4PY6A

Crystal structure of bromodomain of pfa0510w from plasmodium falciparum
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
ENSNKRLLKQWEKILRDNVLKLLKNDNNAFYFKTPVLEDININDNIKEEYRIKIKKPMDYITISRNLSDGIYKEPIDFYHDMKLIYKNCIDFNPDIEENKYIIEAAKSSDMKFEFLWNKWKEKINNNFCDLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain protein, putative
publication title Crystal Structure of bromodomain of PFA0510w from Plasmodium Falciparum
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Protein binding
total genus 40
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4py6A00
2DVQA 3UV2A 5F61A 3O36A 4HBYA 4J3IA 5J0DA 4TT2A 3UW9A 5I7XA 5I29A 4MR6A 5CUGA 4BHWA 5EWCA 5HQ5A 5KTUA 4UYDA 3MXFA 4IOOA 3HMEA 5C85A 4TYLA 5AMEA 5HENA 4QSTA 4YH4A 4Z6IA 5A5QA 5D7XA 3O37A 3AADA 4O7FA 5FDZA 2YEMA 4HXNA 2F6NA 2RNYA 4O77A 4NUDA 4NYWA 5FH7A 3QZVA 4NYXA 3HMHA 5EPSA 4N4GA 5E3GA 5EPBA 4PCIA 4NYVA 5IGKA 5AMFA 5EV9A 5EGUA 1ZS5A 5FG4A 4BW2A 4NUEA 3U5OA 5TB6A 4HXOA 5HFQA 4Z6HA 4PTBA 4WHWA 4QNSA 5F36A 2YYNA 5ENCA 4TTEA 4LYIA 2RFJA 4A9FA 5G4RA 3LJWA 5JI8A 4MR3A 4IR3A 4LC2A 1N72A 5EU1A 3G0LA 3U5NA 3LQHA 5I88A 4QB3A 4PY6A 5E7DA 4TS8A 4UYGA 3NXBA 5CS8A 4OGIA 5ETBA 3FKMX 4Q0NA 4QEVA 4MEQA 5FE6A 5D3NA 5EWHA 5KTXA 5BT3A 2LSPB 3JVLA 5E3DA 4GPJA 5H85A 5A5NA 3JVKA 4TQNA 5HQ6A 5C4QA 4O76A 4TZ2A 4MEPA 5CPEA 5HJCA 4ALHA 3MULA 4IR4A 5IGMA 5HELA 4O7AA 2KTBB 3I3JA 4UIXA 5JWMA 5ETDA 3TLPA 5IIDA 5D26A 3UVWA 3IU6A 4QC3A 3U5PA 5D24A 3JVJA 4A9KA 4YBMA 5CQ7A 4UYFB 5EPRA 4XUAA 4UIVA 5FH6A 2D9EA 1WUMA 5I7YA 4HXMA 5IBNA 4YADA 3U5JA 3UV5A 4HXPA 3P5OA 4O75A 5D3HA 5BT4A 2FSAA 4YH3A 4CFLA 4FLPA 5DKDA 4UIUA 5HCLA 5ENEA 3UVXA 4YYJA 2RNWA 2RNXA 4UYEA 4XY8A 2R10A 5EA1A 5DX4A 2DKWA 2OUOA 4PKLA 5A5PA 4LZ2A 5I1QA 5KHMA 4YYKA 5H1UA 4LZSA 2WP1A 4XYAA 4NUCA 2MJVB 5TCMA 5F62A 4A9MA 4BW1A 2YELA 3S92A 5D3LA 4HBXA 2E7NA 4HXSA 4A9IA 3DAIA 5FBXA 5CQTA 3P1FA 4O70A 2I8NA 4YYMA 5EP7A 5HRWA 4YYDA 5FE0A 2YEKA 5I80A 4IR5A 3UVYA 3DWYA 5FG6A 5EISA 2DVVA 5LKXA 2F6JA 5D3SA 5LJ0A 5FE8A 4X2IA 4YC9A 4YBSA 4LR6A 4J0SA 3D7CA 5CU8A 5F1HA 5DKHA 5DKCA 5DYUA 4LZRA 5COIA 2H60A 2E7OA 4CURA 3UV4A 4O78A 5IGLA 4O72A 5CUBA 4NR7A 4YYGA 2D82A 4LYSA 4HXKA 3AQAA 5CQ8A 5E9MA 4N3WA 4Z93A 5DY7A 5D3RA 5DYXA 3S91A 5DFCA 4QBMA 4N4IA 5FE2A 4WIVA 5EM3A 4NR6A 2L5EA 5FH8A 4CFKA 3ONIA 5KU3A 5D25A 4NQNA 5ENJA 4NRCA 4YY6A 5C8GA 5F5ZA 3QZTA 5BT5A 5KTWA 1F68A 4TU6A 4YBTA 5EWDA 5H1VA 5C87A 2OO1A 4LRGA 5L8TA 2L84A 5L96A 5F60A 2OSSA 4ALGA 4WHUA 5CQ3A 5CY9A 4NS5A 5C7NA 4QSXA 5A83A 5FE9A 5DYCA 3U5LA 4IOQA 5ENIA 4Y03A 5FFWA 5IG6A 2YW5A 5E9IA 3O35A 5E9VA 4YYNA 2RO1A 4CUSA 1WUGA 2G4AA 5CGPA 5FE5A 4ZC9A 3GG3A 3O34A 4NXJA 5EWWA 4YY4A 5CQ6A 3JVMA 5E9KA 4XUBA 5CRZA 3P1CA 4ZQLA 5ENFA 4YABA 4QSRA 4QYLA 4QR5A 5L99A 5CP5A 4QC1A 5FG5A 4MR5A 4QSUA 3U5MA 4A9OA 4KV4A 4Q0OA 3LQIA 2E3KA 4PCEA 3MB3A 4XY9A 3SVFA 5KO4A 3P1DA 1EQFA 3IU5A 2R0VA 3SVGA 5LJ1A 4O7EA 4ZW1A 5DLXA 5D3TA 4QSSA 5ENBA 2WP2A 5E9YA 5HM0A 4UITA 4A9LA 5FE1A 4CUTA 5LUUA 4A9JA 3U5KA 5EI4A 5HQ7A 5E9LA 5F2PA 5A82A 5CQAA 5CQ5A 5E74A 5D3PA 4NR4A 4C67A 5CFWA 5F25A 5LVRA 5G4SA 5FFYA 4HXRA 4Z1SA 4BW3A 4TT6A 4E96A 5CUCA 5EK9A 4QSQA 2L85A 5ACYA 4UIZA 4YYHA 5FE7A 4HBVA 3O33A 5EWVA 4IR6A 4TT4A 2RS9B 4QY4A 4KV1A 4O7CA 4HXLA 5DFBA 3G0JA 3ZYUA 4J1PA 1E6IA 5A5RA 4QZSA 5CRMA 4N4HA 2DWWA 5FE3A 1JSPB 5A7CA 5AD3A 5EQ1A 5II1A 4CL9A 1JM4B 5LKTA 4O74A 4KCXA 1X0JA 4QUUA 4CUPA 4A9EA 4LDFA 5ENHA 3HMFA 2DATA 4NR5A 5EVAA 5IGNA 5HEMA 4MR4A 5F1LA 3SVHA 5AD2A 5A5SA 5DFDA 4QSVA 5ENGA 4QSWA 2GRCA 5HRVA 3Q2FA 5FFVA 2DVRA 4HBWA 5II2A 4QUTA 4UIYA 4NQMA 5CQ4A 4CUUA 4A9NA 4QR3A 4OGJA 4NR9A 4QR4A 5A81A 5LVQA 5I86A 4O7BA 4Z1QA 2R0SA 5I40A 5I83A 5HLSA 4J0RA 4AKNA 3LXJA 3RCWA 4UYHA 4YK0A 5D0CA 2DVSA 5DW1A 4MEOA 4QEUA 5FB0A 4TU4A 4TZ8A 4MENA 4BJXA 5I89A 5D3JA 2YQDA 4BW4A 5HFRA 5DW2A 3LQJA 4YYIA 2RI7A 4LYWA 4CUQA 4NRAA 3MB4A 5H1TA 3MQMA 2YDWA 5DLZA 3MUKA 5K29A 2N9GA 4UIWA 4YATA 3Q2EA 5L8UA 5CTLA 4QYDA 4F3IA 3K2JA 5HRXA 4UYFA 4C66A 5C89A 4O71A 5F63A 4QEWA 2R0YA 5EICA 5CZGA 5DYAA 4PS5A 5LKZA 5E73A 3QZSA 4IORA 5CUAA 4YAXA 4OUFA 3UVDA 2NXBA 4NR8A 5A85A 4A9HA 5L98A 5LJ2A 3P1EA 4N4FA 5FB1A 5A5OA 5LKUA 4QSPA 4NRBA 5CUDA 5FE4A 5E0RA 5L97A 5CUEA 5DBMA 4DONA 4RVRA 2I7KA 4CLBA 5F3AA
chains in the Genus database with same CATH superfamily
2DVQA 3UV2A 5F61A 3O36A 4HBYA 4J3IA 5J0DA 4TT2A 3UW9A 5I7XA 5I29A 4MR6A 5CUGA 4BHWA 5EWCA 5HQ5A 5KTUA 4UYDA 3MXFA 4IOOA 3HMEA 5C85A 4TYLA 5AMEA 5HENA 4QSTA 4YH4A 4Z6IA 5A5QA 5D7XA 3O37A 3AADA 4O7FA 5FDZA 2YEMA 4HXNA 2F6NA 2RNYA 4O77A 4NUDA 4NYWA 5FH7A 3QZVA 4NYXA 3HMHA 5EPSA 1ZKRA 4N4GA 5E3GA 5EPBA 4PCIA 4NYVA 5IGKA 5AMFA 5EV9A 5EGUA 1ZS5A 5FG4A 4BW2A 4NUEA 3U5OA 5TB6A 4HXOA 5HFQA 4Z6HA 4PTBA 4WHWA 4QNSA 5F36A 2YYNA 5ENCA 4TTEA 4LYIA 2RFJA 4A9FA 5G4RA 3LJWA 5JI8A 4MR3A 4IR3A 4LC2A 1N72A 5EU1A 3G0LA 3U5NA 3LQHA 5I88A 4QB3A 4PY6A 5E7DA 4TS8A 4UYGA 3NXBA 5CS8A 4OGIA 5ETBA 3FKMX 4Q0NA 4QEVA 4MEQA 5FE6A 5D3NA 5EWHA 5KTXA 5BT3A 2LSPB 3JVLA 5E3DA 4GPJA 5H85A 5A5NA 3JVKA 4TQNA 5HQ6A 5C4QA 4O76A 4TZ2A 4MEPA 5CPEA 5HJCA 4ALHA 3MULA 4IR4A 5IGMA 3VKGA 5HELA 4O7AA 4AKGA 2KTBB 3I3JA 4UIXA 5JWMA 5ETDA 3TLPA 5IIDA 5D26A 3UVWA 3IU6A 4QC3A 3U5PA 5D24A 3JVJA 4A9KA 4YBMA 3VKHA 5CQ7A 4UYFB 5EPRA 4XUAA 4UIVA 5FH6A 2D9EA 1WUMA 5I7YA 4HXMA 5IBNA 4YADA 3U5JA 3UV5A 4HXPA 3P5OA 4O75A 5D3HA 5BT4A 2FSAA 4YH3A 4CFLA 4FLPA 5DKDA 4UIUA 5HCLA 5ENEA 3UVXA 4YYJA 2RNWA 2RNXA 4UYEA 4XY8A 2R10A 5EA1A 5DX4A 2DKWA 2OUOA 4PKLA 5A5PA 4LZ2A 5I1QA 5KHMA 4YYKA 5H1UA 4LZSA 2WP1A 4XYAA 4NUCA 2MJVB 5TCMA 5F62A 4A9MA 4BW1A 2YELA 3S92A 5D3LA 4HBXA 2E7NA 4HXSA 4AKHA 4A9IA 3DAIA 5FBXA 5CQTA 3P1FA 4O70A 2I8NA 4YYMA 5EP7A 5HRWA 4YYDA 5FE0A 2YEKA 5I80A 4IR5A 3UVYA 3DWYA 5FG6A 5EISA 2DVVA 5LKXA 2F6JA 5D3SA 4AI6A 5LJ0A 5FE8A 4X2IA 4YC9A 4YBSA 4LR6A 4J0SA 3D7CA 5CU8A 5F1HA 5DKHA 5DKCA 5DYUA 4LZRA 5COIA 2H60A 2E7OA 4CURA 3UV4A 4O78A 5IGLA 4O72A 5CUBA 4NR7A 4YYGA 2D82A 4LYSA 4HXKA 3AQAA 5CQ8A 5E9MA 4N3WA 4Z93A 5DY7A 5D3RA 5DYXA 3S91A 5DFCA 4QBMA 4N4IA 5FE2A 4WIVA 5EM3A 4NR6A 2L5EA 5FH8A 4CFKA 3ONIA 5KU3A 5D25A 4NQNA 5ENJA 4NRCA 4YY6A 5C8GA 5F5ZA 3QZTA 5BT5A 5KTWA 1F68A 4TU6A 1PUOA 4YBTA 5EWDA 5H1VA 5C87A 2OO1A 4LRGA 5L8TA 2L84A 5L96A 5F60A 3D1BA 2OSSA 4ALGA 4WHUA 5CQ3A 5CY9A 4NS5A 5C7NA 3D1DA 4QSXA 5A83A 5FE9A 5DYCA 3U5LA 4IOQA 5ENIA 4Y03A 5FFWA 5IG6A 2YW5A 5E9IA 3O35A 5E9VA 4YYNA 2RO1A 4CUSA 1WUGA 2G4AA 5CGPA 5FE5A 4ZC9A 3GG3A 3O34A 4NXJA 5EWWA 4YY4A 5CQ6A 3JVMA 5E9KA 4XUBA 5CRZA 3P1CA 4ZQLA 5ENFA 4YABA 4QSRA 4QYLA 4QR5A 5L99A 5CP5A 4QC1A 5FG5A 4MR5A 4QSUA 3U5MA 4A9OA 4KV4A 4Q0OA 3LQIA 2E3KA 4PCEA 3MB3A 4XY9A 3SVFA 5KO4A 3P1DA 1EQFA 2R0VA 3IU5A 3SVGA 5LJ1A 4O7EA 4ZW1A 5DLXA 5D3TA 4QSSA 5ENBA 2WP2A 5E9YA 5HM0A 4UITA 4A9LA 5FE1A 4CUTA 5LUUA 4A9JA 3U5KA 5EI4A 5HQ7A 5E9LA 5F2PA 5A82A 5CQAA 5CQ5A 5E74A 5D3PA 4NR4A 4C67A 5CFWA 5F25A 5LVRA 5G4SA 5FFYA 4HXRA 4Z1SA 4BW3A 4TT6A 4E96A 5CUCA 5EK9A 4QSQA 2L85A 5ACYA 4UIZA 4YYHA 5FE7A 4HBVA 3O33A 5EWVA 4IR6A 4TT4A 2RS9B 4QY4A 4KV1A 4O7CA 4HXLA 5DFBA 3G0JA 3ZYUA 4J1PA 1E6IA 5A5RA 3ERRA 4QZSA 5CRMA 4N4HA 2DWWA 5FE3A 1JSPB 5A7CA 5AD3A 5EQ1A 5II1A 4CL9A 1JM4B 5LKTA 4O74A 4KCXA 1X0JA 4QUUA 4CUPA 4A9EA 4LDFA 5ENHA 3HMFA 2DATA 4NR5A 5EVAA 5IGNA 5HEMA 4MR4A 5F1LA 3SVHA 5AD2A 5A5SA 5DFDA 4QSVA 5ENGA 4QSWA 2GRCA 5HRVA 3Q2FA 5FFVA 2DVRA 4HBWA 5II2A 4QUTA 4UIYA 4NQMA 5CQ4A 4CUUA 4A9NA 4QR3A 4OGJA 4NR9A 4QR4A 5A81A 5LVQA 5I86A 4O7BA 4Z1QA 2R0SA 5I40A 5I83A 5HLSA 4J0RA 4AKNA 3LXJA 3RCWA 4UYHA 4YK0A 5D0CA 4AKIA 2DVSA 5DW1A 4MEOA 4QEUA 5FB0A 4TU4A 4TZ8A 4MENA 4BJXA 5I89A 5D3JA 2YQDA 4BW4A 5HFRA 5DW2A 3LQJA 4YYIA 2RI7A 4LYWA 4CUQA 4NRAA 3MB4A 5H1TA 3MQMA 2EJNA 2YDWA 5DLZA 3MUKA 5K29A 2N9GA 4UIWA 4YATA 3Q2EA 5L8UA 5CTLA 4QYDA 4F3IA 3K2JA 5HRXA 4UYFA 4C66A 5C89A 4O71A 5F63A 4QEWA 2R0YA 5EICA 5CZGA 5DYAA 4PS5A 5LKZA 5E73A 3QZSA 4IORA 5CUAA 4YAXA 4OUFA 3UVDA 2NXBA 4NR8A 5A85A 4A9HA 5L98A 5LJ2A 3P1EA 4N4FA 5FB1A 5A5OA 5LKUA 4QSPA 4NRBA 5CUDA 5FE4A 5E0RA 5L97A 5CUEA 5DBMA 4DONA 4RVRA 2I7KA 4CLBA 5F3AA
chains in the Genus database with same CATH topology
2DVQA 3UV2A 5F61A 3O36A 4HBYA 4J3IA 5J0DA 4TT2A 3UW9A 5I7XA 5I29A 4MR6A 5CUGA 4BHWA 5EWCA 5HQ5A 5KTUA 4UYDA 3MXFA 4IOOA 3HMEA 5C85A 4TYLA 5AMEA 5HENA 4QSTA 4YH4A 4Z6IA 5A5QA 5D7XA 3O37A 3AADA 4O7FA 5FDZA 2YEMA 4HXNA 2F6NA 2RNYA 4O77A 4NUDA 4NYWA 5FH7A 3QZVA 4NYXA 3HMHA 5EPSA 4N4GA 5E3GA 5EPBA 4PCIA 4NYVA 5IGKA 5AMFA 5EV9A 5EGUA 1ZS5A 5FG4A 4BW2A 4NUEA 3U5OA 5TB6A 4HXOA 5HFQA 4Z6HA 4PTBA 4WHWA 4QNSA 5F36A 2YYNA 5ENCA 4TTEA 4LYIA 2RFJA 4A9FA 5G4RA 3LJWA 5JI8A 4MR3A 4IR3A 4LC2A 1N72A 5EU1A 3G0LA 3U5NA 3LQHA 5I88A 4QB3A 4PY6A 5E7DA 4TS8A 4UYGA 3NXBA 5CS8A 4OGIA 5ETBA 3FKMX 4Q0NA 4QEVA 4MEQA 5FE6A 5D3NA 5EWHA 5KTXA 5BT3A 2LSPB 3JVLA 5E3DA 4GPJA 5H85A 5A5NA 3JVKA 4TQNA 5HQ6A 5C4QA 4O76A 4TZ2A 4MEPA 5CPEA 5HJCA 4ALHA 3MULA 4IR4A 5IGMA 5HELA 4O7AA 2KTBB 3I3JA 4UIXA 5JWMA 5ETDA 3TLPA 5IIDA 5D26A 3UVWA 3IU6A 4QC3A 3U5PA 5D24A 3JVJA 4A9KA 4YBMA 5CQ7A 4UYFB 5EPRA 4XUAA 4UIVA 5FH6A 2D9EA 1WUMA 5I7YA 4HXMA 5IBNA 4YADA 3U5JA 3UV5A 4HXPA 3P5OA 4O75A 5D3HA 5BT4A 2FSAA 4YH3A 4CFLA 4FLPA 5DKDA 4UIUA 5HCLA 5ENEA 3UVXA 4YYJA 2RNWA 2RNXA 4UYEA 4XY8A 2R10A 5EA1A 5DX4A 2DKWA 2OUOA 4PKLA 5A5PA 4LZ2A 5I1QA 5KHMA 4YYKA 5H1UA 4LZSA 2WP1A 4XYAA 4NUCA 2MJVB 5TCMA 5F62A 4A9MA 4BW1A 2YELA 3S92A 5D3LA 4HBXA 2E7NA 4HXSA 4A9IA 3DAIA 5FBXA 5CQTA 3P1FA 4O70A 2I8NA 4YYMA 5EP7A 5HRWA 4YYDA 5FE0A 2YEKA 5I80A 4IR5A 3UVYA 3DWYA 5FG6A 5EISA 2DVVA 5LKXA 2F6JA 5D3SA 5LJ0A 5FE8A 4X2IA 4YC9A 4YBSA 4LR6A 4J0SA 3D7CA 5CU8A 5F1HA 5DKHA 5DKCA 5DYUA 4LZRA 5COIA 2H60A 2E7OA 4CURA 3UV4A 4O78A 5IGLA 4O72A 5CUBA 4NR7A 4YYGA 2D82A 4LYSA 4HXKA 3AQAA 5CQ8A 5E9MA 4N3WA 4Z93A 5DY7A 5D3RA 5DYXA 3S91A 5DFCA 4QBMA 4N4IA 5FE2A 4WIVA 5EM3A 4NR6A 2L5EA 5FH8A 4CFKA 3ONIA 5KU3A 5D25A 4NQNA 5ENJA 4NRCA 4YY6A 5C8GA 5F5ZA 3QZTA 5BT5A 5KTWA 1F68A 4TU6A 4YBTA 5EWDA 5H1VA 5C87A 2OO1A 4LRGA 5L8TA 2L84A 5L96A 5F60A 2OSSA 4ALGA 4WHUA 5CQ3A 5CY9A 4NS5A 5C7NA 4QSXA 5A83A 5FE9A 5DYCA 3U5LA 4IOQA 5ENIA 4Y03A 5FFWA 5IG6A 2YW5A 5E9IA 3O35A 5E9VA 4YYNA 2RO1A 4CUSA 1WUGA 2G4AA 5CGPA 5FE5A 4ZC9A 3GG3A 3O34A 4NXJA 5EWWA 4YY4A 5CQ6A 3JVMA 5E9KA 4XUBA 5CRZA 3P1CA 4ZQLA 5ENFA 4YABA 4QSRA 4QYLA 4QR5A 5L99A 5CP5A 4QC1A 5FG5A 4MR5A 4QSUA 3U5MA 4A9OA 4KV4A 4Q0OA 3LQIA 2E3KA 4PCEA 3MB3A 4XY9A 3SVFA 5KO4A 3P1DA 1EQFA 3IU5A 2R0VA 3SVGA 5LJ1A 4O7EA 4ZW1A 5DLXA 5D3TA 4QSSA 5ENBA 2WP2A 5E9YA 5HM0A 4UITA 4A9LA 5FE1A 4CUTA 5LUUA 4A9JA 3U5KA 5EI4A 5HQ7A 5E9LA 5F2PA 5A82A 5CQAA 5CQ5A 5E74A 5D3PA 4NR4A 4C67A 5CFWA 5F25A 5LVRA 5G4SA 5FFYA 4HXRA 4Z1SA 4BW3A 4TT6A 4E96A 5CUCA 5EK9A 4QSQA 2L85A 5ACYA 4UIZA 4YYHA 5FE7A 4HBVA 3O33A 5EWVA 4IR6A 4TT4A 2RS9B 4QY4A 4KV1A 4O7CA 4HXLA 5DFBA 3G0JA 3ZYUA 4J1PA 1E6IA 5A5RA 4QZSA 5CRMA 4N4HA 2DWWA 5FE3A 1JSPB 5A7CA 5AD3A 5EQ1A 5II1A 4CL9A 1JM4B 5LKTA 4O74A 4KCXA 1X0JA 4QUUA 4CUPA 4A9EA 4LDFA 5ENHA 3HMFA 2DATA 4NR5A 5EVAA 5IGNA 5HEMA 4MR4A 5F1LA 3SVHA 5AD2A 5A5SA 5DFDA 4QSVA 5ENGA 4QSWA 2GRCA 5HRVA 3Q2FA 5FFVA 2DVRA 4HBWA 5II2A 4QUTA 4UIYA 4NQMA 5CQ4A 4CUUA 4A9NA 4QR3A 4OGJA 4NR9A 4QR4A 5A81A 5LVQA 5I86A 4O7BA 4Z1QA 2R0SA 5I40A 5I83A 5HLSA 4J0RA 4AKNA 3LXJA 3RCWA 4UYHA 4YK0A 5D0CA 2DVSA 5DW1A 4MEOA 4QEUA 5FB0A 4TU4A 4TZ8A 4MENA 4BJXA 5I89A 5D3JA 2YQDA 4BW4A 5HFRA 5DW2A 3LQJA 4YYIA 2RI7A 4LYWA 4CUQA 4NRAA 3MB4A 5H1TA 3MQMA 2YDWA 5DLZA 3MUKA 5K29A 2N9GA 4UIWA 4YATA 3Q2EA 5L8UA 5CTLA 4QYDA 4F3IA 3K2JA 5HRXA 4UYFA 4C66A 5C89A 4O71A 5F63A 4QEWA 2R0YA 5EICA 5CZGA 5DYAA 4PS5A 5LKZA 5E73A 3QZSA 4IORA 5CUAA 4YAXA 4OUFA 3UVDA 2NXBA 4NR8A 5A85A 4A9HA 5L98A 5LJ2A 3P1EA 4N4FA 5FB1A 5A5OA 5LKUA 4QSPA 4NRBA 5CUDA 5FE4A 5E0RA 5L97A 5CUEA 5DBMA 4DONA 4RVRA 2I7KA 4CLBA 5F3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVQ A;  3UV2 A;  5F61 A;  3O36 A;  4HBY A;  4J3I A;  5J0D A;  4TT2 A;  3UW9 A;  5I7X A;  5I29 A;  4MR6 A;  5CUG A;  4BHW A;  5EWC A;  5HQ5 A;  5KTU A;  4UYD A;  3MXF A;  4IOO A;  3HME A;  5C85 A;  4TYL A;  5AME A;  5HEN A;  4QST A;  4YH4 A;  4Z6I A;  5A5Q A;  5D7X A;  3O37 A;  3AAD A;  4O7F A;  5FDZ A;  2YEM A;  4HXN A;  2F6N A;  2RNY A;  4O77 A;  4NUD A;  4NYW A;  5FH7 A;  3QZV A;  4NYX A;  3HMH A;  5EPS A;  4N4G A;  5E3G A;  5EPB A;  4PCI A;  4NYV A;  5IGK A;  5AMF A;  5EV9 A;  5EGU A;  1ZS5 A;  5FG4 A;  4BW2 A;  4NUE A;  3U5O A;  5TB6 A;  4HXO A;  5HFQ A;  4Z6H A;  4PTB A;  4WHW A;  4QNS A;  5F36 A;  2YYN A;  5ENC A;  4TTE A;  4LYI A;  2RFJ A;  4A9F A;  5G4R A;  3LJW A;  5JI8 A;  4MR3 A;  4IR3 A;  4LC2 A;  1N72 A;  5EU1 A;  3G0L A;  3U5N A;  3LQH A;  5I88 A;  4QB3 A;  4PY6 A;  5E7D A;  4TS8 A;  4UYG A;  3NXB A;  5CS8 A;  4OGI A;  5ETB A;  3FKM X;  4Q0N A;  4QEV A;  4MEQ A;  5FE6 A;  5D3N A;  5EWH A;  5KTX A;  5BT3 A;  2LSP B;  3JVL A;  5E3D A;  4GPJ A;  5H85 A;  5A5N A;  3JVK A;  4TQN A;  5HQ6 A;  5C4Q A;  4O76 A;  4TZ2 A;  4MEP A;  5CPE A;  5HJC A;  4ALH A;  3MUL A;  4IR4 A;  5IGM A;  5HEL A;  4O7A A;  2KTB B;  3I3J A;  4UIX A;  5JWM A;  5ETD A;  3TLP A;  5IID A;  5D26 A;  3UVW A;  3IU6 A;  4QC3 A;  3U5P A;  5D24 A;  3JVJ A;  4A9K A;  4YBM A;  5CQ7 A;  4UYF B;  5EPR A;  4XUA A;  4UIV A;  5FH6 A;  2D9E A;  1WUM A;  5I7Y A;  4HXM A;  5IBN A;  4YAD A;  3U5J A;  3UV5 A;  4HXP A;  3P5O A;  4O75 A;  5D3H A;  5BT4 A;  2FSA A;  4YH3 A;  4CFL A;  4FLP A;  5DKD A;  4UIU A;  5HCL A;  5ENE A;  3UVX A;  4YYJ A;  2RNW A;  2RNX A;  4UYE A;  4XY8 A;  2R10 A;  5EA1 A;  5DX4 A;  2DKW A;  2OUO A;  4PKL A;  5A5P A;  4LZ2 A;  5I1Q A;  5KHM A;  4YYK A;  5H1U A;  4LZS A;  2WP1 A;  4XYA A;  4NUC A;  2MJV B;  5TCM A;  5F62 A;  4A9M A;  4BW1 A;  2YEL A;  3S92 A;  5D3L A;  4HBX A;  2E7N A;  4HXS A;  4A9I A;  3DAI A;  5FBX A;  5CQT A;  3P1F A;  4O70 A;  2I8N A;  4YYM A;  5EP7 A;  5HRW A;  4YYD A;  5FE0 A;  2YEK A;  5I80 A;  4IR5 A;  3UVY A;  3DWY A;  5FG6 A;  5EIS A;  2DVV A;  5LKX A;  2F6J A;  5D3S A;  5LJ0 A;  5FE8 A;  4X2I A;  4YC9 A;  4YBS A;  4LR6 A;  4J0S A;  3D7C A;  5CU8 A;  5F1H A;  5DKH A;  5DKC A;  5DYU A;  4LZR A;  5COI A;  2H60 A;  2E7O A;  4CUR A;  3UV4 A;  4O78 A;  5IGL A;  4O72 A;  5CUB A;  4NR7 A;  4YYG A;  2D82 A;  4LYS A;  4HXK A;  3AQA A;  5CQ8 A;  5E9M A;  4N3W A;  4Z93 A;  5DY7 A;  5D3R A;  5DYX A;  3S91 A;  5DFC A;  4QBM A;  4N4I A;  5FE2 A;  4WIV A;  5EM3 A;  4NR6 A;  2L5E A;  5FH8 A;  4CFK A;  3ONI A;  5KU3 A;  5D25 A;  4NQN A;  5ENJ A;  4NRC A;  4YY6 A;  5C8G A;  5F5Z A;  3QZT A;  5BT5 A;  5KTW A;  1F68 A;  4TU6 A;  4YBT A;  5EWD A;  5H1V A;  5C87 A;  2OO1 A;  4LRG A;  5L8T A;  2L84 A;  5L96 A;  5F60 A;  2OSS A;  4ALG A;  4WHU A;  5CQ3 A;  5CY9 A;  4NS5 A;  5C7N A;  4QSX A;  5A83 A;  5FE9 A;  5DYC A;  3U5L A;  4IOQ A;  5ENI A;  4Y03 A;  5FFW A;  5IG6 A;  2YW5 A;  5E9I A;  3O35 A;  5E9V A;  4YYN A;  2RO1 A;  4CUS A;  1WUG A;  2G4A A;  5CGP A;  5FE5 A;  4ZC9 A;  3GG3 A;  3O34 A;  4NXJ A;  5EWW A;  4YY4 A;  5CQ6 A;  3JVM A;  5E9K A;  4XUB A;  5CRZ A;  3P1C A;  4ZQL A;  5ENF A;  4YAB A;  4QSR A;  4QYL A;  4QR5 A;  5L99 A;  5CP5 A;  4QC1 A;  5FG5 A;  4MR5 A;  4QSU A;  3U5M A;  4A9O A;  4KV4 A;  4Q0O A;  3LQI A;  2E3K A;  4PCE A;  3MB3 A;  4XY9 A;  3SVF A;  5KO4 A;  3P1D A;  1EQF A;  3IU5 A;  2R0V A;  3SVG A;  5LJ1 A;  4O7E A;  4ZW1 A;  5DLX A;  5D3T A;  4QSS A;  5ENB A;  2WP2 A;  5E9Y A;  5HM0 A;  4UIT A;  4A9L A;  5FE1 A;  4CUT A;  5LUU A;  4A9J A;  3U5K A;  5EI4 A;  5HQ7 A;  5E9L A;  5F2P A;  5A82 A;  5CQA A;  5CQ5 A;  5E74 A;  5D3P A;  4NR4 A;  4C67 A;  5CFW A;  5F25 A;  5LVR A;  5G4S A;  5FFY A;  4HXR A;  4Z1S A;  4BW3 A;  4TT6 A;  4E96 A;  5CUC A;  5EK9 A;  4QSQ A;  2L85 A;  5ACY A;  4UIZ A;  4YYH A;  5FE7 A;  4HBV A;  3O33 A;  5EWV A;  4IR6 A;  4TT4 A;  2RS9 B;  4QY4 A;  4KV1 A;  4O7C A;  4HXL A;  5DFB A;  3G0J A;  3ZYU A;  4J1P A;  1E6I A;  5A5R A;  4QZS A;  5CRM A;  4N4H A;  2DWW A;  5FE3 A;  1JSP B;  5A7C A;  5AD3 A;  5EQ1 A;  5II1 A;  4CL9 A;  1JM4 B;  5LKT A;  4O74 A;  4KCX A;  1X0J A;  4QUU A;  4CUP A;  4A9E A;  4LDF A;  5ENH A;  3HMF A;  2DAT A;  4NR5 A;  5EVA A;  5IGN A;  5HEM A;  4MR4 A;  5F1L A;  3SVH A;  5AD2 A;  5A5S A;  5DFD A;  4QSV A;  5ENG A;  4QSW A;  2GRC A;  5HRV A;  3Q2F A;  5FFV A;  2DVR A;  4HBW A;  5II2 A;  4QUT A;  4UIY A;  4NQM A;  5CQ4 A;  4CUU A;  4A9N A;  4QR3 A;  4OGJ A;  4NR9 A;  4QR4 A;  5A81 A;  5LVQ A;  5I86 A;  4O7B A;  4Z1Q A;  2R0S A;  5I40 A;  5I83 A;  5HLS A;  4J0R A;  4AKN A;  3LXJ A;  3RCW A;  4UYH A;  4YK0 A;  5D0C A;  2DVS A;  5DW1 A;  4MEO A;  4QEU A;  5FB0 A;  4TU4 A;  4TZ8 A;  4MEN A;  4BJX A;  5I89 A;  5D3J A;  2YQD A;  4BW4 A;  5HFR A;  5DW2 A;  3LQJ A;  4YYI A;  2RI7 A;  4LYW A;  4CUQ A;  4NRA A;  3MB4 A;  5H1T A;  3MQM A;  2YDW A;  5DLZ A;  3MUK A;  5K29 A;  2N9G A;  4UIW A;  4YAT A;  3Q2E A;  5L8U A;  5CTL A;  4QYD A;  4F3I A;  3K2J A;  5HRX A;  4UYF A;  4C66 A;  5C89 A;  4O71 A;  5F63 A;  4QEW A;  2R0Y A;  5EIC A;  5CZG A;  5DYA A;  4PS5 A;  5LKZ A;  5E73 A;  3QZS A;  4IOR A;  5CUA A;  4YAX A;  4OUF A;  3UVD A;  2NXB A;  4NR8 A;  5A85 A;  4A9H A;  5L98 A;  5LJ2 A;  3P1E A;  4N4F A;  5FB1 A;  5A5O A;  5LKU A;  4QSP A;  4NRB A;  5CUD A;  5FE4 A;  5E0R A;  5L97 A;  5CUE A;  5DBM A;  4DON A;  4RVR A;  2I7K A;  4CLB A;  5F3A A; 
#chains in the Genus database with same CATH topology
 2DVQ A;  3UV2 A;  5F61 A;  3O36 A;  4HBY A;  4J3I A;  5J0D A;  4TT2 A;  3UW9 A;  5I7X A;  5I29 A;  4MR6 A;  5CUG A;  4BHW A;  5EWC A;  5HQ5 A;  5KTU A;  4UYD A;  3MXF A;  4IOO A;  3HME A;  5C85 A;  4TYL A;  5AME A;  5HEN A;  4QST A;  4YH4 A;  4Z6I A;  5A5Q A;  5D7X A;  3O37 A;  3AAD A;  4O7F A;  5FDZ A;  2YEM A;  4HXN A;  2F6N A;  2RNY A;  4O77 A;  4NUD A;  4NYW A;  5FH7 A;  3QZV A;  4NYX A;  3HMH A;  5EPS A;  1ZKR A;  4N4G A;  5E3G A;  5EPB A;  4PCI A;  4NYV A;  5IGK A;  5AMF A;  5EV9 A;  5EGU A;  1ZS5 A;  5FG4 A;  4BW2 A;  4NUE A;  3U5O A;  5TB6 A;  4HXO A;  5HFQ A;  4Z6H A;  4PTB A;  4WHW A;  4QNS A;  5F36 A;  2YYN A;  5ENC A;  4TTE A;  4LYI A;  2RFJ A;  4A9F A;  5G4R A;  3LJW A;  5JI8 A;  4MR3 A;  4IR3 A;  4LC2 A;  1N72 A;  5EU1 A;  3G0L A;  3U5N A;  3LQH A;  5I88 A;  4QB3 A;  4PY6 A;  5E7D A;  4TS8 A;  4UYG A;  3NXB A;  5CS8 A;  4OGI A;  5ETB A;  3FKM X;  4Q0N A;  4QEV A;  4MEQ A;  5FE6 A;  5D3N A;  5EWH A;  5KTX A;  5BT3 A;  2LSP B;  3JVL A;  5E3D A;  4GPJ A;  5H85 A;  5A5N A;  3JVK A;  4TQN A;  5HQ6 A;  5C4Q A;  4O76 A;  4TZ2 A;  4MEP A;  5CPE A;  5HJC A;  4ALH A;  3MUL A;  4IR4 A;  5IGM A;  3VKG A;  5HEL A;  4O7A A;  4AKG A;  2KTB B;  3I3J A;  4UIX A;  5JWM A;  5ETD A;  3TLP A;  5IID A;  5D26 A;  3UVW A;  3IU6 A;  4QC3 A;  3U5P A;  5D24 A;  3JVJ A;  4A9K A;  4YBM A;  3VKH A;  5CQ7 A;  4UYF B;  5EPR A;  4XUA A;  4UIV A;  5FH6 A;  2D9E A;  1WUM A;  5I7Y A;  4HXM A;  5IBN A;  4YAD A;  3U5J A;  3UV5 A;  4HXP A;  3P5O A;  4O75 A;  5D3H A;  5BT4 A;  2FSA A;  4YH3 A;  4CFL A;  4FLP A;  5DKD A;  4UIU A;  5HCL A;  5ENE A;  3UVX A;  4YYJ A;  2RNW A;  2RNX A;  4UYE A;  4XY8 A;  2R10 A;  5EA1 A;  5DX4 A;  2DKW A;  2OUO A;  4PKL A;  5A5P A;  4LZ2 A;  5I1Q A;  5KHM A;  4YYK A;  5H1U A;  4LZS A;  2WP1 A;  4XYA A;  4NUC A;  2MJV B;  5TCM A;  5F62 A;  4A9M A;  4BW1 A;  2YEL A;  3S92 A;  5D3L A;  4HBX A;  2E7N A;  4HXS A;  4AKH A;  4A9I A;  3DAI A;  5FBX A;  5CQT A;  3P1F A;  4O70 A;  2I8N A;  4YYM A;  5EP7 A;  5HRW A;  4YYD A;  5FE0 A;  2YEK A;  5I80 A;  4IR5 A;  3UVY A;  3DWY A;  5FG6 A;  5EIS A;  2DVV A;  5LKX A;  2F6J A;  5D3S A;  4AI6 A;  5LJ0 A;  5FE8 A;  4X2I A;  4YC9 A;  4YBS A;  4LR6 A;  4J0S A;  3D7C A;  5CU8 A;  5F1H A;  5DKH A;  5DKC A;  5DYU A;  4LZR A;  5COI A;  2H60 A;  2E7O A;  4CUR A;  3UV4 A;  4O78 A;  5IGL A;  4O72 A;  5CUB A;  4NR7 A;  4YYG A;  2D82 A;  4LYS A;  4HXK A;  3AQA A;  5CQ8 A;  5E9M A;  4N3W A;  4Z93 A;  5DY7 A;  5D3R A;  5DYX A;  3S91 A;  5DFC A;  4QBM A;  4N4I A;  5FE2 A;  4WIV A;  5EM3 A;  4NR6 A;  2L5E A;  5FH8 A;  4CFK A;  3ONI A;  5KU3 A;  5D25 A;  4NQN A;  5ENJ A;  4NRC A;  4YY6 A;  5C8G A;  5F5Z A;  3QZT A;  5BT5 A;  5KTW A;  1F68 A;  4TU6 A;  1PUO A;  4YBT A;  5EWD A;  5H1V A;  5C87 A;  2OO1 A;  4LRG A;  5L8T A;  2L84 A;  5L96 A;  5F60 A;  3D1B A;  2OSS A;  4ALG A;  4WHU A;  5CQ3 A;  5CY9 A;  4NS5 A;  5C7N A;  3D1D A;  4QSX A;  5A83 A;  5FE9 A;  5DYC A;  3U5L A;  4IOQ A;  5ENI A;  4Y03 A;  5FFW A;  5IG6 A;  2YW5 A;  5E9I A;  3O35 A;  5E9V A;  4YYN A;  2RO1 A;  4CUS A;  1WUG A;  2G4A A;  5CGP A;  5FE5 A;  4ZC9 A;  3GG3 A;  3O34 A;  4NXJ A;  5EWW A;  4YY4 A;  5CQ6 A;  3JVM A;  5E9K A;  4XUB A;  5CRZ A;  3P1C A;  4ZQL A;  5ENF A;  4YAB A;  4QSR A;  4QYL A;  4QR5 A;  5L99 A;  5CP5 A;  4QC1 A;  5FG5 A;  4MR5 A;  4QSU A;  3U5M A;  4A9O A;  4KV4 A;  4Q0O A;  3LQI A;  2E3K A;  4PCE A;  3MB3 A;  4XY9 A;  3SVF A;  5KO4 A;  3P1D A;  1EQF A;  2R0V A;  3IU5 A;  3SVG A;  5LJ1 A;  4O7E A;  4ZW1 A;  5DLX A;  5D3T A;  4QSS A;  5ENB A;  2WP2 A;  5E9Y A;  5HM0 A;  4UIT A;  4A9L A;  5FE1 A;  4CUT A;  5LUU A;  4A9J A;  3U5K A;  5EI4 A;  5HQ7 A;  5E9L A;  5F2P A;  5A82 A;  5CQA A;  5CQ5 A;  5E74 A;  5D3P A;  4NR4 A;  4C67 A;  5CFW A;  5F25 A;  5LVR A;  5G4S A;  5FFY A;  4HXR A;  4Z1S A;  4BW3 A;  4TT6 A;  4E96 A;  5CUC A;  5EK9 A;  4QSQ A;  2L85 A;  5ACY A;  4UIZ A;  4YYH A;  5FE7 A;  4HBV A;  3O33 A;  5EWV A;  4IR6 A;  4TT4 A;  2RS9 B;  4QY4 A;  4KV1 A;  4O7C A;  4HXL A;  5DFB A;  3G0J A;  3ZYU A;  4J1P A;  1E6I A;  5A5R A;  3ERR A;  4QZS A;  5CRM A;  4N4H A;  2DWW A;  5FE3 A;  1JSP B;  5A7C A;  5AD3 A;  5EQ1 A;  5II1 A;  4CL9 A;  1JM4 B;  5LKT A;  4O74 A;  4KCX A;  1X0J A;  4QUU A;  4CUP A;  4A9E A;  4LDF A;  5ENH A;  3HMF A;  2DAT A;  4NR5 A;  5EVA A;  5IGN A;  5HEM A;  4MR4 A;  5F1L A;  3SVH A;  5AD2 A;  5A5S A;  5DFD A;  4QSV A;  5ENG A;  4QSW A;  2GRC A;  5HRV A;  3Q2F A;  5FFV A;  2DVR A;  4HBW A;  5II2 A;  4QUT A;  4UIY A;  4NQM A;  5CQ4 A;  4CUU A;  4A9N A;  4QR3 A;  4OGJ A;  4NR9 A;  4QR4 A;  5A81 A;  5LVQ A;  5I86 A;  4O7B A;  4Z1Q A;  2R0S A;  5I40 A;  5I83 A;  5HLS A;  4J0R A;  4AKN A;  3LXJ A;  3RCW A;  4UYH A;  4YK0 A;  5D0C A;  4AKI A;  2DVS A;  5DW1 A;  4MEO A;  4QEU A;  5FB0 A;  4TU4 A;  4TZ8 A;  4MEN A;  4BJX A;  5I89 A;  5D3J A;  2YQD A;  4BW4 A;  5HFR A;  5DW2 A;  3LQJ A;  4YYI A;  2RI7 A;  4LYW A;  4CUQ A;  4NRA A;  3MB4 A;  5H1T A;  3MQM A;  2EJN A;  2YDW A;  5DLZ A;  3MUK A;  5K29 A;  2N9G A;  4UIW A;  4YAT A;  3Q2E A;  5L8U A;  5CTL A;  4QYD A;  4F3I A;  3K2J A;  5HRX A;  4UYF A;  4C66 A;  5C89 A;  4O71 A;  5F63 A;  4QEW A;  2R0Y A;  5EIC A;  5CZG A;  5DYA A;  4PS5 A;  5LKZ A;  5E73 A;  3QZS A;  4IOR A;  5CUA A;  4YAX A;  4OUF A;  3UVD A;  2NXB A;  4NR8 A;  5A85 A;  4A9H A;  5L98 A;  5LJ2 A;  3P1E A;  4N4F A;  5FB1 A;  5A5O A;  5LKU A;  4QSP A;  4NRB A;  5CUD A;  5FE4 A;  5E0R A;  5L97 A;  5CUE A;  5DBM A;  4DON A;  4RVR A;  2I7K A;  4CLB A;  5F3A A; 
#chains in the Genus database with same CATH homology
 2DVQ A;  3UV2 A;  5F61 A;  3O36 A;  4HBY A;  4J3I A;  5J0D A;  4TT2 A;  3UW9 A;  5I7X A;  5I29 A;  4MR6 A;  5CUG A;  4BHW A;  5EWC A;  5HQ5 A;  5KTU A;  4UYD A;  3MXF A;  4IOO A;  3HME A;  5C85 A;  4TYL A;  5AME A;  5HEN A;  4QST A;  4YH4 A;  4Z6I A;  5A5Q A;  5D7X A;  3O37 A;  3AAD A;  4O7F A;  5FDZ A;  2YEM A;  4HXN A;  2F6N A;  2RNY A;  4O77 A;  4NUD A;  4NYW A;  5FH7 A;  3QZV A;  4NYX A;  3HMH A;  5EPS A;  4N4G A;  5E3G A;  5EPB A;  4PCI A;  4NYV A;  5IGK A;  5AMF A;  5EV9 A;  5EGU A;  1ZS5 A;  5FG4 A;  4BW2 A;  4NUE A;  3U5O A;  5TB6 A;  4HXO A;  5HFQ A;  4Z6H A;  4PTB A;  4WHW A;  4QNS A;  5F36 A;  2YYN A;  5ENC A;  4TTE A;  4LYI A;  2RFJ A;  4A9F A;  5G4R A;  3LJW A;  5JI8 A;  4MR3 A;  4IR3 A;  4LC2 A;  1N72 A;  5EU1 A;  3G0L A;  3U5N A;  3LQH A;  5I88 A;  4QB3 A;  4PY6 A;  5E7D A;  4TS8 A;  4UYG A;  3NXB A;  5CS8 A;  4OGI A;  5ETB A;  3FKM X;  4Q0N A;  4QEV A;  4MEQ A;  5FE6 A;  5D3N A;  5EWH A;  5KTX A;  5BT3 A;  2LSP B;  3JVL A;  5E3D A;  4GPJ A;  5H85 A;  5A5N A;  3JVK A;  4TQN A;  5HQ6 A;  5C4Q A;  4O76 A;  4TZ2 A;  4MEP A;  5CPE A;  5HJC A;  4ALH A;  3MUL A;  4IR4 A;  5IGM A;  5HEL A;  4O7A A;  2KTB B;  3I3J A;  4UIX A;  5JWM A;  5ETD A;  3TLP A;  5IID A;  5D26 A;  3UVW A;  3IU6 A;  4QC3 A;  3U5P A;  5D24 A;  3JVJ A;  4A9K A;  4YBM A;  5CQ7 A;  4UYF B;  5EPR A;  4XUA A;  4UIV A;  5FH6 A;  2D9E A;  1WUM A;  5I7Y A;  4HXM A;  5IBN A;  4YAD A;  3U5J A;  3UV5 A;  4HXP A;  3P5O A;  4O75 A;  5D3H A;  5BT4 A;  2FSA A;  4YH3 A;  4CFL A;  4FLP A;  5DKD A;  4UIU A;  5HCL A;  5ENE A;  3UVX A;  4YYJ A;  2RNW A;  2RNX A;  4UYE A;  4XY8 A;  2R10 A;  5EA1 A;  5DX4 A;  2DKW A;  2OUO A;  4PKL A;  5A5P A;  4LZ2 A;  5I1Q A;  5KHM A;  4YYK A;  5H1U A;  4LZS A;  2WP1 A;  4XYA A;  4NUC A;  2MJV B;  5TCM A;  5F62 A;  4A9M A;  4BW1 A;  2YEL A;  3S92 A;  5D3L A;  4HBX A;  2E7N A;  4HXS A;  4A9I A;  3DAI A;  5FBX A;  5CQT A;  3P1F A;  4O70 A;  2I8N A;  4YYM A;  5EP7 A;  5HRW A;  4YYD A;  5FE0 A;  2YEK A;  5I80 A;  4IR5 A;  3UVY A;  3DWY A;  5FG6 A;  5EIS A;  2DVV A;  5LKX A;  2F6J A;  5D3S A;  5LJ0 A;  5FE8 A;  4X2I A;  4YC9 A;  4YBS A;  4LR6 A;  4J0S A;  3D7C A;  5CU8 A;  5F1H A;  5DKH A;  5DKC A;  5DYU A;  4LZR A;  5COI A;  2H60 A;  2E7O A;  4CUR A;  3UV4 A;  4O78 A;  5IGL A;  4O72 A;  5CUB A;  4NR7 A;  4YYG A;  2D82 A;  4LYS A;  4HXK A;  3AQA A;  5CQ8 A;  5E9M A;  4N3W A;  4Z93 A;  5DY7 A;  5D3R A;  5DYX A;  3S91 A;  5DFC A;  4QBM A;  4N4I A;  5FE2 A;  4WIV A;  5EM3 A;  4NR6 A;  2L5E A;  5FH8 A;  4CFK A;  3ONI A;  5KU3 A;  5D25 A;  4NQN A;  5ENJ A;  4NRC A;  4YY6 A;  5C8G A;  5F5Z A;  3QZT A;  5BT5 A;  5KTW A;  1F68 A;  4TU6 A;  4YBT A;  5EWD A;  5H1V A;  5C87 A;  2OO1 A;  4LRG A;  5L8T A;  2L84 A;  5L96 A;  5F60 A;  2OSS A;  4ALG A;  4WHU A;  5CQ3 A;  5CY9 A;  4NS5 A;  5C7N A;  4QSX A;  5A83 A;  5FE9 A;  5DYC A;  3U5L A;  4IOQ A;  5ENI A;  4Y03 A;  5FFW A;  5IG6 A;  2YW5 A;  5E9I A;  3O35 A;  5E9V A;  4YYN A;  2RO1 A;  4CUS A;  1WUG A;  2G4A A;  5CGP A;  5FE5 A;  4ZC9 A;  3GG3 A;  3O34 A;  4NXJ A;  5EWW A;  4YY4 A;  5CQ6 A;  3JVM A;  5E9K A;  4XUB A;  5CRZ A;  3P1C A;  4ZQL A;  5ENF A;  4YAB A;  4QSR A;  4QYL A;  4QR5 A;  5L99 A;  5CP5 A;  4QC1 A;  5FG5 A;  4MR5 A;  4QSU A;  3U5M A;  4A9O A;  4KV4 A;  4Q0O A;  3LQI A;  2E3K A;  4PCE A;  3MB3 A;  4XY9 A;  3SVF A;  5KO4 A;  3P1D A;  1EQF A;  3IU5 A;  2R0V A;  3SVG A;  5LJ1 A;  4O7E A;  4ZW1 A;  5DLX A;  5D3T A;  4QSS A;  5ENB A;  2WP2 A;  5E9Y A;  5HM0 A;  4UIT A;  4A9L A;  5FE1 A;  4CUT A;  5LUU A;  4A9J A;  3U5K A;  5EI4 A;  5HQ7 A;  5E9L A;  5F2P A;  5A82 A;  5CQA A;  5CQ5 A;  5E74 A;  5D3P A;  4NR4 A;  4C67 A;  5CFW A;  5F25 A;  5LVR A;  5G4S A;  5FFY A;  4HXR A;  4Z1S A;  4BW3 A;  4TT6 A;  4E96 A;  5CUC A;  5EK9 A;  4QSQ A;  2L85 A;  5ACY A;  4UIZ A;  4YYH A;  5FE7 A;  4HBV A;  3O33 A;  5EWV A;  4IR6 A;  4TT4 A;  2RS9 B;  4QY4 A;  4KV1 A;  4O7C A;  4HXL A;  5DFB A;  3G0J A;  3ZYU A;  4J1P A;  1E6I A;  5A5R A;  4QZS A;  5CRM A;  4N4H A;  2DWW A;  5FE3 A;  1JSP B;  5A7C A;  5AD3 A;  5EQ1 A;  5II1 A;  4CL9 A;  1JM4 B;  5LKT A;  4O74 A;  4KCX A;  1X0J A;  4QUU A;  4CUP A;  4A9E A;  4LDF A;  5ENH A;  3HMF A;  2DAT A;  4NR5 A;  5EVA A;  5IGN A;  5HEM A;  4MR4 A;  5F1L A;  3SVH A;  5AD2 A;  5A5S A;  5DFD A;  4QSV A;  5ENG A;  4QSW A;  2GRC A;  5HRV A;  3Q2F A;  5FFV A;  2DVR A;  4HBW A;  5II2 A;  4QUT A;  4UIY A;  4NQM A;  5CQ4 A;  4CUU A;  4A9N A;  4QR3 A;  4OGJ A;  4NR9 A;  4QR4 A;  5A81 A;  5LVQ A;  5I86 A;  4O7B A;  4Z1Q A;  2R0S A;  5I40 A;  5I83 A;  5HLS A;  4J0R A;  4AKN A;  3LXJ A;  3RCW A;  4UYH A;  4YK0 A;  5D0C A;  2DVS A;  5DW1 A;  4MEO A;  4QEU A;  5FB0 A;  4TU4 A;  4TZ8 A;  4MEN A;  4BJX A;  5I89 A;  5D3J A;  2YQD A;  4BW4 A;  5HFR A;  5DW2 A;  3LQJ A;  4YYI A;  2RI7 A;  4LYW A;  4CUQ A;  4NRA A;  3MB4 A;  5H1T A;  3MQM A;  2YDW A;  5DLZ A;  3MUK A;  5K29 A;  2N9G A;  4UIW A;  4YAT A;  3Q2E A;  5L8U A;  5CTL A;  4QYD A;  4F3I A;  3K2J A;  5HRX A;  4UYF A;  4C66 A;  5C89 A;  4O71 A;  5F63 A;  4QEW A;  2R0Y A;  5EIC A;  5CZG A;  5DYA A;  4PS5 A;  5LKZ A;  5E73 A;  3QZS A;  4IOR A;  5CUA A;  4YAX A;  4OUF A;  3UVD A;  2NXB A;  4NR8 A;  5A85 A;  4A9H A;  5L98 A;  5LJ2 A;  3P1E A;  4N4F A;  5FB1 A;  5A5O A;  5LKU A;  4QSP A;  4NRB A;  5CUD A;  5FE4 A;  5E0R A;  5L97 A;  5CUE A;  5DBM A;  4DON A;  4RVR A;  2I7K A;  4CLB A;  5F3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...