 A;  4UIV A;  5G4S A;  5DW2 A;  4CUR A;  3QZT A;  4QSX A;  5D24 A;  4YAX A;  3P1D A;  3D1B A;  4QEV A;  5DYX A;  3P1C A;  5FE7 A;  4QSQ A;  4CFL A;  4YYJ A;  3LQJ A;  3LXJ A;  5E9L A;  5F1L A;  5HCL A;  5EWH A;  5CRM A;  4NXJ A;  2RI7 A;  4O7A A;  5AD2 A;  4TTE A;  5D3P A;  5CQ3 A;  4AKN A;  4IOQ A;  2RS9 B;  4LYS A;  3U5K A;  5I86 A;  4WIV A;  5EA1 A;  5JWM A;  2E7O A;  5EWD A;  4YYM A;  5D3N A;  4QUU A;  2H60 A;  4A9L A;  5DLZ A;  4O74 A;  5HLS A;  4PTB A;  5FFV A;  5ENG A;  5CGP A;  5CQ5 A;  4Z93 A;  5E9Y A;  4N4H A;  3S91 A;  2YDW A;  4UIZ A;  3ERR A;  4UYF B;  5CQ4 A;  5AMF A;  5FH8 A;  2I8N A;  2WP2 A;  5DFD A;  4NYW A;  4CUS A;  5CUE A;  4X2I A;  4BJX A;  5ENC A;  4HBV A;  4A9M A;  4CUT A;  4Z1Q A;  4NR8 A;  5HQ5 A;  3S92 A;  4TZ8 A;  5F36 A;  5H85 A;  5C85 A;  5EPR A;  4NS5 A;  4QBM A;  5EM3 A;  5K29 A;  4BW2 A;  4YBT A;  4DON A;  4O71 A;  4YYG A;  5J0D A;  5DW1 A;  5IG6 A;  5A5Q A;  4A9J A;  4YYH A;  4UYE A;  5I83 A;  5I88 A;  4BHW A;  5CUD A;  4YAB A;  4AI6 A;  4XYA A;  4ZC9 A;  5FDZ A;  5I1Q A;  5IID A;  5BT4 A;  3O34 A;  4IOR A;  1EQF A;  3U5M A;  2R0V A;  5DBM A;  5DYC A;  4YAT A;  4TT2 A;  5CZG A;  4QR4 A;  4N3W A;  2MJV B;  5TCM A;  5DX4 A;  5F2P A;  4LYI A;  5DYA A;  2YEK A;  3LQH A;  4UIU A;  5HRV A;  4MR5 A;  5AME A;  1ZS5 A;  4O77 A;  4YY4 A;  2RO1 A;  2YEM A;  5H1V A;  5II1 A;  3I3J A;  5A82 A;  5FE9 A;  5I7Y A;  4O76 A;  3P1F A;  5FE3 A;  5E7D A;  5A81 A;  5H1T A;  5A5P A;  4PKL A;  5DKD A;  4YYD A;  3P5O A;  5EIC A;  5HJC A;  3HMF A;  4A9H A;  5FE8 A;  4MEP A;  5EV9 A;  4E96 A;  5HRW A;  5LKZ A;  5EPS A;  5C87 A;  5CQA A;  4CFK A;  1PUO A;  4QSS A;  2OUO A;  5A5S A;  4TT6 A;  4QR3 A;  4NYX A;  3O37 A;  4HBY A;  4CUP A;  5KHM A;  5FB0 A;  4A9I A;  4LYW A;  5KTX A;  5EWC A;  2E3K A;  4YK0 A;  5COI A;  5D7X A;  3G0J A;  4UYH A;  5EWW A;  4MEO A;  4YBS A;  5KU3 A;  3G0L A;  5II2 A;  5FG6 A;  3ZYU A;  4YYN A;  4NYV A;  5CS8 A;  1WUG A;  4HXL A;  4UIX A;  5EQ1 A;  2R10 A;  3AQA A;  5ENH A;  5LJ2 A;  5ETB A;  5IGL A;  2KTB B;  2LSP B;  3JVJ A;  3JVM A;  4HXP A;  3LQI A;  3O35 A;  4MR4 A;  5A85 A;  3FKM X;  5HEM A;  4UIT A;  4C66 A;  5CTL A;  4QB3 A;  4HXM A;  1N72 A;  5FE4 A;  4HXN A;  5LVQ A;  4IR4 A;  2L84 A;  5ETD A;  4TYL A;  4A9F A;  3HME A;  4QR5 A;  3DAI A;  5ENI A;  3O33 A;  4HXS A;  5CU8 A;  5CY9 A;  2L5E A;  5EWV A;  1E6I A;  4BW3 A;  4TZ2 A;  2YW5 A;  3D1D A;  5D3L A;  4IR5 A;  2N9G A;  4QSP A;  5L99 A;  2I7K A;  4TU6 A;  4Z6I A;  4XY8 A;  4J3I A;  4QEW A; 
#chains in the Genus database with same CATH homology
 5FG5 A;  3ONI A;  5FFW A;  4UYF A;  5ENJ A;  4N4G A;  4TS8 A;  5LKX A;  5CP5 A;  2F6J A;  2FSA A;  4WHU A;  4QYL A;  4QSW A;  4YY6 A;  4BW4 A;  4QSV A;  5CUB A;  4Z6H A;  4UYG A;  5HQ7 A;  5CUA A;  5I7X A;  4YYK A;  3U5N A;  4BW1 A;  5ENB A;  5FE6 A;  5D25 A;  5L98 A;  3DWY A;  3U5J A;  2R0Y A;  4CL9 A;  3JVL A;  3Q2E A;  5HEL A;  5ENF A;  2YYN A;  5A83 A;  5A5O A;  3IU6 A;  2RNW A;  4LR6 A;  4N4I A;  4KCX A;  4O75 A;  4QST A;  2DVR A;  3RCW A;  4CLB A;  4F3I A;  5FE0 A;  4ALG A;  5E3D A;  3UVW A;  4PCI A;  2D82 A;  4FLP A;  5FH7 A;  5C4Q A;  5KTU A;  1F68 A;  4ZW1 A;  4NR7 A;  4QC1 A;  4A9N A;  5KTW A;  3MUL A;  5IGN A;  4ZQL A;  4UYD A;  3UV2 A;  2DVS A;  5F62 A;  5DY7 A;  5LJ0 A;  5C7N A;  4UIW A;  4CUU A;  4NQM A;  2RNX A;  2DKW A;  2D9E A;  5D0C A;  5BT3 A;  5EU1 A;  3P1E A;  3Q2F A;  3SVG A;  5HQ6 A;  4QSR A;  5IBN A;  4KV4 A;  5EPB A;  5LVR A;  5IGM A;  5E9K A;  5FG4 A;  5D3S A;  4QNS A;  4HBW A;  5CQ6 A;  5EP7 A;  4PS5 A;  5DKC A;  5CQT A;  5FFY A;  5F61 A;  4N4F A;  2WP1 A;  5FE5 A;  4LZ2 A;  3MUK A;  4GPJ A;  3NXB A;  4LRG A;  5I29 A;  5DYU A;  5C8G A;  4Z1S A;  5A7C A;  3SVH A;  5AD3 A;  4XUB A;  5CUG A;  5E0R A;  5E9V A;  5DFC A;  2GRC A;  4KV1 A;  5L96 A;  3U5O A;  5EK9 A;  3MXF A;  5JI8 A;  4C67 A;  2YQD A;  2DVV A;  4O7F A;  4Q0N A;  4CUQ A;  1WUM A;  5FBX A;  5D3T A;  2E7N A;  4O70 A;  3UV4 A;  3UV5 A;  5L8U A;  3UW9 A;  4NR6 A;  4J0S A;  5A5R A;  1JSP B;  4MEN A;  2L85 A;  3MQM A;  4NRC A;  4OUF A;  4QZS A;  2NXB A;  4NQN A;  4Y03 A;  4MR6 A;  2OO1 A;  5FB1 A;  5CFW A;  5CUC A;  3JVK A;  4PCE A;  5F60 A;  5ACY A;  5ENE A;  5D3H A;  1JM4 B;  3D7C A;  4QEU A;  4QYD A;  4YH3 A;  5E9I A;  5HFQ A;  3UVD A;  4LZS A;  4HXR A;  5KO4 A;  5F63 A;  4QSU A;  4ALH A;  5I40 A;  5DLX A;  5LUU A;  5D3J A;  3GG3 A;  5E9M A;  5A5N A;  4NUD A;  5LKT A;  4TT4 A;  5IGK A;  4QC3 A;  5D26 A;  5G4R A;  4YYI A;  5EI4 A;  2G4A A;  5E3G A;  5FE2 A;  4J0R A;  4O7E A;  2F6N A;  5I89 A;  4HBX A;  3U5P A;  4LC2 A;  5CPE A;  2RNY A;  5E74 A;  4MEQ A;  5HM0 A;  2RFJ A;  3TLP A;  4MR3 A;  5L8T A;  5DFB A;  4A9O A;  3AAD A;  4IR6 A;  5CQ7 A;  4Q0O A;  2DAT A;  5C89 A;  3QZS A;  5I80 A;  3LJW A;  4NR4 A;  2R0S A;  5DKH A;  4HXO A;  3HMH A;  4UIY A;  4J1P A;  4OGJ A;  5FH6 A;  4PY6 A;  4NUC A;  5CQ8 A;  2OSS A;  5TB6 A;  5H1U A;  5FE1 A;  4O72 A;  4QUT A;  4NUE A;  5HFR A;  4O7B A;  4IR3 A;  5D3R A;  5EVA A;  5F1H A;  5HEN A;  5EIS A;  4RVR A;  3O36 A;  4LZR A;  3K2J A;  4LDF A;  4YBM A;  5LJ1 A;  3UVY A;  3QZV A;  4YAD A;  1X0J A;  5E73 A;  2DVQ A;  3SVF A;  4TU4 A;  4YC9 A;  4QY4 A;  5BT5 A;  4XUA A;  4O78 A;  4NRA A;  4NR5 A;  4OGI A;  4XY9 A;  4IOO A;  2YEL A;  4WHW A;  5EGU A;  3UVX A;  4TQN A;  2DWW A;  3MB4 A;  3U5L A;  4O7C A;  4A9K A;  4YH4 A;  5F5Z A;  3MB3 A;  4HXK A;  3IU5 A;  4A9E A;  5F3A A;  5F25 A;  5CRZ A;  5HRX A;  4NR9 A;  5LKU A;  4NRB A;  5L97 A;  4UIV A;  5G4S A;  5DW2 A;  4CUR A;  3QZT A;  4QSX A;  5D24 A;  4YAX A;  3P1D A;  4QEV A;  5DYX A;  3P1C A;  5FE7 A;  4QSQ A;  4CFL A;  4YYJ A;  3LQJ A;  3LXJ A;  5E9L A;  5F1L A;  5HCL A;  5EWH A;  5CRM A;  4NXJ A;  2RI7 A;  4O7A A;  5AD2 A;  4TTE A;  5D3P A;  5CQ3 A;  4AKN A;  4IOQ A;  2RS9 B;  4LYS A;  3U5K A;  5I86 A;  4WIV A;  5EA1 A;  5JWM A;  2E7O A;  5EWD A;  4YYM A;  5D3N A;  4QUU A;  2H60 A;  4A9L A;  5DLZ A;  4O74 A;  5HLS A;  4PTB A;  5FFV A;  5ENG A;  5CGP A;  5CQ5 A;  4Z93 A;  5E9Y A;  4N4H A;  3S91 A;  2YDW A;  4UIZ A;  4UYF B;  5CQ4 A;  5AMF A;  5FH8 A;  2I8N A;  2WP2 A;  5DFD A;  4NYW A;  4CUS A;  5CUE A;  4X2I A;  4BJX A;  5ENC A;  4HBV A;  4A9M A;  4CUT A;  4Z1Q A;  4NR8 A;  5HQ5 A;  3S92 A;  4TZ8 A;  5F36 A;  5H85 A;  5C85 A;  5EPR A;  4NS5 A;  4QBM A;  5EM3 A;  5K29 A;  4BW2 A;  4YBT A;  4DON A;  4O71 A;  4YYG A;  5J0D A;  5DW1 A;  5IG6 A;  5A5Q A;  4A9J A;  4YYH A;  4UYE A;  5I83 A;  5I88 A;  4BHW A;  5CUD A;  4YAB A;  4XYA A;  4ZC9 A;  5FDZ A;  5I1Q A;  5IID A;  5BT4 A;  3O34 A;  4IOR A;  1EQF A;  3U5M A;  2R0V A;  5DBM A;  5DYC A;  4YAT A;  4TT2 A;  5CZG A;  4QR4 A;  4N3W A;  2MJV B;  5TCM A;  5DX4 A;  5F2P A;  4LYI A;  5DYA A;  2YEK A;  3LQH A;  4UIU A;  5HRV A;  4MR5 A;  5AME A;  1ZS5 A;  4O77 A;  4YY4 A;  2RO1 A;  2YEM A;  5H1V A;  5II1 A;  3I3J A;  5A82 A;  5FE9 A;  5I7Y A;  4O76 A;  3P1F A;  5FE3 A;  5E7D A;  5A81 A;  5H1T A;  5A5P A;  4PKL A;  5DKD A;  4YYD A;  3P5O A;  5EIC A;  5HJC A;  3HMF A;  4A9H A;  5FE8 A;  4MEP A;  5EV9 A;  4E96 A;  5HRW A;  5LKZ A;  5EPS A;  5C87 A;  5CQA A;  4CFK A;  4QSS A;  2OUO A;  5A5S A;  4TT6 A;  4QR3 A;  4NYX A;  3O37 A;  4HBY A;  4CUP A;  5KHM A;  5FB0 A;  4A9I A;  4LYW A;  5KTX A;  5EWC A;  2E3K A;  4YK0 A;  5COI A;  5D7X A;  3G0J A;  4UYH A;  5EWW A;  4MEO A;  4YBS A;  5KU3 A;  3G0L A;  5II2 A;  5FG6 A;  3ZYU A;  4YYN A;  4NYV A;  5CS8 A;  1WUG A;  4HXL A;  4UIX A;  5EQ1 A;  2R10 A;  3AQA A;  5ENH A;  5LJ2 A;  5ETB A;  5IGL A;  2KTB B;  2LSP B;  3JVJ A;  3JVM A;  4HXP A;  3LQI A;  3O35 A;  4MR4 A;  5A85 A;  3FKM X;  5HEM A;  4UIT A;  4C66 A;  5CTL A;  4QB3 A;  4HXM A;  1N72 A;  5FE4 A;  4HXN A;  5LVQ A;  4IR4 A;  2L84 A;  5ETD A;  4TYL A;  4A9F A;  3HME A;  4QR5 A;  3DAI A;  5ENI A;  3O33 A;  4HXS A;  5CU8 A;  5CY9 A;  2L5E A;  5EWV A;  1E6I A;  4BW3 A;  4TZ2 A;  2YW5 A;  5D3L A;  4IR5 A;  2N9G A;  4QSP A;  5L99 A;  2I7K A;  4TU6 A;  4Z6I A;  4XY8 A;  4J3I A;  4QEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...