5FE0A

Crystal structure of human pcaf bromodomain in complex with acetyllysine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
108
structure length
108
Chain Sequence
DPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Histone acetyltransferase KAT2B
publication title Structure-Based Identification of Inhibitory Fragments Targeting the p300/CBP-Associated Factor Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fe0A00
2I7KA 5E73A 4MEOA 5KO4A 4UIUA 3RCWA 4YABA 2L84A 4A9KA 4XUAA 5D0CA 5C8GA 5LKZA 4TTEA 5EPBA 5LVRA 4J0SA 5FE3A 2GRCA 4O76A 5C4QA 4OGIA 4QUTA 4NS5A 5BT4A 3LXJA 4FLPA 5EK9A 4X2IA 5EP7A 5ENFA 5II2A 4TZ2A 5A5NA 4PS5A 5DKDA 4YYKA 5H1VA 4NR4A 5CP5A 4LZ2A 3JVMA 1E6IA 2R0YA 3QZVA 5FB1A 4XUBA 5ETDA 5LJ1A 3JVKA 4YATA 5E0RA 5F1HA 3TLPA 4A9HA 3Q2FA 3UV4A 4ZC9A 5I7YA 5EU1A 5HQ5A 4QSTA 4O72A 5F5ZA 4QBMA 4LYWA 5EWWA 4CURA 5ENBA 5D24A 2D82A 5D3LA 4QYLA 4HXKA 4OUFA 5CPEA 5HFQA 2RNWA 5FG6A 4QSXA 5CQ3A 4IR6A 5DLZA 5CGPA 2L5EA 3LQJA 5A5OA 4IOQA 4QR5A 5KTUA 5A83A 4C67A 3D7CA 5I88A 4LRGA 5FH8A 4Z1QA 5EGUA 4YY4A 4NRBA 4HBYA 3P1EA 5FE5A 3AQAA 3LQIA 4UYFA 2DVQA 2RNXA 4UITA 4UIYA 5HJCA 5IGKA 4WIVA 5A81A 4QYDA 4QEVA 4QSPA 2E7OA 1JM4B 4J3IA 4NR6A 4QR3A 5CRZA 4YBMA 5KHMA 4YYIA 4QC1A 4QC3A 4N4HA 5I29A 3U5KA 4YYDA 4UIVA 2RS9B 5EWCA 4NR8A 4OGJA 5FE4A 5DYCA 4CUSA 5H1UA 5DKHA 2F6JA 5E9VA 3QZTA 1EQFA 2YQDA 4XY8A 4NUEA 5E3DA 5FB0A 5F1LA 2LSPB 5E9YA 5ENIA 5A7CA 4IORA 4UYFB 4O71A 2NXBA 4NQMA 5DFDA 5HQ6A 5FG5A 5D3TA 4AKNA 5JI8A 4YYNA 3DAIA 5CQTA 5ENHA 3Q2EA 3P5OA 4LYIA 5CQ5A 2E3KA 2YEMA 5FH7A 2F6NA 4TU4A 5IBNA 5ENCA 4TQNA 4CUTA 5I86A 5DKCA 5E9IA 4HXMA 4LZSA 4ZQLA 4CUQA 4QSWA 4ALGA 2R0SA 2KTBB 5HRXA 5HFRA 5KU3A 5D3SA 5DY7A 5AMFA 4UIXA 5L96A 4MENA 5ETBA 4YH4A 4N4GA 3UW9A 5FE6A 3O35A 5CUDA 4QY4A 5EPSA 4O7EA 2OUOA 3QZSA 4O70A 4BJXA 5CUCA 5FFYA 5EISA 4QSRA 4UYHA 5CQAA 5LKTA 4HXRA 4UYDA 4QEUA 5EI4A 5D7XA 5A82A 5II1A 4NXJA 5CS8A 2DVSA 5FE0A 5HEMA 4QSVA 4TS8A 3G0JA 2DVRA 2R0VA 5D3HA 5HM0A 5HENA 3MUKA 3O34A 5KTWA 1JSPB 4YAXA 4Z93A 5CUBA 5F3AA 5LUUA 3U5JA 5J0DA 4Z1SA 5DFBA 2H60A 5CU8A 4PY6A 5E74A 5D3RA 4NYXA 5FDZA 5EWVA 5EV9A 4QB3A 3LJWA 5FE7A 4XY9A 5EQ1A 5DLXA 5D3JA 4ZW1A 5I40A 3U5PA 4QSSA 4WHUA 3O37A 4YBTA 2YDWA 4YBSA 5F63A 5F36A 4BW2A 4Q0OA 4N4IA 3SVFA 5I80A 1F68A 4HXNA 3IU6A 4A9EA 4MR3A 4GPJA 5G4SA 4QUUA 4XYAA 5HCLA 3O36A 5LJ2A 1WUGA 4BW3A 5L98A 2YW5A 5AD3A 3I3JA 5DFCA 2RFJA 3IU5A 5DYAA 4BHWA 4NR7A 4NRCA 5EM3A 2I8NA 5HLSA 5H85A 4YH3A 5HRWA 3MB3A 4Q0NA 4MR4A 4LC2A 3ZYUA 4LR6A 5CTLA 4CUUA 4A9LA 3HMEA 4LZRA 5IIDA 5HQ7A 4Z6HA 5E9MA 4NR9A 5D3NA 5H1TA 4HXLA 3UVWA 5E3GA 3U5LA 5TCMA 4Z6IA 2DWWA 3HMHA 4A9IA 3UVXA 5LKXA 5EPRA 5E7DA 5ENJA 5DW1A 2OO1A 5CRMA 5EWHA 4MEQA 5CQ6A 4QZSA 4HXSA 5EA1A 5FFVA 4MR6A 4TT2A 4PKLA 4O75A 4NR5A 4CFKA 2L85A 5AD2A 5IGMA 5CFWA 4TT4A 5BT3A 4CL9A 3O33A 2DKWA 4O7CA 2G4AA 5DYUA 5F62A 4YY6A 4NQNA 3SVHA 4KCXA 5IGLA 5CQ4A 4O77A 5D25A 5AMEA 5F60A 4BW4A 5K29A 4BW1A 5LVQA 4TU6A 4RVRA 5A5SA 4UIZA 5L97A 1X0JA 3P1DA 3G0LA 5FE8A 5FH6A 4PCIA 4UYGA 2R10A 5I7XA 2RO1A 4MEPA 3JVJA 2YELA 5CY9A 4J1PA 4A9FA 5F25A 1ZS5A 4ALHA 2E7NA 5C7NA 4YK0A 4HBXA 3U5NA 2WP1A 4WHWA 2RI7A 3SVGA 5CQ8A 3NXBA 5KTXA 3U5MA 3U5OA 5L99A 3ONIA 5FE2A 2MJVB 5A5PA 5JWMA 5A5QA 4A9MA 4IR3A 5FG4A 5I89A 5IGNA 2WP2A 5ACYA 4O7AA 5CQ7A 4HXPA 5HRVA 3UVDA 5DW2A 4YC9A 2YYNA 4TZ8A 4YYMA 3AADA 5I83A 2FSAA 5C85A 4QSUA 5CZGA 4HBVA 3FKMX 5HELA 4NYWA 4YYHA 5E9KA 4E96A 3DWYA 3P1CA 3S92A 1WUMA 5D26A 5L8TA 4IR4A 4N4FA 4O7FA 4DONA 4QSQA 4CLBA 4Y03A 4A9OA 3LQHA 3MB4A 4F3IA 2RNYA 2DATA 5DYXA 5ENGA 5L8UA 4QEWA 4QNSA 4MR5A 5A85A 5EVAA 4NUDA 4NRAA 5TB6A 3HMFA 5CUGA 4N3WA 4NUCA 3P1FA 4YADA 5CUAA 2YEKA 1N72A 4CFLA 5FFWA 5LJ0A 5FE1A 2D9EA 2N9GA 4A9NA 4KV1A 5COIA 3S91A 4IOOA 4TT6A 5LKUA 4LYSA 4TYLA 5IG6A 4O78A 3MXFA 4IR5A 4NYVA 5DBMA 4YYGA 5EWDA 3JVLA 4QR4A 5C87A 5CUEA 5FE9A 5ENEA 4CUPA 4PCEA 3K2JA 5BT5A 2DVVA 5E9LA 3UVYA 3UV5A 4KV4A 5F61A 4HBWA 5DX4A 2OSSA 3MULA 5D3PA 4UYEA 5F2PA 3UV2A 4O74A 4UIWA 5FBXA 3MQMA 5A5RA 4C66A 5I1QA 4LDFA 5EICA 4HXOA 4O7BA 4A9JA 4J0RA 5G4RA 4PTBA 4YYJA 3GG3A 5C89A
chains in the Genus database with same CATH superfamily
2I7KA 5E73A 4MEOA 5KO4A 4UIUA 3RCWA 4YABA 2L84A 1ZKRA 4A9KA 4XUAA 5D0CA 5C8GA 5LKZA 4TTEA 5EPBA 5LVRA 4J0SA 5FE3A 2GRCA 4O76A 5C4QA 4OGIA 4QUTA 4NS5A 5BT4A 3LXJA 4FLPA 5EK9A 4X2IA 5EP7A 5ENFA 5II2A 4TZ2A 5A5NA 4PS5A 5DKDA 4YYKA 5H1VA 4NR4A 5CP5A 4LZ2A 3JVMA 1E6IA 2R0YA 3QZVA 5FB1A 4XUBA 5ETDA 5LJ1A 3JVKA 4YATA 5E0RA 5F1HA 3TLPA 4A9HA 3Q2FA 3UV4A 4ZC9A 5I7YA 5EU1A 5HQ5A 4QSTA 4O72A 5F5ZA 4QBMA 4LYWA 5EWWA 4CURA 5ENBA 5D24A 2D82A 5D3LA 4QYLA 4HXKA 4OUFA 5CPEA 5HFQA 2RNWA 5FG6A 4QSXA 5CQ3A 4IR6A 5DLZA 5CGPA 2L5EA 3LQJA 5A5OA 4IOQA 4QR5A 5KTUA 5A83A 4C67A 3D7CA 5I88A 4LRGA 5FH8A 4Z1QA 5EGUA 4YY4A 4NRBA 4HBYA 3P1EA 5FE5A 3AQAA 3LQIA 4UYFA 2DVQA 2RNXA 4UITA 4UIYA 5HJCA 5IGKA 4WIVA 5A81A 4QYDA 4QEVA 4QSPA 2E7OA 1JM4B 4J3IA 4NR6A 4QR3A 5CRZA 4YBMA 5KHMA 4YYIA 4QC1A 4QC3A 4N4HA 5I29A 3U5KA 4YYDA 4UIVA 2RS9B 5EWCA 4NR8A 4OGJA 5FE4A 5DYCA 4CUSA 5H1UA 5DKHA 2F6JA 5E9VA 3QZTA 1EQFA 2YQDA 4XY8A 4NUEA 5E3DA 5FB0A 5F1LA 2LSPB 5E9YA 5ENIA 5A7CA 4IORA 4UYFB 4O71A 2NXBA 4NQMA 5DFDA 5HQ6A 5FG5A 5D3TA 4AKNA 5JI8A 4YYNA 3DAIA 5CQTA 5ENHA 3Q2EA 3P5OA 4LYIA 5CQ5A 2E3KA 2YEMA 5FH7A 2F6NA 4TU4A 5IBNA 5ENCA 4TQNA 4CUTA 5I86A 5DKCA 5E9IA 4HXMA 4LZSA 4ZQLA 4CUQA 4QSWA 4ALGA 2R0SA 2KTBB 5HRXA 5HFRA 2EJNA 5KU3A 5D3SA 5DY7A 5AMFA 4UIXA 5L96A 4MENA 5ETBA 4YH4A 4N4GA 3UW9A 5FE6A 3O35A 5CUDA 4QY4A 5EPSA 4O7EA 2OUOA 3QZSA 4O70A 4BJXA 5CUCA 5FFYA 5EISA 4QSRA 4UYHA 5CQAA 5LKTA 4HXRA 4UYDA 4QEUA 5EI4A 5D7XA 5A82A 5II1A 4NXJA 5CS8A 2DVSA 5FE0A 5HEMA 4QSVA 4TS8A 3G0JA 2DVRA 2R0VA 5D3HA 5HM0A 5HENA 3MUKA 3O34A 5KTWA 1JSPB 4YAXA 4Z93A 5CUBA 5F3AA 5LUUA 3U5JA 5J0DA 4Z1SA 5DFBA 2H60A 5CU8A 4PY6A 5E74A 5D3RA 4NYXA 5FDZA 5EWVA 5EV9A 4QB3A 1PUOA 3LJWA 5FE7A 4XY9A 5EQ1A 5DLXA 5D3JA 4ZW1A 5I40A 3U5PA 4QSSA 4WHUA 3O37A 4YBTA 2YDWA 4YBSA 5F63A 5F36A 4BW2A 4Q0OA 4N4IA 3SVFA 5I80A 1F68A 4HXNA 3IU6A 4A9EA 4MR3A 4GPJA 5G4SA 4QUUA 4XYAA 5HCLA 3O36A 5LJ2A 1WUGA 4BW3A 5L98A 2YW5A 5AD3A 3I3JA 5DFCA 2RFJA 3IU5A 5DYAA 4AKHA 4BHWA 4NR7A 4AKGA 4NRCA 5EM3A 2I8NA 3ERRA 5H85A 5HLSA 4YH3A 5HRWA 3MB3A 4Q0NA 4MR4A 4LC2A 3ZYUA 4LR6A 5CTLA 4CUUA 4A9LA 3HMEA 4LZRA 5IIDA 5HQ7A 4Z6HA 5E9MA 4NR9A 5D3NA 5H1TA 4HXLA 3UVWA 5E3GA 3U5LA 5TCMA 4Z6IA 2DWWA 3HMHA 4A9IA 3UVXA 4AI6A 5LKXA 5EPRA 5E7DA 5ENJA 5DW1A 2OO1A 5CRMA 5EWHA 4MEQA 5CQ6A 4QZSA 4HXSA 5EA1A 5FFVA 4MR6A 4TT2A 4PKLA 4O75A 4NR5A 4CFKA 2L85A 5AD2A 5IGMA 5CFWA 4TT4A 5BT3A 4CL9A 3O33A 2DKWA 4O7CA 2G4AA 5DYUA 5F62A 4YY6A 4NQNA 3SVHA 4KCXA 5IGLA 5CQ4A 4O77A 5D25A 5AMEA 5F60A 4BW4A 5K29A 4BW1A 5LVQA 4TU6A 4RVRA 5A5SA 4UIZA 5L97A 1X0JA 3P1DA 3G0LA 5FE8A 5FH6A 4PCIA 4UYGA 2R10A 5I7XA 2RO1A 4MEPA 3JVJA 2YELA 5CY9A 4J1PA 4A9FA 5F25A 1ZS5A 4ALHA 2E7NA 5C7NA 4YK0A 4HBXA 3U5NA 2WP1A 4WHWA 2RI7A 3SVGA 5CQ8A 3NXBA 5KTXA 3U5MA 3U5OA 4AKIA 5L99A 3ONIA 5FE2A 2MJVB 5A5PA 5JWMA 5A5QA 4A9MA 4IR3A 5FG4A 5I89A 5IGNA 2WP2A 5ACYA 4O7AA 5CQ7A 4HXPA 5HRVA 3UVDA 5DW2A 4YC9A 2YYNA 4TZ8A 4YYMA 3AADA 5I83A 2FSAA 5C85A 4QSUA 3D1DA 5CZGA 4HBVA 3FKMX 5HELA 4NYWA 4YYHA 5E9KA 4E96A 3DWYA 3P1CA 3S92A 1WUMA 5D26A 5L8TA 4IR4A 4N4FA 4O7FA 4DONA 4QSQA 4CLBA 4Y03A 4A9OA 3LQHA 3MB4A 4F3IA 2RNYA 2DATA 5DYXA 5ENGA 5L8UA 4QEWA 4QNSA 4MR5A 5A85A 5EVAA 4NUDA 4NRAA 5TB6A 3HMFA 5CUGA 4N3WA 4NUCA 3P1FA 4YADA 5CUAA 2YEKA 1N72A 4CFLA 5FFWA 5LJ0A 5FE1A 3VKGA 2D9EA 2N9GA 4A9NA 4KV1A 5COIA 3S91A 4IOOA 4TT6A 5LKUA 4LYSA 4TYLA 5IG6A 4O78A 3MXFA 4IR5A 4NYVA 5DBMA 4YYGA 5EWDA 3JVLA 4QR4A 5C87A 5CUEA 5FE9A 5ENEA 4CUPA 4PCEA 3K2JA 3VKHA 5BT5A 2DVVA 5E9LA 3UVYA 3UV5A 3D1BA 4KV4A 5F61A 4HBWA 5DX4A 2OSSA 3MULA 5D3PA 4UYEA 5F2PA 3UV2A 4O74A 4UIWA 5FBXA 3MQMA 5A5RA 4C66A 5I1QA 4LDFA 5EICA 4HXOA 4O7BA 4A9JA 4J0RA 5G4RA 4PTBA 4YYJA 3GG3A 5C89A
chains in the Genus database with same CATH topology
2I7KA 5E73A 4MEOA 5KO4A 4UIUA 3RCWA 4YABA 2L84A 4A9KA 4XUAA 5D0CA 5C8GA 5LKZA 4TTEA 5EPBA 5LVRA 4J0SA 5FE3A 2GRCA 4O76A 5C4QA 4OGIA 4QUTA 4NS5A 5BT4A 3LXJA 4FLPA 5EK9A 4X2IA 5EP7A 5ENFA 5II2A 4TZ2A 5A5NA 4PS5A 5DKDA 4YYKA 5H1VA 4NR4A 5CP5A 4LZ2A 3JVMA 1E6IA 2R0YA 3QZVA 5FB1A 4XUBA 5ETDA 5LJ1A 3JVKA 4YATA 5E0RA 5F1HA 3TLPA 4A9HA 3Q2FA 3UV4A 4ZC9A 5I7YA 5EU1A 5HQ5A 4QSTA 4O72A 5F5ZA 4QBMA 4LYWA 5EWWA 4CURA 5ENBA 5D24A 2D82A 5D3LA 4QYLA 4HXKA 4OUFA 5CPEA 5HFQA 2RNWA 5FG6A 4QSXA 5CQ3A 4IR6A 5DLZA 5CGPA 2L5EA 3LQJA 5A5OA 4IOQA 4QR5A 5KTUA 5A83A 4C67A 3D7CA 5I88A 4LRGA 5FH8A 4Z1QA 5EGUA 4YY4A 4NRBA 4HBYA 3P1EA 5FE5A 3AQAA 3LQIA 4UYFA 2DVQA 2RNXA 4UITA 4UIYA 5HJCA 5IGKA 4WIVA 5A81A 4QYDA 4QEVA 4QSPA 2E7OA 1JM4B 4J3IA 4NR6A 4QR3A 5CRZA 4YBMA 5KHMA 4YYIA 4QC1A 4QC3A 4N4HA 5I29A 3U5KA 4YYDA 4UIVA 2RS9B 5EWCA 4NR8A 4OGJA 5FE4A 5DYCA 4CUSA 5H1UA 5DKHA 2F6JA 5E9VA 3QZTA 1EQFA 2YQDA 4XY8A 4NUEA 5E3DA 5FB0A 5F1LA 2LSPB 5E9YA 5ENIA 5A7CA 4IORA 4UYFB 4O71A 2NXBA 4NQMA 5DFDA 5HQ6A 5FG5A 5D3TA 4AKNA 5JI8A 4YYNA 3DAIA 5CQTA 5ENHA 3Q2EA 3P5OA 4LYIA 5CQ5A 2E3KA 2YEMA 5FH7A 2F6NA 4TU4A 5IBNA 5ENCA 4TQNA 4CUTA 5I86A 5DKCA 5E9IA 4HXMA 4LZSA 4ZQLA 4CUQA 4QSWA 4ALGA 2R0SA 2KTBB 5HRXA 5HFRA 5KU3A 5D3SA 5DY7A 5AMFA 4UIXA 5L96A 4MENA 5ETBA 4YH4A 4N4GA 3UW9A 5FE6A 3O35A 5CUDA 4QY4A 5EPSA 4O7EA 2OUOA 3QZSA 4O70A 4BJXA 5CUCA 5FFYA 5EISA 4QSRA 4UYHA 5CQAA 5LKTA 4HXRA 4UYDA 4QEUA 5EI4A 5D7XA 5A82A 5II1A 4NXJA 5CS8A 2DVSA 5FE0A 5HEMA 4QSVA 4TS8A 3G0JA 2DVRA 2R0VA 5D3HA 5HM0A 5HENA 3MUKA 3O34A 5KTWA 1JSPB 4YAXA 4Z93A 5CUBA 5F3AA 5LUUA 3U5JA 5J0DA 4Z1SA 5DFBA 2H60A 5CU8A 4PY6A 5E74A 5D3RA 4NYXA 5FDZA 5EWVA 5EV9A 4QB3A 3LJWA 5FE7A 4XY9A 5EQ1A 5DLXA 5D3JA 4ZW1A 5I40A 3U5PA 4QSSA 4WHUA 3O37A 4YBTA 2YDWA 4YBSA 5F63A 5F36A 4BW2A 4Q0OA 4N4IA 3SVFA 5I80A 1F68A 4HXNA 3IU6A 4A9EA 4MR3A 4GPJA 5G4SA 4QUUA 4XYAA 5HCLA 3O36A 5LJ2A 1WUGA 4BW3A 5L98A 2YW5A 5AD3A 3I3JA 5DFCA 2RFJA 3IU5A 5DYAA 4BHWA 4NR7A 4NRCA 5EM3A 2I8NA 5HLSA 5H85A 4YH3A 5HRWA 3MB3A 4Q0NA 4MR4A 4LC2A 3ZYUA 4LR6A 5CTLA 4CUUA 4A9LA 3HMEA 4LZRA 5IIDA 5HQ7A 4Z6HA 5E9MA 4NR9A 5D3NA 5H1TA 4HXLA 3UVWA 5E3GA 3U5LA 5TCMA 4Z6IA 2DWWA 3HMHA 4A9IA 3UVXA 5LKXA 5EPRA 5E7DA 5ENJA 5DW1A 2OO1A 5CRMA 5EWHA 4MEQA 5CQ6A 4QZSA 4HXSA 5EA1A 5FFVA 4MR6A 4TT2A 4PKLA 4O75A 4NR5A 4CFKA 2L85A 5AD2A 5IGMA 5CFWA 4TT4A 5BT3A 4CL9A 3O33A 2DKWA 4O7CA 2G4AA 5DYUA 5F62A 4YY6A 4NQNA 3SVHA 4KCXA 5IGLA 5CQ4A 4O77A 5D25A 5AMEA 5F60A 4BW4A 5K29A 4BW1A 5LVQA 4TU6A 4RVRA 5A5SA 4UIZA 5L97A 1X0JA 3P1DA 3G0LA 5FE8A 5FH6A 4PCIA 4UYGA 2R10A 5I7XA 2RO1A 4MEPA 3JVJA 2YELA 5CY9A 4J1PA 4A9FA 5F25A 1ZS5A 4ALHA 2E7NA 5C7NA 4YK0A 4HBXA 3U5NA 2WP1A 4WHWA 2RI7A 3SVGA 5CQ8A 3NXBA 5KTXA 3U5MA 3U5OA 5L99A 3ONIA 5FE2A 2MJVB 5A5PA 5JWMA 5A5QA 4A9MA 4IR3A 5FG4A 5I89A 5IGNA 2WP2A 5ACYA 4O7AA 5CQ7A 4HXPA 5HRVA 3UVDA 5DW2A 4YC9A 2YYNA 4TZ8A 4YYMA 3AADA 5I83A 2FSAA 5C85A 4QSUA 5CZGA 4HBVA 3FKMX 5HELA 4NYWA 4YYHA 5E9KA 4E96A 3DWYA 3P1CA 3S92A 1WUMA 5D26A 5L8TA 4IR4A 4N4FA 4O7FA 4DONA 4QSQA 4CLBA 4Y03A 4A9OA 3LQHA 3MB4A 4F3IA 2RNYA 2DATA 5DYXA 5ENGA 5L8UA 4QEWA 4QNSA 4MR5A 5A85A 5EVAA 4NUDA 4NRAA 5TB6A 3HMFA 5CUGA 4N3WA 4NUCA 3P1FA 4YADA 5CUAA 2YEKA 1N72A 4CFLA 5FFWA 5LJ0A 5FE1A 2D9EA 2N9GA 4A9NA 4KV1A 5COIA 3S91A 4IOOA 4TT6A 5LKUA 4LYSA 4TYLA 5IG6A 4O78A 3MXFA 4IR5A 4NYVA 5DBMA 4YYGA 5EWDA 3JVLA 4QR4A 5C87A 5CUEA 5FE9A 5ENEA 4CUPA 4PCEA 3K2JA 5BT5A 2DVVA 5E9LA 3UVYA 3UV5A 4KV4A 5F61A 4HBWA 5DX4A 2OSSA 3MULA 5D3PA 4UYEA 5F2PA 3UV2A 4O74A 4UIWA 5FBXA 3MQMA 5A5RA 4C66A 5I1QA 4LDFA 5EICA 4HXOA 4O7BA 4A9JA 4J0RA 5G4RA 4PTBA 4YYJA 3GG3A 5C89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I7K A;  5E73 A;  4MEO A;  5KO4 A;  4UIU A;  3RCW A;  4YAB A;  2L84 A;  4A9K A;  4XUA A;  5D0C A;  5C8G A;  5LKZ A;  4TTE A;  5EPB A;  5LVR A;  4J0S A;  5FE3 A;  2GRC A;  4O76 A;  5C4Q A;  4OGI A;  4QUT A;  4NS5 A;  5BT4 A;  3LXJ A;  4FLP A;  5EK9 A;  4X2I A;  5EP7 A;  5ENF A;  5II2 A;  4TZ2 A;  5A5N A;  4PS5 A;  5DKD A;  4YYK A;  5H1V A;  4NR4 A;  5CP5 A;  4LZ2 A;  3JVM A;  1E6I A;  2R0Y A;  3QZV A;  5FB1 A;  4XUB A;  5ETD A;  5LJ1 A;  3JVK A;  4YAT A;  5E0R A;  5F1H A;  3TLP A;  4A9H A;  3Q2F A;  3UV4 A;  4ZC9 A;  5I7Y A;  5EU1 A;  5HQ5 A;  4QST A;  4O72 A;  5F5Z A;  4QBM A;  4LYW A;  5EWW A;  4CUR A;  5ENB A;  5D24 A;  2D82 A;  5D3L A;  4QYL A;  4HXK A;  4OUF A;  5CPE A;  5HFQ A;  2RNW A;  5FG6 A;  4QSX A;  5CQ3 A;  4IR6 A;  5DLZ A;  5CGP A;  2L5E A;  3LQJ A;  5A5O A;  4IOQ A;  4QR5 A;  5KTU A;  5A83 A;  4C67 A;  3D7C A;  5I88 A;  4LRG A;  5FH8 A;  4Z1Q A;  5EGU A;  4YY4 A;  4NRB A;  4HBY A;  3P1E A;  5FE5 A;  3AQA A;  3LQI A;  4UYF A;  2DVQ A;  2RNX A;  4UIT A;  4UIY A;  5HJC A;  5IGK A;  4WIV A;  5A81 A;  4QYD A;  4QEV A;  4QSP A;  2E7O A;  1JM4 B;  4J3I A;  4NR6 A;  4QR3 A;  5CRZ A;  4YBM A;  5KHM A;  4YYI A;  4QC1 A;  4QC3 A;  4N4H A;  5I29 A;  3U5K A;  4YYD A;  4UIV A;  2RS9 B;  5EWC A;  4NR8 A;  4OGJ A;  5FE4 A;  5DYC A;  4CUS A;  5H1U A;  5DKH A;  2F6J A;  5E9V A;  3QZT A;  1EQF A;  2YQD A;  4XY8 A;  4NUE A;  5E3D A;  5FB0 A;  5F1L A;  2LSP B;  5E9Y A;  5ENI A;  5A7C A;  4IOR A;  4UYF B;  4O71 A;  2NXB A;  4NQM A;  5DFD A;  5HQ6 A;  5FG5 A;  5D3T A;  4AKN A;  5JI8 A;  4YYN A;  3DAI A;  5CQT A;  5ENH A;  3Q2E A;  3P5O A;  4LYI A;  5CQ5 A;  2E3K A;  2YEM A;  5FH7 A;  2F6N A;  4TU4 A;  5IBN A;  5ENC A;  4TQN A;  4CUT A;  5I86 A;  5DKC A;  5E9I A;  4HXM A;  4LZS A;  4ZQL A;  4CUQ A;  4QSW A;  4ALG A;  2R0S A;  2KTB B;  5HRX A;  5HFR A;  5KU3 A;  5D3S A;  5DY7 A;  5AMF A;  4UIX A;  5L96 A;  4MEN A;  5ETB A;  4YH4 A;  4N4G A;  3UW9 A;  5FE6 A;  3O35 A;  5CUD A;  4QY4 A;  5EPS A;  4O7E A;  2OUO A;  3QZS A;  4O70 A;  4BJX A;  5CUC A;  5FFY A;  5EIS A;  4QSR A;  4UYH A;  5CQA A;  5LKT A;  4HXR A;  4UYD A;  4QEU A;  5EI4 A;  5D7X A;  5A82 A;  5II1 A;  4NXJ A;  5CS8 A;  2DVS A;  5FE0 A;  5HEM A;  4QSV A;  4TS8 A;  3G0J A;  2DVR A;  2R0V A;  5D3H A;  5HM0 A;  5HEN A;  3MUK A;  3O34 A;  5KTW A;  1JSP B;  4YAX A;  4Z93 A;  5CUB A;  5F3A A;  5LUU A;  3U5J A;  5J0D A;  4Z1S A;  5DFB A;  2H60 A;  5CU8 A;  4PY6 A;  5E74 A;  5D3R A;  4NYX A;  5FDZ A;  5EWV A;  5EV9 A;  4QB3 A;  3LJW A;  5FE7 A;  4XY9 A;  5EQ1 A;  5DLX A;  5D3J A;  4ZW1 A;  5I40 A;  3U5P A;  4QSS A;  4WHU A;  3O37 A;  4YBT A;  2YDW A;  4YBS A;  5F63 A;  5F36 A;  4BW2 A;  4Q0O A;  4N4I A;  3SVF A;  5I80 A;  1F68 A;  4HXN A;  3IU6 A;  4A9E A;  4MR3 A;  4GPJ A;  5G4S A;  4QUU A;  4XYA A;  5HCL A;  3O36 A;  5LJ2 A;  1WUG A;  4BW3 A;  5L98 A;  2YW5 A;  5AD3 A;  3I3J A;  5DFC A;  2RFJ A;  3IU5 A;  5DYA A;  4BHW A;  4NR7 A;  4NRC A;  5EM3 A;  2I8N A;  5HLS A;  5H85 A;  4YH3 A;  5HRW A;  3MB3 A;  4Q0N A;  4MR4 A;  4LC2 A;  3ZYU A;  4LR6 A;  5CTL A;  4CUU A;  4A9L A;  3HME A;  4LZR A;  5IID A;  5HQ7 A;  4Z6H A;  5E9M A;  4NR9 A;  5D3N A;  5H1T A;  4HXL A;  3UVW A;  5E3G A;  3U5L A;  5TCM A;  4Z6I A;  2DWW A;  3HMH A;  4A9I A;  3UVX A;  5LKX A;  5EPR A;  5E7D A;  5ENJ A;  5DW1 A;  2OO1 A;  5CRM A;  5EWH A;  4MEQ A;  5CQ6 A;  4QZS A;  4HXS A;  5EA1 A;  5FFV A;  4MR6 A;  4TT2 A;  4PKL A;  4O75 A;  4NR5 A;  4CFK A;  2L85 A;  5AD2 A;  5IGM A;  5CFW A;  4TT4 A;  5BT3 A;  4CL9 A;  3O33 A;  2DKW A;  4O7C A;  2G4A A;  5DYU A;  5F62 A;  4YY6 A;  4NQN A;  3SVH A;  4KCX A;  5IGL A;  5CQ4 A;  4O77 A;  5D25 A;  5AME A;  5F60 A;  4BW4 A;  5K29 A;  4BW1 A;  5LVQ A;  4TU6 A;  4RVR A;  5A5S A;  4UIZ A;  5L97 A;  1X0J A;  3P1D A;  3G0L A;  5FE8 A;  5FH6 A;  4PCI A;  4UYG A;  2R10 A;  5I7X A;  2RO1 A;  4MEP A;  3JVJ A;  2YEL A;  5CY9 A;  4J1P A;  4A9F A;  5F25 A;  1ZS5 A;  4ALH A;  2E7N A;  5C7N A;  4YK0 A;  4HBX A;  3U5N A;  2WP1 A;  4WHW A;  2RI7 A;  3SVG A;  5CQ8 A;  3NXB A;  5KTX A;  3U5M A;  3U5O A;  5L99 A;  3ONI A;  5FE2 A;  2MJV B;  5A5P A;  5JWM A;  5A5Q A;  4A9M A;  4IR3 A;  5FG4 A;  5I89 A;  5IGN A;  2WP2 A;  5ACY A;  4O7A A;  5CQ7 A;  4HXP A;  5HRV A;  3UVD A;  5DW2 A;  4YC9 A;  2YYN A;  4TZ8 A;  4YYM A;  3AAD A;  5I83 A;  2FSA A;  5C85 A;  4QSU A;  5CZG A;  4HBV A;  3FKM X;  5HEL A;  4NYW A;  4YYH A;  5E9K A;  4E96 A;  3DWY A;  3P1C A;  3S92 A;  1WUM A;  5D26 A;  5L8T A;  4IR4 A;  4N4F A;  4O7F A;  4DON A;  4QSQ A;  4CLB A;  4Y03 A;  4A9O A;  3LQH A;  3MB4 A;  4F3I A;  2RNY A;  2DAT A;  5DYX A;  5ENG A;  5L8U A;  4QEW A;  4QNS A;  4MR5 A;  5A85 A;  5EVA A;  4NUD A;  4NRA A;  5TB6 A;  3HMF A;  5CUG A;  4N3W A;  4NUC A;  3P1F A;  4YAD A;  5CUA A;  2YEK A;  1N72 A;  4CFL A;  5FFW A;  5LJ0 A;  5FE1 A;  2D9E A;  2N9G A;  4A9N A;  4KV1 A;  5COI A;  3S91 A;  4IOO A;  4TT6 A;  5LKU A;  4LYS A;  4TYL A;  5IG6 A;  4O78 A;  3MXF A;  4IR5 A;  4NYV A;  5DBM A;  4YYG A;  5EWD A;  3JVL A;  4QR4 A;  5C87 A;  5CUE A;  5FE9 A;  5ENE A;  4CUP A;  4PCE A;  3K2J A;  5BT5 A;  2DVV A;  5E9L A;  3UVY A;  3UV5 A;  4KV4 A;  5F61 A;  4HBW A;  5DX4 A;  2OSS A;  3MUL A;  5D3P A;  4UYE A;  5F2P A;  3UV2 A;  4O74 A;  4UIW A;  5FBX A;  3MQM A;  5A5R A;  4C66 A;  5I1Q A;  4LDF A;  5EIC A;  4HXO A;  4O7B A;  4A9J A;  4J0R A;  5G4R A;  4PTB A;  4YYJ A;  3GG3 A;  5C89 A; 
#chains in the Genus database with same CATH topology
 2I7K A;  5E73 A;  4MEO A;  5KO4 A;  4UIU A;  3RCW A;  4YAB A;  2L84 A;  1ZKR A;  4A9K A;  4XUA A;  5D0C A;  5C8G A;  5LKZ A;  4TTE A;  5EPB A;  5LVR A;  4J0S A;  5FE3 A;  2GRC A;  4O76 A;  5C4Q A;  4OGI A;  4QUT A;  4NS5 A;  5BT4 A;  3LXJ A;  4FLP A;  5EK9 A;  4X2I A;  5EP7 A;  5ENF A;  5II2 A;  4TZ2 A;  5A5N A;  4PS5 A;  5DKD A;  4YYK A;  5H1V A;  4NR4 A;  5CP5 A;  4LZ2 A;  3JVM A;  1E6I A;  2R0Y A;  3QZV A;  5FB1 A;  4XUB A;  5ETD A;  5LJ1 A;  3JVK A;  4YAT A;  5E0R A;  5F1H A;  3TLP A;  4A9H A;  3Q2F A;  3UV4 A;  4ZC9 A;  5I7Y A;  5EU1 A;  5HQ5 A;  4QST A;  4O72 A;  5F5Z A;  4QBM A;  4LYW A;  5EWW A;  4CUR A;  5ENB A;  5D24 A;  2D82 A;  5D3L A;  4QYL A;  4HXK A;  4OUF A;  5CPE A;  5HFQ A;  2RNW A;  5FG6 A;  4QSX A;  5CQ3 A;  4IR6 A;  5DLZ A;  5CGP A;  2L5E A;  3LQJ A;  5A5O A;  4IOQ A;  4QR5 A;  5KTU A;  5A83 A;  4C67 A;  3D7C A;  5I88 A;  4LRG A;  5FH8 A;  4Z1Q A;  5EGU A;  4YY4 A;  4NRB A;  4HBY A;  3P1E A;  5FE5 A;  3AQA A;  3LQI A;  4UYF A;  2DVQ A;  2RNX A;  4UIT A;  4UIY A;  5HJC A;  5IGK A;  4WIV A;  5A81 A;  4QYD A;  4QEV A;  4QSP A;  2E7O A;  1JM4 B;  4J3I A;  4NR6 A;  4QR3 A;  5CRZ A;  4YBM A;  5KHM A;  4YYI A;  4QC1 A;  4QC3 A;  4N4H A;  5I29 A;  3U5K A;  4YYD A;  4UIV A;  2RS9 B;  5EWC A;  4NR8 A;  4OGJ A;  5FE4 A;  5DYC A;  4CUS A;  5H1U A;  5DKH A;  2F6J A;  5E9V A;  3QZT A;  1EQF A;  2YQD A;  4XY8 A;  4NUE A;  5E3D A;  5FB0 A;  5F1L A;  2LSP B;  5E9Y A;  5ENI A;  5A7C A;  4IOR A;  4UYF B;  4O71 A;  2NXB A;  4NQM A;  5DFD A;  5HQ6 A;  5FG5 A;  5D3T A;  4AKN A;  5JI8 A;  4YYN A;  3DAI A;  5CQT A;  5ENH A;  3Q2E A;  3P5O A;  4LYI A;  5CQ5 A;  2E3K A;  2YEM A;  5FH7 A;  2F6N A;  4TU4 A;  5IBN A;  5ENC A;  4TQN A;  4CUT A;  5I86 A;  5DKC A;  5E9I A;  4HXM A;  4LZS A;  4ZQL A;  4CUQ A;  4QSW A;  4ALG A;  2R0S A;  2KTB B;  5HRX A;  5HFR A;  2EJN A;  5KU3 A;  5D3S A;  5DY7 A;  5AMF A;  4UIX A;  5L96 A;  4MEN A;  5ETB A;  4YH4 A;  4N4G A;  3UW9 A;  5FE6 A;  3O35 A;  5CUD A;  4QY4 A;  5EPS A;  4O7E A;  2OUO A;  3QZS A;  4O70 A;  4BJX A;  5CUC A;  5FFY A;  5EIS A;  4QSR A;  4UYH A;  5CQA A;  5LKT A;  4HXR A;  4UYD A;  4QEU A;  5EI4 A;  5D7X A;  5A82 A;  5II1 A;  4NXJ A;  5CS8 A;  2DVS A;  5FE0 A;  5HEM A;  4QSV A;  4TS8 A;  3G0J A;  2DVR A;  2R0V A;  5D3H A;  5HM0 A;  5HEN A;  3MUK A;  3O34 A;  5KTW A;  1JSP B;  4YAX A;  4Z93 A;  5CUB A;  5F3A A;  5LUU A;  3U5J A;  5J0D A;  4Z1S A;  5DFB A;  2H60 A;  5CU8 A;  4PY6 A;  5E74 A;  5D3R A;  4NYX A;  5FDZ A;  5EWV A;  5EV9 A;  4QB3 A;  1PUO A;  3LJW A;  5FE7 A;  4XY9 A;  5EQ1 A;  5DLX A;  5D3J A;  4ZW1 A;  5I40 A;  3U5P A;  4QSS A;  4WHU A;  3O37 A;  4YBT A;  2YDW A;  4YBS A;  5F63 A;  5F36 A;  4BW2 A;  4Q0O A;  4N4I A;  3SVF A;  5I80 A;  1F68 A;  4HXN A;  3IU6 A;  4A9E A;  4MR3 A;  4GPJ A;  5G4S A;  4QUU A;  4XYA A;  5HCL A;  3O36 A;  5LJ2 A;  1WUG A;  4BW3 A;  5L98 A;  2YW5 A;  5AD3 A;  3I3J A;  5DFC A;  2RFJ A;  3IU5 A;  5DYA A;  4AKH A;  4BHW A;  4NR7 A;  4AKG A;  4NRC A;  5EM3 A;  2I8N A;  3ERR A;  5H85 A;  5HLS A;  4YH3 A;  5HRW A;  3MB3 A;  4Q0N A;  4MR4 A;  4LC2 A;  3ZYU A;  4LR6 A;  5CTL A;  4CUU A;  4A9L A;  3HME A;  4LZR A;  5IID A;  5HQ7 A;  4Z6H A;  5E9M A;  4NR9 A;  5D3N A;  5H1T A;  4HXL A;  3UVW A;  5E3G A;  3U5L A;  5TCM A;  4Z6I A;  2DWW A;  3HMH A;  4A9I A;  3UVX A;  4AI6 A;  5LKX A;  5EPR A;  5E7D A;  5ENJ A;  5DW1 A;  2OO1 A;  5CRM A;  5EWH A;  4MEQ A;  5CQ6 A;  4QZS A;  4HXS A;  5EA1 A;  5FFV A;  4MR6 A;  4TT2 A;  4PKL A;  4O75 A;  4NR5 A;  4CFK A;  2L85 A;  5AD2 A;  5IGM A;  5CFW A;  4TT4 A;  5BT3 A;  4CL9 A;  3O33 A;  2DKW A;  4O7C A;  2G4A A;  5DYU A;  5F62 A;  4YY6 A;  4NQN A;  3SVH A;  4KCX A;  5IGL A;  5CQ4 A;  4O77 A;  5D25 A;  5AME A;  5F60 A;  4BW4 A;  5K29 A;  4BW1 A;  5LVQ A;  4TU6 A;  4RVR A;  5A5S A;  4UIZ A;  5L97 A;  1X0J A;  3P1D A;  3G0L A;  5FE8 A;  5FH6 A;  4PCI A;  4UYG A;  2R10 A;  5I7X A;  2RO1 A;  4MEP A;  3JVJ A;  2YEL A;  5CY9 A;  4J1P A;  4A9F A;  5F25 A;  1ZS5 A;  4ALH A;  2E7N A;  5C7N A;  4YK0 A;  4HBX A;  3U5N A;  2WP1 A;  4WHW A;  2RI7 A;  3SVG A;  5CQ8 A;  3NXB A;  5KTX A;  3U5M A;  3U5O A;  4AKI A;  5L99 A;  3ONI A;  5FE2 A;  2MJV B;  5A5P A;  5JWM A;  5A5Q A;  4A9M A;  4IR3 A;  5FG4 A;  5I89 A;  5IGN A;  2WP2 A;  5ACY A;  4O7A A;  5CQ7 A;  4HXP A;  5HRV A;  3UVD A;  5DW2 A;  4YC9 A;  2YYN A;  4TZ8 A;  4YYM A;  3AAD A;  5I83 A;  2FSA A;  5C85 A;  4QSU A;  3D1D A;  5CZG A;  4HBV A;  3FKM X;  5HEL A;  4NYW A;  4YYH A;  5E9K A;  4E96 A;  3DWY A;  3P1C A;  3S92 A;  1WUM A;  5D26 A;  5L8T A;  4IR4 A;  4N4F A;  4O7F A;  4DON A;  4QSQ A;  4CLB A;  4Y03 A;  4A9O A;  3LQH A;  3MB4 A;  4F3I A;  2RNY A;  2DAT A;  5DYX A;  5ENG A;  5L8U A;  4QEW A;  4QNS A;  4MR5 A;  5A85 A;  5EVA A;  4NUD A;  4NRA A;  5TB6 A;  3HMF A;  5CUG A;  4N3W A;  4NUC A;  3P1F A;  4YAD A;  5CUA A;  2YEK A;  1N72 A;  4CFL A;  5FFW A;  5LJ0 A;  5FE1 A;  3VKG A;  2D9E A;  2N9G A;  4A9N A;  4KV1 A;  5COI A;  3S91 A;  4IOO A;  4TT6 A;  5LKU A;  4LYS A;  4TYL A;  5IG6 A;  4O78 A;  3MXF A;  4IR5 A;  4NYV A;  5DBM A;  4YYG A;  5EWD A;  3JVL A;  4QR4 A;  5C87 A;  5CUE A;  5FE9 A;  5ENE A;  4CUP A;  4PCE A;  3K2J A;  3VKH A;  5BT5 A;  2DVV A;  5E9L A;  3UVY A;  3UV5 A;  3D1B A;  4KV4 A;  5F61 A;  4HBW A;  5DX4 A;  2OSS A;  3MUL A;  5D3P A;  4UYE A;  5F2P A;  3UV2 A;  4O74 A;  4UIW A;  5FBX A;  3MQM A;  5A5R A;  4C66 A;  5I1Q A;  4LDF A;  5EIC A;  4HXO A;  4O7B A;  4A9J A;  4J0R A;  5G4R A;  4PTB A;  4YYJ A;  3GG3 A;  5C89 A; 
#chains in the Genus database with same CATH homology
 2I7K A;  5E73 A;  4MEO A;  5KO4 A;  4UIU A;  3RCW A;  4YAB A;  2L84 A;  4A9K A;  4XUA A;  5D0C A;  5C8G A;  5LKZ A;  4TTE A;  5EPB A;  5LVR A;  4J0S A;  5FE3 A;  2GRC A;  4O76 A;  5C4Q A;  4OGI A;  4QUT A;  4NS5 A;  5BT4 A;  3LXJ A;  4FLP A;  5EK9 A;  4X2I A;  5EP7 A;  5ENF A;  5II2 A;  4TZ2 A;  5A5N A;  4PS5 A;  5DKD A;  4YYK A;  5H1V A;  4NR4 A;  5CP5 A;  4LZ2 A;  3JVM A;  1E6I A;  2R0Y A;  3QZV A;  5FB1 A;  4XUB A;  5ETD A;  5LJ1 A;  3JVK A;  4YAT A;  5E0R A;  5F1H A;  3TLP A;  4A9H A;  3Q2F A;  3UV4 A;  4ZC9 A;  5I7Y A;  5EU1 A;  5HQ5 A;  4QST A;  4O72 A;  5F5Z A;  4QBM A;  4LYW A;  5EWW A;  4CUR A;  5ENB A;  5D24 A;  2D82 A;  5D3L A;  4QYL A;  4HXK A;  4OUF A;  5CPE A;  5HFQ A;  2RNW A;  5FG6 A;  4QSX A;  5CQ3 A;  4IR6 A;  5DLZ A;  5CGP A;  2L5E A;  3LQJ A;  5A5O A;  4IOQ A;  4QR5 A;  5KTU A;  5A83 A;  4C67 A;  3D7C A;  5I88 A;  4LRG A;  5FH8 A;  4Z1Q A;  5EGU A;  4YY4 A;  4NRB A;  4HBY A;  3P1E A;  5FE5 A;  3AQA A;  3LQI A;  4UYF A;  2DVQ A;  2RNX A;  4UIT A;  4UIY A;  5HJC A;  5IGK A;  4WIV A;  5A81 A;  4QYD A;  4QEV A;  4QSP A;  2E7O A;  1JM4 B;  4J3I A;  4NR6 A;  4QR3 A;  5CRZ A;  4YBM A;  5KHM A;  4YYI A;  4QC1 A;  4QC3 A;  4N4H A;  5I29 A;  3U5K A;  4YYD A;  4UIV A;  2RS9 B;  5EWC A;  4NR8 A;  4OGJ A;  5FE4 A;  5DYC A;  4CUS A;  5H1U A;  5DKH A;  2F6J A;  5E9V A;  3QZT A;  1EQF A;  2YQD A;  4XY8 A;  4NUE A;  5E3D A;  5FB0 A;  5F1L A;  2LSP B;  5E9Y A;  5ENI A;  5A7C A;  4IOR A;  4UYF B;  4O71 A;  2NXB A;  4NQM A;  5DFD A;  5HQ6 A;  5FG5 A;  5D3T A;  4AKN A;  5JI8 A;  4YYN A;  3DAI A;  5CQT A;  5ENH A;  3Q2E A;  3P5O A;  4LYI A;  5CQ5 A;  2E3K A;  2YEM A;  5FH7 A;  2F6N A;  4TU4 A;  5IBN A;  5ENC A;  4TQN A;  4CUT A;  5I86 A;  5DKC A;  5E9I A;  4HXM A;  4LZS A;  4ZQL A;  4CUQ A;  4QSW A;  4ALG A;  2R0S A;  2KTB B;  5HRX A;  5HFR A;  5KU3 A;  5D3S A;  5DY7 A;  5AMF A;  4UIX A;  5L96 A;  4MEN A;  5ETB A;  4YH4 A;  4N4G A;  3UW9 A;  5FE6 A;  3O35 A;  5CUD A;  4QY4 A;  5EPS A;  4O7E A;  2OUO A;  3QZS A;  4O70 A;  4BJX A;  5CUC A;  5FFY A;  5EIS A;  4QSR A;  4UYH A;  5CQA A;  5LKT A;  4HXR A;  4UYD A;  4QEU A;  5EI4 A;  5D7X A;  5A82 A;  5II1 A;  4NXJ A;  5CS8 A;  2DVS A;  5FE0 A;  5HEM A;  4QSV A;  4TS8 A;  3G0J A;  2DVR A;  2R0V A;  5D3H A;  5HM0 A;  5HEN A;  3MUK A;  3O34 A;  5KTW A;  1JSP B;  4YAX A;  4Z93 A;  5CUB A;  5F3A A;  5LUU A;  3U5J A;  5J0D A;  4Z1S A;  5DFB A;  2H60 A;  5CU8 A;  4PY6 A;  5E74 A;  5D3R A;  4NYX A;  5FDZ A;  5EWV A;  5EV9 A;  4QB3 A;  3LJW A;  5FE7 A;  4XY9 A;  5EQ1 A;  5DLX A;  5D3J A;  4ZW1 A;  5I40 A;  3U5P A;  4QSS A;  4WHU A;  3O37 A;  4YBT A;  2YDW A;  4YBS A;  5F63 A;  5F36 A;  4BW2 A;  4Q0O A;  4N4I A;  3SVF A;  5I80 A;  1F68 A;  4HXN A;  3IU6 A;  4A9E A;  4MR3 A;  4GPJ A;  5G4S A;  4QUU A;  4XYA A;  5HCL A;  3O36 A;  5LJ2 A;  1WUG A;  4BW3 A;  5L98 A;  2YW5 A;  5AD3 A;  3I3J A;  5DFC A;  2RFJ A;  3IU5 A;  5DYA A;  4BHW A;  4NR7 A;  4NRC A;  5EM3 A;  2I8N A;  5HLS A;  5H85 A;  4YH3 A;  5HRW A;  3MB3 A;  4Q0N A;  4MR4 A;  4LC2 A;  3ZYU A;  4LR6 A;  5CTL A;  4CUU A;  4A9L A;  3HME A;  4LZR A;  5IID A;  5HQ7 A;  4Z6H A;  5E9M A;  4NR9 A;  5D3N A;  5H1T A;  4HXL A;  3UVW A;  5E3G A;  3U5L A;  5TCM A;  4Z6I A;  2DWW A;  3HMH A;  4A9I A;  3UVX A;  5LKX A;  5EPR A;  5E7D A;  5ENJ A;  5DW1 A;  2OO1 A;  5CRM A;  5EWH A;  4MEQ A;  5CQ6 A;  4QZS A;  4HXS A;  5EA1 A;  5FFV A;  4MR6 A;  4TT2 A;  4PKL A;  4O75 A;  4NR5 A;  4CFK A;  2L85 A;  5AD2 A;  5IGM A;  5CFW A;  4TT4 A;  5BT3 A;  4CL9 A;  3O33 A;  2DKW A;  4O7C A;  2G4A A;  5DYU A;  5F62 A;  4YY6 A;  4NQN A;  3SVH A;  4KCX A;  5IGL A;  5CQ4 A;  4O77 A;  5D25 A;  5AME A;  5F60 A;  4BW4 A;  5K29 A;  4BW1 A;  5LVQ A;  4TU6 A;  4RVR A;  5A5S A;  4UIZ A;  5L97 A;  1X0J A;  3P1D A;  3G0L A;  5FE8 A;  5FH6 A;  4PCI A;  4UYG A;  2R10 A;  5I7X A;  2RO1 A;  4MEP A;  3JVJ A;  2YEL A;  5CY9 A;  4J1P A;  4A9F A;  5F25 A;  1ZS5 A;  4ALH A;  2E7N A;  5C7N A;  4YK0 A;  4HBX A;  3U5N A;  2WP1 A;  4WHW A;  2RI7 A;  3SVG A;  5CQ8 A;  3NXB A;  5KTX A;  3U5M A;  3U5O A;  5L99 A;  3ONI A;  5FE2 A;  2MJV B;  5A5P A;  5JWM A;  5A5Q A;  4A9M A;  4IR3 A;  5FG4 A;  5I89 A;  5IGN A;  2WP2 A;  5ACY A;  4O7A A;  5CQ7 A;  4HXP A;  5HRV A;  3UVD A;  5DW2 A;  4YC9 A;  2YYN A;  4TZ8 A;  4YYM A;  3AAD A;  5I83 A;  2FSA A;  5C85 A;  4QSU A;  5CZG A;  4HBV A;  3FKM X;  5HEL A;  4NYW A;  4YYH A;  5E9K A;  4E96 A;  3DWY A;  3P1C A;  3S92 A;  1WUM A;  5D26 A;  5L8T A;  4IR4 A;  4N4F A;  4O7F A;  4DON A;  4QSQ A;  4CLB A;  4Y03 A;  4A9O A;  3LQH A;  3MB4 A;  4F3I A;  2RNY A;  2DAT A;  5DYX A;  5ENG A;  5L8U A;  4QEW A;  4QNS A;  4MR5 A;  5A85 A;  5EVA A;  4NUD A;  4NRA A;  5TB6 A;  3HMF A;  5CUG A;  4N3W A;  4NUC A;  3P1F A;  4YAD A;  5CUA A;  2YEK A;  1N72 A;  4CFL A;  5FFW A;  5LJ0 A;  5FE1 A;  2D9E A;  2N9G A;  4A9N A;  4KV1 A;  5COI A;  3S91 A;  4IOO A;  4TT6 A;  5LKU A;  4LYS A;  4TYL A;  5IG6 A;  4O78 A;  3MXF A;  4IR5 A;  4NYV A;  5DBM A;  4YYG A;  5EWD A;  3JVL A;  4QR4 A;  5C87 A;  5CUE A;  5FE9 A;  5ENE A;  4CUP A;  4PCE A;  3K2J A;  5BT5 A;  2DVV A;  5E9L A;  3UVY A;  3UV5 A;  4KV4 A;  5F61 A;  4HBW A;  5DX4 A;  2OSS A;  3MUL A;  5D3P A;  4UYE A;  5F2P A;  3UV2 A;  4O74 A;  4UIW A;  5FBX A;  3MQM A;  5A5R A;  4C66 A;  5I1Q A;  4LDF A;  5EIC A;  4HXO A;  4O7B A;  4A9J A;  4J0R A;  5G4R A;  4PTB A;  4YYJ A;  3GG3 A;  5C89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...