4PY6A

Crystal structure of bromodomain of pfa0510w from plasmodium falciparum
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
ENSNKRLLKQWEKILRDNVLKLLKNDNNAFYFKTPVLEDININDNIKEEYRIKIKKPMDYITISRNLSDGIYKEPIDFYHDMKLIYKNCIDFNPDIEENKYIIEAAKSSDMKFEFLWNKWKEKINNNFCDLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Bromodomain protein, putative
publication title Crystal Structure of bromodomain of PFA0510w from Plasmodium Falciparum
rcsb
source organism Plasmodium falciparum 3d7
total genus 40
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4py6A00
5ENEA 5DW2A 5DY7A 5FFWA 5LVRA 3MXFA 5L8TA 3LQIA 5J0DA 5II2A 5FE0A 4UIZA 4QSPA 5FE8A 4ZQLA 5FG6A 4O71A 4O77A 4O70A 4WHUA 5DKCA 4YK0A 5CQ8A 2YQDA 5EA1A 1N72A 4MEOA 5EWDA 4UYFB 2DVQA 4QNSA 2OO1A 4MR4A 5FFVA 4YABA 4ALGA 4GPJA 1F68A 4Z1QA 4ZC9A 5DYAA 4O75A 5CP5A 5F61A 4NUEA 5CPEA 4QEWA 5D26A 3JVKA 5F60A 2E3KA 3UV2A 4A9HA 4LC2A 4XUAA 2YW5A 2WP1A 5E7DA 4QYDA 4QSWA 4LZRA 4QSSA 4TZ8A 3S91A 5FE3A 4MEPA 4CFLA 4KCXA 3G0JA 5FE5A 4N4GA 2OUOA 5IG6A 5KHMA 4OGJA 3UVDA 4LZSA 5ETDA 3Q2FA 2R0SA 4NQNA 4X2IA 5I7XA 4UYEA 4O74A 4PCEA 5F63A 5D3PA 4NYVA 2RFJA 5DW1A 2RNYA 2MJVB 2DVRA 2L85A 4NR9A 5KTWA 3LXJA 2DATA 3SVFA 4IR6A 5EVAA 3MUKA 3HMHA 4NS5A 1EQFA 3QZTA 5LJ2A 4N4HA 4QBMA 5LUUA 5DX4A 5EICA 5FB0A 5L8UA 5KO4A 5EM3A 3MULA 5DLXA 5I83A 4UIUA 3S92A 5HM0A 5ENJA 4QC1A 3UVYA 4YYGA 2DVVA 3D7CA 5I1QA 2RNXA 4A9OA 4IR3A 1X0JA 5LKUA 5CU8A 2WP2A 2H60A 5C4QA 5F1LA 5ENIA 5DKHA 4QR4A 3QZSA 5D3NA 4NR7A 4RVRA 2L84A 3O37A 2YELA 4QSUA 4NRBA 5D3RA 5E0RA 4A9KA 5EPSA 4HXMA 5CS8A 5F3AA 5TCMA 5A5PA 5F5ZA 4KV1A 5H85A 5AMFA 5HQ6A 3IU6A 5DBMA 4LR6A 5CTLA 4YYNA 5IGNA 5E74A 5H1TA 5E3DA 5A5OA 5D3SA 2D82A 5II1A 4A9IA 5CFWA 4CURA 5CUBA 4QUTA 2E7NA 3IU5A 4HXSA 5JI8A 4TT6A 4LZ2A 2F6JA 2F6NA 4TQNA 5HEMA 5HQ7A 5AD3A 3LQJA 4QEUA 3G0LA 5IGMA 4HXKA 4QSRA 2DKWA 3UVWA 4BJXA 4NR6A 3U5LA 5EV9A 5EWVA 4CUPA 5IGKA 5FDZA 5HRVA 5EQ1A 5A83A 5CY9A 5D7XA 4ZW1A 3HMEA 4Z1SA 5A5QA 3U5NA 5C8GA 4LYWA 5HCLA 5FE2A 5CUGA 2LSPB 4LYIA 5ENGA 4J1PA 4N4IA 2R0YA 4NQMA 5DLZA 4NR5A 5HRXA 4TTEA 2OSSA 3QZVA 5FH6A 4YADA 4NR8A 5EK9A 3P5OA 5C87A 5D3JA 4YBSA 4QSVA 5EWHA 5C7NA 5I80A 3UV5A 4HBXA 4O78A 5KTXA 2RI7A 5K29A 2GRCA 4N3WA 5EPRA 3AQAA 5FG4A 2FSAA 1WUMA 4TZ2A 5IBNA 4J3IA 5C85A 5D0CA 5E9LA 5TB6A 3LJWA 5AMEA 4C66A 4QYLA 2I7KA 5IGLA 5FH7A 4YY6A 5F62A 4YYMA 5KU3A 5E9MA 3U5MA 4UYDA 4TT4A 4YC9A 1JM4B 3JVJA 4TYLA 5HFRA 4QC3A 5ENBA 4IR5A 3O36A 5EISA 4UIXA 3U5PA 4QSXA 2DVSA 5F2PA 5JWMA 4PKLA 2RNWA 2L5EA 5A82A 5ENFA 5ENCA 5FE7A 3I3JA 2KTBB 5CQ6A 5LKZA 5E3GA 4Q0OA 4DONA 4PCIA 5HELA 4QR3A 5CQTA 2RS9B 5DKDA 2D9EA 5HENA 5L96A 4O72A 4HXRA 5D3HA 4TS8A 4QSTA 5CGPA 5FBXA 4Y03A 4A9LA 5BT3A 5I7YA 3GG3A 2R10A 3K2JA 5A5RA 4YY4A 5AD2A 5CZGA 4NXJA 4TT2A 4NUCA 3NXBA 4HXOA 5H1UA 4O7AA 4O7CA 5COIA 5A85A 1WUGA 4HBWA 4NYWA 5DFCA 5BT4A 3MB4A 5EI4A 5E9YA 4O7BA 5D3LA 2I8NA 3AADA 4NUDA 3U5OA 4E96A 5F25A 5A7CA 5ENHA 5EWWA 3FKMX 4F3IA 3SVHA 3UVXA 4O7EA 5E9VA 5CUAA 4BW3A 2N9GA 4AKNA 4BW2A 2YYNA 5L98A 4UIYA 4IR4A 5FE4A 5EU1A 3P1CA 4HBYA 5F1HA 4UITA 4O76A 4YH4A 4QB3A 4YYKA 5C89A 4FLPA 5L97A 5HFQA 4YYDA 4PTBA 3UV4A 4LDFA 5KTUA 2RO1A 5CQ3A 5LKTA 5DYXA 5DFBA 2YDWA 4UYGA 4A9MA 5E9IA 5FH8A 4PY6A 5A5NA 4MR6A 4HBVA 5IIDA 4YYIA 5I29A 4J0RA 5I89A 5HLSA 3P1FA 4XY9A 4NRAA 5A5SA 5HRWA 3SVGA 2YEKA 5L99A 2YEMA 4Z6HA 5I86A 5D3TA 4BW4A 4LYSA 4IOOA 4YH3A 4YATA 4QY4A 4IOQA 3O33A 5EWCA 4NR4A 4A9EA 4C67A 5CQAA 5A81A 4CLBA 4CUUA 3O34A 4J0SA 4OGIA 3ZYUA 4YBTA 5LVQA 5FG5A 4HXLA 3P1DA 5FE6A 4Q0NA 4XYAA 4NRCA 1JSPB 4UYFA 4UYHA 4TU6A 4CL9A 4IORA 4CUQA 4WIVA 4OUFA 5LJ1A 5CUCA 3DWYA 5H1VA 5HJCA 2E7OA 5E73A 5DYUA 4UIWA 4QSQA 5D25A 4XY8A 5EGUA 5G4SA 4N4FA 4WHWA 5D24A 4BW1A 4HXNA 4YBMA 3U5KA 1ZS5A 4TU4A 4YAXA 4PS5A 5CRZA 5E9KA 4A9NA 5ETBA 5I40A 5DYCA 5CUEA 5F36A 5EP7A 2R0VA 1E6IA 4NYXA 4UIVA 5EPBA 4QUUA 3MQMA 5HQ5A 4KV4A 3MB3A 4CFKA 5LJ0A 4QZSA 3JVMA 5FFYA 2NXBA 3DAIA 3RCWA 4Z6IA 5CRMA 4QEVA 4QR5A 4MENA 5G4RA 4MR3A 2DWWA 3TLPA 4LRGA 3UW9A 3U5JA 5CQ4A 5FB1A 5CQ7A 4BHWA 4CUTA 4ALHA 5ACYA 5I88A 4MEQA 2G4AA 4XUBA 4A9JA 3LQHA 3ONIA 4YYJA 5FE9A 5CUDA 5FE1A 5BT5A 3Q2EA 4Z93A 4O7FA 5CQ5A 3JVLA 4CUSA 4HXPA 3HMFA 3P1EA 4MR5A 5DFDA 4YYHA 5LKXA 3O35A 4A9FA
chains in the Genus database with same CATH superfamily
5ENEA 5DW2A 5DY7A 5FFWA 5LVRA 3MXFA 5L8TA 3LQIA 5J0DA 5II2A 5FE0A 4UIZA 4QSPA 5FE8A 4ZQLA 5FG6A 4O71A 4O77A 4O70A 4WHUA 5DKCA 4YK0A 5CQ8A 2EJNA 2YQDA 5EA1A 1N72A 4MEOA 5EWDA 4UYFB 2DVQA 4QNSA 2OO1A 4MR4A 5FFVA 4YABA 4ALGA 4GPJA 1F68A 4Z1QA 3ERRA 4ZC9A 5DYAA 4O75A 5CP5A 5F61A 4NUEA 5CPEA 4QEWA 5D26A 3JVKA 5F60A 2E3KA 3UV2A 4A9HA 3VKHA 4LC2A 4XUAA 2YW5A 2WP1A 5E7DA 4QYDA 4QSWA 4LZRA 4QSSA 4TZ8A 3S91A 5FE3A 4MEPA 4CFLA 4KCXA 3G0JA 5FE5A 4N4GA 2OUOA 5IG6A 5KHMA 4OGJA 3UVDA 4LZSA 5ETDA 3Q2FA 2R0SA 4NQNA 4X2IA 5I7XA 4UYEA 4O74A 1PUOA 4PCEA 5F63A 5D3PA 4NYVA 2RFJA 5DW1A 2RNYA 2MJVB 2DVRA 2L85A 4NR9A 5KTWA 3LXJA 2DATA 3SVFA 4IR6A 5EVAA 3MUKA 3HMHA 4NS5A 1EQFA 3QZTA 5LJ2A 4N4HA 4QBMA 5LUUA 5DX4A 5EICA 5FB0A 5L8UA 5KO4A 3D1BA 5EM3A 3MULA 5DLXA 5I83A 4UIUA 3S92A 5HM0A 5ENJA 4QC1A 3UVYA 4YYGA 2DVVA 3D7CA 5I1QA 2RNXA 4A9OA 4IR3A 1X0JA 5LKUA 5CU8A 2WP2A 2H60A 5C4QA 5F1LA 5ENIA 5DKHA 4QR4A 3QZSA 5D3NA 4NR7A 4RVRA 2L84A 3O37A 2YELA 4QSUA 4NRBA 5D3RA 5E0RA 4A9KA 5EPSA 4HXMA 5CS8A 5F3AA 5TCMA 5A5PA 5F5ZA 4KV1A 5H85A 5AMFA 5HQ6A 3IU6A 5DBMA 4LR6A 5CTLA 4YYNA 4AKHA 5IGNA 5E74A 5H1TA 5E3DA 5A5OA 5D3SA 2D82A 5II1A 4A9IA 5CFWA 4CURA 5CUBA 4QUTA 2E7NA 3IU5A 4HXSA 5JI8A 4TT6A 4LZ2A 2F6JA 2F6NA 4TQNA 5HEMA 5HQ7A 5AD3A 3LQJA 4QEUA 3G0LA 5IGMA 4HXKA 4QSRA 2DKWA 3UVWA 4BJXA 4NR6A 3U5LA 5EV9A 5EWVA 4CUPA 5IGKA 5FDZA 5HRVA 5EQ1A 5A83A 5CY9A 5D7XA 4ZW1A 3HMEA 4Z1SA 5A5QA 3U5NA 5C8GA 4LYWA 5HCLA 5FE2A 5CUGA 2LSPB 4LYIA 5ENGA 4J1PA 4N4IA 2R0YA 4NQMA 5DLZA 4NR5A 5HRXA 4TTEA 2OSSA 3QZVA 5FH6A 4YADA 4NR8A 5EK9A 3P5OA 5C87A 5D3JA 4YBSA 4QSVA 5EWHA 5C7NA 1ZKRA 5I80A 3UV5A 4HBXA 4O78A 5KTXA 2RI7A 5K29A 2GRCA 4N3WA 5EPRA 3AQAA 5FG4A 2FSAA 1WUMA 4TZ2A 5IBNA 4J3IA 5C85A 5D0CA 5E9LA 5TB6A 3LJWA 5AMEA 4C66A 4QYLA 2I7KA 5IGLA 5FH7A 4YY6A 5F62A 4YYMA 5KU3A 5E9MA 3U5MA 4UYDA 4TT4A 4YC9A 1JM4B 3JVJA 4TYLA 5HFRA 4QC3A 5ENBA 4IR5A 3O36A 5EISA 4UIXA 3U5PA 4QSXA 2DVSA 5F2PA 5JWMA 4PKLA 2RNWA 2L5EA 5A82A 5ENFA 5ENCA 5FE7A 3I3JA 2KTBB 5CQ6A 5LKZA 5E3GA 4Q0OA 4DONA 4PCIA 5HELA 4QR3A 5CQTA 2RS9B 5DKDA 2D9EA 5HENA 5L96A 4O72A 4HXRA 5D3HA 4TS8A 4QSTA 5CGPA 5FBXA 4Y03A 4A9LA 5BT3A 5I7YA 3GG3A 2R10A 3K2JA 5A5RA 4YY4A 5AD2A 5CZGA 4NXJA 4TT2A 4NUCA 3NXBA 4HXOA 5H1UA 4O7AA 4O7CA 5COIA 5A85A 1WUGA 4HBWA 4NYWA 5DFCA 5BT4A 3MB4A 5EI4A 5E9YA 4O7BA 5D3LA 2I8NA 3AADA 4NUDA 3U5OA 4E96A 5F25A 5A7CA 5ENHA 5EWWA 3FKMX 4F3IA 3SVHA 3UVXA 4O7EA 5E9VA 5CUAA 4BW3A 2N9GA 4AKNA 4BW2A 2YYNA 5L98A 4UIYA 4IR4A 5FE4A 4AKGA 4AKIA 5EU1A 3P1CA 4HBYA 5F1HA 4UITA 4O76A 4YH4A 4QB3A 4YYKA 5C89A 4FLPA 5L97A 5HFQA 4YYDA 4PTBA 3UV4A 4LDFA 5KTUA 2RO1A 3D1DA 5CQ3A 5LKTA 5DYXA 5DFBA 2YDWA 4UYGA 4A9MA 5E9IA 5FH8A 4PY6A 5A5NA 4MR6A 4HBVA 5IIDA 4YYIA 5I29A 4J0RA 5I89A 5HLSA 3P1FA 4XY9A 4NRAA 5A5SA 5HRWA 3SVGA 2YEKA 5L99A 3VKGA 2YEMA 4Z6HA 5I86A 5D3TA 4BW4A 4LYSA 4IOOA 4YH3A 4YATA 4QY4A 4IOQA 3O33A 5EWCA 4NR4A 4A9EA 4C67A 5CQAA 5A81A 4CLBA 4CUUA 3O34A 4J0SA 4OGIA 3ZYUA 4YBTA 5LVQA 5FG5A 4HXLA 3P1DA 5FE6A 4Q0NA 4XYAA 4NRCA 1JSPB 4UYFA 4UYHA 4TU6A 4CL9A 4IORA 4CUQA 4AI6A 4WIVA 4OUFA 5LJ1A 5CUCA 3DWYA 5H1VA 5HJCA 2E7OA 5E73A 5DYUA 4UIWA 4QSQA 5D25A 4XY8A 5EGUA 5G4SA 4N4FA 4WHWA 5D24A 4BW1A 4HXNA 4YBMA 3U5KA 1ZS5A 4TU4A 4YAXA 4PS5A 5CRZA 5E9KA 4A9NA 5ETBA 5I40A 5DYCA 5CUEA 5F36A 5EP7A 2R0VA 1E6IA 4NYXA 4UIVA 5EPBA 4QUUA 3MQMA 5HQ5A 4KV4A 3MB3A 4CFKA 5LJ0A 4QZSA 3JVMA 5FFYA 2NXBA 3DAIA 3RCWA 4Z6IA 5CRMA 4QEVA 4QR5A 4MENA 5G4RA 4MR3A 2DWWA 3TLPA 4LRGA 3UW9A 3U5JA 5CQ4A 5FB1A 5CQ7A 4BHWA 4CUTA 4ALHA 5ACYA 5I88A 4MEQA 2G4AA 4XUBA 4A9JA 3LQHA 3ONIA 4YYJA 5FE9A 5CUDA 5FE1A 5BT5A 3Q2EA 4Z93A 4O7FA 5CQ5A 3JVLA 4CUSA 4HXPA 3HMFA 3P1EA 4MR5A 5DFDA 4YYHA 5LKXA 3O35A 4A9FA
chains in the Genus database with same CATH topology
5ENEA 5DW2A 5DY7A 5FFWA 5LVRA 3MXFA 5L8TA 3LQIA 5J0DA 5II2A 5FE0A 4UIZA 4QSPA 5FE8A 4ZQLA 5FG6A 4O71A 4O77A 4O70A 4WHUA 5DKCA 4YK0A 5CQ8A 2YQDA 5EA1A 1N72A 4MEOA 5EWDA 4UYFB 2DVQA 4QNSA 2OO1A 4MR4A 5FFVA 4YABA 4ALGA 4GPJA 1F68A 4Z1QA 4ZC9A 5DYAA 4O75A 5CP5A 5F61A 4NUEA 5CPEA 4QEWA 5D26A 3JVKA 5F60A 2E3KA 3UV2A 4A9HA 4LC2A 4XUAA 2YW5A 2WP1A 5E7DA 4QYDA 4QSWA 4LZRA 4QSSA 4TZ8A 3S91A 5FE3A 4MEPA 4CFLA 4KCXA 3G0JA 5FE5A 4N4GA 2OUOA 5IG6A 5KHMA 4OGJA 3UVDA 4LZSA 5ETDA 3Q2FA 2R0SA 4NQNA 4X2IA 5I7XA 4UYEA 4O74A 4PCEA 5F63A 5D3PA 4NYVA 2RFJA 5DW1A 2RNYA 2MJVB 2DVRA 2L85A 4NR9A 5KTWA 3LXJA 2DATA 3SVFA 4IR6A 5EVAA 3MUKA 3HMHA 4NS5A 1EQFA 3QZTA 5LJ2A 4N4HA 4QBMA 5LUUA 5DX4A 5EICA 5FB0A 5L8UA 5KO4A 5EM3A 3MULA 5DLXA 5I83A 4UIUA 3S92A 5HM0A 5ENJA 4QC1A 3UVYA 4YYGA 2DVVA 3D7CA 5I1QA 2RNXA 4A9OA 4IR3A 1X0JA 5LKUA 5CU8A 2WP2A 2H60A 5C4QA 5F1LA 5ENIA 5DKHA 4QR4A 3QZSA 5D3NA 4NR7A 4RVRA 2L84A 3O37A 2YELA 4QSUA 4NRBA 5D3RA 5E0RA 4A9KA 5EPSA 4HXMA 5CS8A 5F3AA 5TCMA 5A5PA 5F5ZA 4KV1A 5H85A 5AMFA 5HQ6A 3IU6A 5DBMA 4LR6A 5CTLA 4YYNA 5IGNA 5E74A 5H1TA 5E3DA 5A5OA 5D3SA 2D82A 5II1A 4A9IA 5CFWA 4CURA 5CUBA 4QUTA 2E7NA 3IU5A 4HXSA 5JI8A 4TT6A 4LZ2A 2F6JA 2F6NA 4TQNA 5HEMA 5HQ7A 5AD3A 3LQJA 4QEUA 3G0LA 5IGMA 4HXKA 4QSRA 2DKWA 3UVWA 4BJXA 4NR6A 3U5LA 5EV9A 5EWVA 4CUPA 5IGKA 5FDZA 5HRVA 5EQ1A 5A83A 5CY9A 5D7XA 4ZW1A 3HMEA 4Z1SA 5A5QA 3U5NA 5C8GA 4LYWA 5HCLA 5FE2A 5CUGA 2LSPB 4LYIA 5ENGA 4J1PA 4N4IA 2R0YA 4NQMA 5DLZA 4NR5A 5HRXA 4TTEA 2OSSA 3QZVA 5FH6A 4YADA 4NR8A 5EK9A 3P5OA 5C87A 5D3JA 4YBSA 4QSVA 5EWHA 5C7NA 5I80A 3UV5A 4HBXA 4O78A 5KTXA 2RI7A 5K29A 2GRCA 4N3WA 5EPRA 3AQAA 5FG4A 2FSAA 1WUMA 4TZ2A 5IBNA 4J3IA 5C85A 5D0CA 5E9LA 5TB6A 3LJWA 5AMEA 4C66A 4QYLA 2I7KA 5IGLA 5FH7A 4YY6A 5F62A 4YYMA 5KU3A 5E9MA 3U5MA 4UYDA 4TT4A 4YC9A 1JM4B 3JVJA 4TYLA 5HFRA 4QC3A 5ENBA 4IR5A 3O36A 5EISA 4UIXA 3U5PA 4QSXA 2DVSA 5F2PA 5JWMA 4PKLA 2RNWA 2L5EA 5A82A 5ENFA 5ENCA 5FE7A 3I3JA 2KTBB 5CQ6A 5LKZA 5E3GA 4Q0OA 4DONA 4PCIA 5HELA 4QR3A 5CQTA 2RS9B 5DKDA 2D9EA 5HENA 5L96A 4O72A 4HXRA 5D3HA 4TS8A 4QSTA 5CGPA 5FBXA 4Y03A 4A9LA 5BT3A 5I7YA 3GG3A 2R10A 3K2JA 5A5RA 4YY4A 5AD2A 5CZGA 4NXJA 4TT2A 4NUCA 3NXBA 4HXOA 5H1UA 4O7AA 4O7CA 5COIA 5A85A 1WUGA 4HBWA 4NYWA 5DFCA 5BT4A 3MB4A 5EI4A 5E9YA 4O7BA 5D3LA 2I8NA 3AADA 4NUDA 3U5OA 4E96A 5F25A 5A7CA 5ENHA 5EWWA 3FKMX 4F3IA 3SVHA 3UVXA 4O7EA 5E9VA 5CUAA 4BW3A 2N9GA 4AKNA 4BW2A 2YYNA 5L98A 4UIYA 4IR4A 5FE4A 5EU1A 3P1CA 4HBYA 5F1HA 4UITA 4O76A 4YH4A 4QB3A 4YYKA 5C89A 4FLPA 5L97A 5HFQA 4YYDA 4PTBA 3UV4A 4LDFA 5KTUA 2RO1A 5CQ3A 5LKTA 5DYXA 5DFBA 2YDWA 4UYGA 4A9MA 5E9IA 5FH8A 4PY6A 5A5NA 4MR6A 4HBVA 5IIDA 4YYIA 5I29A 4J0RA 5I89A 5HLSA 3P1FA 4XY9A 4NRAA 5A5SA 5HRWA 3SVGA 2YEKA 5L99A 2YEMA 4Z6HA 5I86A 5D3TA 4BW4A 4LYSA 4IOOA 4YH3A 4YATA 4QY4A 4IOQA 3O33A 5EWCA 4NR4A 4A9EA 4C67A 5CQAA 5A81A 4CLBA 4CUUA 3O34A 4J0SA 4OGIA 3ZYUA 4YBTA 5LVQA 5FG5A 4HXLA 3P1DA 5FE6A 4Q0NA 4XYAA 4NRCA 1JSPB 4UYFA 4UYHA 4TU6A 4CL9A 4IORA 4CUQA 4WIVA 4OUFA 5LJ1A 5CUCA 3DWYA 5H1VA 5HJCA 2E7OA 5E73A 5DYUA 4UIWA 4QSQA 5D25A 4XY8A 5EGUA 5G4SA 4N4FA 4WHWA 5D24A 4BW1A 4HXNA 4YBMA 3U5KA 1ZS5A 4TU4A 4YAXA 4PS5A 5CRZA 5E9KA 4A9NA 5ETBA 5I40A 5DYCA 5CUEA 5F36A 5EP7A 2R0VA 1E6IA 4NYXA 4UIVA 5EPBA 4QUUA 3MQMA 5HQ5A 4KV4A 3MB3A 4CFKA 5LJ0A 4QZSA 3JVMA 5FFYA 2NXBA 3DAIA 3RCWA 4Z6IA 5CRMA 4QEVA 4QR5A 4MENA 5G4RA 4MR3A 2DWWA 3TLPA 4LRGA 3UW9A 3U5JA 5CQ4A 5FB1A 5CQ7A 4BHWA 4CUTA 4ALHA 5ACYA 5I88A 4MEQA 2G4AA 4XUBA 4A9JA 3LQHA 3ONIA 4YYJA 5FE9A 5CUDA 5FE1A 5BT5A 3Q2EA 4Z93A 4O7FA 5CQ5A 3JVLA 4CUSA 4HXPA 3HMFA 3P1EA 4MR5A 5DFDA 4YYHA 5LKXA 3O35A 4A9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENE A;  5DW2 A;  5DY7 A;  5FFW A;  5LVR A;  3MXF A;  5L8T A;  3LQI A;  5J0D A;  5II2 A;  5FE0 A;  4UIZ A;  4QSP A;  5FE8 A;  4ZQL A;  5FG6 A;  4O71 A;  4O77 A;  4O70 A;  4WHU A;  5DKC A;  4YK0 A;  5CQ8 A;  2YQD A;  5EA1 A;  1N72 A;  4MEO A;  5EWD A;  4UYF B;  2DVQ A;  4QNS A;  2OO1 A;  4MR4 A;  5FFV A;  4YAB A;  4ALG A;  4GPJ A;  1F68 A;  4Z1Q A;  4ZC9 A;  5DYA A;  4O75 A;  5CP5 A;  5F61 A;  4NUE A;  5CPE A;  4QEW A;  5D26 A;  3JVK A;  5F60 A;  2E3K A;  3UV2 A;  4A9H A;  4LC2 A;  4XUA A;  2YW5 A;  2WP1 A;  5E7D A;  4QYD A;  4QSW A;  4LZR A;  4QSS A;  4TZ8 A;  3S91 A;  5FE3 A;  4MEP A;  4CFL A;  4KCX A;  3G0J A;  5FE5 A;  4N4G A;  2OUO A;  5IG6 A;  5KHM A;  4OGJ A;  3UVD A;  4LZS A;  5ETD A;  3Q2F A;  2R0S A;  4NQN A;  4X2I A;  5I7X A;  4UYE A;  4O74 A;  4PCE A;  5F63 A;  5D3P A;  4NYV A;  2RFJ A;  5DW1 A;  2RNY A;  2MJV B;  2DVR A;  2L85 A;  4NR9 A;  5KTW A;  3LXJ A;  2DAT A;  3SVF A;  4IR6 A;  5EVA A;  3MUK A;  3HMH A;  4NS5 A;  1EQF A;  3QZT A;  5LJ2 A;  4N4H A;  4QBM A;  5LUU A;  5DX4 A;  5EIC A;  5FB0 A;  5L8U A;  5KO4 A;  5EM3 A;  3MUL A;  5DLX A;  5I83 A;  4UIU A;  3S92 A;  5HM0 A;  5ENJ A;  4QC1 A;  3UVY A;  4YYG A;  2DVV A;  3D7C A;  5I1Q A;  2RNX A;  4A9O A;  4IR3 A;  1X0J A;  5LKU A;  5CU8 A;  2WP2 A;  2H60 A;  5C4Q A;  5F1L A;  5ENI A;  5DKH A;  4QR4 A;  3QZS A;  5D3N A;  4NR7 A;  4RVR A;  2L84 A;  3O37 A;  2YEL A;  4QSU A;  4NRB A;  5D3R A;  5E0R A;  4A9K A;  5EPS A;  4HXM A;  5CS8 A;  5F3A A;  5TCM A;  5A5P A;  5F5Z A;  4KV1 A;  5H85 A;  5AMF A;  5HQ6 A;  3IU6 A;  5DBM A;  4LR6 A;  5CTL A;  4YYN A;  5IGN A;  5E74 A;  5H1T A;  5E3D A;  5A5O A;  5D3S A;  2D82 A;  5II1 A;  4A9I A;  5CFW A;  4CUR A;  5CUB A;  4QUT A;  2E7N A;  3IU5 A;  4HXS A;  5JI8 A;  4TT6 A;  4LZ2 A;  2F6J A;  2F6N A;  4TQN A;  5HEM A;  5HQ7 A;  5AD3 A;  3LQJ A;  4QEU A;  3G0L A;  5IGM A;  4HXK A;  4QSR A;  2DKW A;  3UVW A;  4BJX A;  4NR6 A;  3U5L A;  5EV9 A;  5EWV A;  4CUP A;  5IGK A;  5FDZ A;  5HRV A;  5EQ1 A;  5A83 A;  5CY9 A;  5D7X A;  4ZW1 A;  3HME A;  4Z1S A;  5A5Q A;  3U5N A;  5C8G A;  4LYW A;  5HCL A;  5FE2 A;  5CUG A;  2LSP B;  4LYI A;  5ENG A;  4J1P A;  4N4I A;  2R0Y A;  4NQM A;  5DLZ A;  4NR5 A;  5HRX A;  4TTE A;  2OSS A;  3QZV A;  5FH6 A;  4YAD A;  4NR8 A;  5EK9 A;  3P5O A;  5C87 A;  5D3J A;  4YBS A;  4QSV A;  5EWH A;  5C7N A;  5I80 A;  3UV5 A;  4HBX A;  4O78 A;  5KTX A;  2RI7 A;  5K29 A;  2GRC A;  4N3W A;  5EPR A;  3AQA A;  5FG4 A;  2FSA A;  1WUM A;  4TZ2 A;  5IBN A;  4J3I A;  5C85 A;  5D0C A;  5E9L A;  5TB6 A;  3LJW A;  5AME A;  4C66 A;  4QYL A;  2I7K A;  5IGL A;  5FH7 A;  4YY6 A;  5F62 A;  4YYM A;  5KU3 A;  5E9M A;  3U5M A;  4UYD A;  4TT4 A;  4YC9 A;  1JM4 B;  3JVJ A;  4TYL A;  5HFR A;  4QC3 A;  5ENB A;  4IR5 A;  3O36 A;  5EIS A;  4UIX A;  3U5P A;  4QSX A;  2DVS A;  5F2P A;  5JWM A;  4PKL A;  2RNW A;  2L5E A;  5A82 A;  5ENF A;  5ENC A;  5FE7 A;  3I3J A;  2KTB B;  5CQ6 A;  5LKZ A;  5E3G A;  4Q0O A;  4DON A;  4PCI A;  5HEL A;  4QR3 A;  5CQT A;  2RS9 B;  5DKD A;  2D9E A;  5HEN A;  5L96 A;  4O72 A;  4HXR A;  5D3H A;  4TS8 A;  4QST A;  5CGP A;  5FBX A;  4Y03 A;  4A9L A;  5BT3 A;  5I7Y A;  3GG3 A;  2R10 A;  3K2J A;  5A5R A;  4YY4 A;  5AD2 A;  5CZG A;  4NXJ A;  4TT2 A;  4NUC A;  3NXB A;  4HXO A;  5H1U A;  4O7A A;  4O7C A;  5COI A;  5A85 A;  1WUG A;  4HBW A;  4NYW A;  5DFC A;  5BT4 A;  3MB4 A;  5EI4 A;  5E9Y A;  4O7B A;  5D3L A;  2I8N A;  3AAD A;  4NUD A;  3U5O A;  4E96 A;  5F25 A;  5A7C A;  5ENH A;  5EWW A;  3FKM X;  4F3I A;  3SVH A;  3UVX A;  4O7E A;  5E9V A;  5CUA A;  4BW3 A;  2N9G A;  4AKN A;  4BW2 A;  2YYN A;  5L98 A;  4UIY A;  4IR4 A;  5FE4 A;  5EU1 A;  3P1C A;  4HBY A;  5F1H A;  4UIT A;  4O76 A;  4YH4 A;  4QB3 A;  4YYK A;  5C89 A;  4FLP A;  5L97 A;  5HFQ A;  4YYD A;  4PTB A;  3UV4 A;  4LDF A;  5KTU A;  2RO1 A;  5CQ3 A;  5LKT A;  5DYX A;  5DFB A;  2YDW A;  4UYG A;  4A9M A;  5E9I A;  5FH8 A;  4PY6 A;  5A5N A;  4MR6 A;  4HBV A;  5IID A;  4YYI A;  5I29 A;  4J0R A;  5I89 A;  5HLS A;  3P1F A;  4XY9 A;  4NRA A;  5A5S A;  5HRW A;  3SVG A;  2YEK A;  5L99 A;  2YEM A;  4Z6H A;  5I86 A;  5D3T A;  4BW4 A;  4LYS A;  4IOO A;  4YH3 A;  4YAT A;  4QY4 A;  4IOQ A;  3O33 A;  5EWC A;  4NR4 A;  4A9E A;  4C67 A;  5CQA A;  5A81 A;  4CLB A;  4CUU A;  3O34 A;  4J0S A;  4OGI A;  3ZYU A;  4YBT A;  5LVQ A;  5FG5 A;  4HXL A;  3P1D A;  5FE6 A;  4Q0N A;  4XYA A;  4NRC A;  1JSP B;  4UYF A;  4UYH A;  4TU6 A;  4CL9 A;  4IOR A;  4CUQ A;  4WIV A;  4OUF A;  5LJ1 A;  5CUC A;  3DWY A;  5H1V A;  5HJC A;  2E7O A;  5E73 A;  5DYU A;  4UIW A;  4QSQ A;  5D25 A;  4XY8 A;  5EGU A;  5G4S A;  4N4F A;  4WHW A;  5D24 A;  4BW1 A;  4HXN A;  4YBM A;  3U5K A;  1ZS5 A;  4TU4 A;  4YAX A;  4PS5 A;  5CRZ A;  5E9K A;  4A9N A;  5ETB A;  5I40 A;  5DYC A;  5CUE A;  5F36 A;  5EP7 A;  2R0V A;  1E6I A;  4NYX A;  4UIV A;  5EPB A;  4QUU A;  3MQM A;  5HQ5 A;  4KV4 A;  3MB3 A;  4CFK A;  5LJ0 A;  4QZS A;  3JVM A;  5FFY A;  2NXB A;  3DAI A;  3RCW A;  4Z6I A;  5CRM A;  4QEV A;  4QR5 A;  4MEN A;  5G4R A;  4MR3 A;  2DWW A;  3TLP A;  4LRG A;  3UW9 A;  3U5J A;  5CQ4 A;  5FB1 A;  5CQ7 A;  4BHW A;  4CUT A;  4ALH A;  5ACY A;  5I88 A;  4MEQ A;  2G4A A;  4XUB A;  4A9J A;  3LQH A;  3ONI A;  4YYJ A;  5FE9 A;  5CUD A;  5FE1 A;  5BT5 A;  3Q2E A;  4Z93 A;  4O7F A;  5CQ5 A;  3JVL A;  4CUS A;  4HXP A;  3HMF A;  3P1E A;  4MR5 A;  5DFD A;  4YYH A;  5LKX A;  3O35 A;  4A9F A; 
#chains in the Genus database with same CATH topology
 5ENE A;  5DW2 A;  5DY7 A;  5FFW A;  5LVR A;  3MXF A;  5L8T A;  3LQI A;  5J0D A;  5II2 A;  5FE0 A;  4UIZ A;  4QSP A;  5FE8 A;  4ZQL A;  5FG6 A;  4O71 A;  4O77 A;  4O70 A;  4WHU A;  5DKC A;  4YK0 A;  5CQ8 A;  2EJN A;  2YQD A;  5EA1 A;  1N72 A;  4MEO A;  5EWD A;  4UYF B;  2DVQ A;  4QNS A;  2OO1 A;  4MR4 A;  5FFV A;  4YAB A;  4ALG A;  4GPJ A;  1F68 A;  4Z1Q A;  3ERR A;  4ZC9 A;  5DYA A;  4O75 A;  5CP5 A;  5F61 A;  4NUE A;  5CPE A;  4QEW A;  5D26 A;  3JVK A;  5F60 A;  2E3K A;  3UV2 A;  4A9H A;  3VKH A;  4LC2 A;  4XUA A;  2YW5 A;  2WP1 A;  5E7D A;  4QYD A;  4QSW A;  4LZR A;  4QSS A;  4TZ8 A;  3S91 A;  5FE3 A;  4MEP A;  4CFL A;  4KCX A;  3G0J A;  5FE5 A;  4N4G A;  2OUO A;  5IG6 A;  5KHM A;  4OGJ A;  3UVD A;  4LZS A;  5ETD A;  3Q2F A;  2R0S A;  4NQN A;  4X2I A;  5I7X A;  4UYE A;  4O74 A;  1PUO A;  4PCE A;  5F63 A;  5D3P A;  4NYV A;  2RFJ A;  5DW1 A;  2RNY A;  2MJV B;  2DVR A;  2L85 A;  4NR9 A;  5KTW A;  3LXJ A;  2DAT A;  3SVF A;  4IR6 A;  5EVA A;  3MUK A;  3HMH A;  4NS5 A;  1EQF A;  3QZT A;  5LJ2 A;  4N4H A;  4QBM A;  5LUU A;  5DX4 A;  5EIC A;  5FB0 A;  5L8U A;  5KO4 A;  3D1B A;  5EM3 A;  3MUL A;  5DLX A;  5I83 A;  4UIU A;  3S92 A;  5HM0 A;  5ENJ A;  4QC1 A;  3UVY A;  4YYG A;  2DVV A;  3D7C A;  5I1Q A;  2RNX A;  4A9O A;  4IR3 A;  1X0J A;  5LKU A;  5CU8 A;  2WP2 A;  2H60 A;  5C4Q A;  5F1L A;  5ENI A;  5DKH A;  4QR4 A;  3QZS A;  5D3N A;  4NR7 A;  4RVR A;  2L84 A;  3O37 A;  2YEL A;  4QSU A;  4NRB A;  5D3R A;  5E0R A;  4A9K A;  5EPS A;  4HXM A;  5CS8 A;  5F3A A;  5TCM A;  5A5P A;  5F5Z A;  4KV1 A;  5H85 A;  5AMF A;  5HQ6 A;  3IU6 A;  5DBM A;  4LR6 A;  5CTL A;  4YYN A;  4AKH A;  5IGN A;  5E74 A;  5H1T A;  5E3D A;  5A5O A;  5D3S A;  2D82 A;  5II1 A;  4A9I A;  5CFW A;  4CUR A;  5CUB A;  4QUT A;  2E7N A;  3IU5 A;  4HXS A;  5JI8 A;  4TT6 A;  4LZ2 A;  2F6J A;  2F6N A;  4TQN A;  5HEM A;  5HQ7 A;  5AD3 A;  3LQJ A;  4QEU A;  3G0L A;  5IGM A;  4HXK A;  4QSR A;  2DKW A;  3UVW A;  4BJX A;  4NR6 A;  3U5L A;  5EV9 A;  5EWV A;  4CUP A;  5IGK A;  5FDZ A;  5HRV A;  5EQ1 A;  5A83 A;  5CY9 A;  5D7X A;  4ZW1 A;  3HME A;  4Z1S A;  5A5Q A;  3U5N A;  5C8G A;  4LYW A;  5HCL A;  5FE2 A;  5CUG A;  2LSP B;  4LYI A;  5ENG A;  4J1P A;  4N4I A;  2R0Y A;  4NQM A;  5DLZ A;  4NR5 A;  5HRX A;  4TTE A;  2OSS A;  3QZV A;  5FH6 A;  4YAD A;  4NR8 A;  5EK9 A;  3P5O A;  5C87 A;  5D3J A;  4YBS A;  4QSV A;  5EWH A;  5C7N A;  1ZKR A;  5I80 A;  3UV5 A;  4HBX A;  4O78 A;  5KTX A;  2RI7 A;  5K29 A;  2GRC A;  4N3W A;  5EPR A;  3AQA A;  5FG4 A;  2FSA A;  1WUM A;  4TZ2 A;  5IBN A;  4J3I A;  5C85 A;  5D0C A;  5E9L A;  5TB6 A;  3LJW A;  5AME A;  4C66 A;  4QYL A;  2I7K A;  5IGL A;  5FH7 A;  4YY6 A;  5F62 A;  4YYM A;  5KU3 A;  5E9M A;  3U5M A;  4UYD A;  4TT4 A;  4YC9 A;  1JM4 B;  3JVJ A;  4TYL A;  5HFR A;  4QC3 A;  5ENB A;  4IR5 A;  3O36 A;  5EIS A;  4UIX A;  3U5P A;  4QSX A;  2DVS A;  5F2P A;  5JWM A;  4PKL A;  2RNW A;  2L5E A;  5A82 A;  5ENF A;  5ENC A;  5FE7 A;  3I3J A;  2KTB B;  5CQ6 A;  5LKZ A;  5E3G A;  4Q0O A;  4DON A;  4PCI A;  5HEL A;  4QR3 A;  5CQT A;  2RS9 B;  5DKD A;  2D9E A;  5HEN A;  5L96 A;  4O72 A;  4HXR A;  5D3H A;  4TS8 A;  4QST A;  5CGP A;  5FBX A;  4Y03 A;  4A9L A;  5BT3 A;  5I7Y A;  3GG3 A;  2R10 A;  3K2J A;  5A5R A;  4YY4 A;  5AD2 A;  5CZG A;  4NXJ A;  4TT2 A;  4NUC A;  3NXB A;  4HXO A;  5H1U A;  4O7A A;  4O7C A;  5COI A;  5A85 A;  1WUG A;  4HBW A;  4NYW A;  5DFC A;  5BT4 A;  3MB4 A;  5EI4 A;  5E9Y A;  4O7B A;  5D3L A;  2I8N A;  3AAD A;  4NUD A;  3U5O A;  4E96 A;  5F25 A;  5A7C A;  5ENH A;  5EWW A;  3FKM X;  4F3I A;  3SVH A;  3UVX A;  4O7E A;  5E9V A;  5CUA A;  4BW3 A;  2N9G A;  4AKN A;  4BW2 A;  2YYN A;  5L98 A;  4UIY A;  4IR4 A;  5FE4 A;  4AKG A;  4AKI A;  5EU1 A;  3P1C A;  4HBY A;  5F1H A;  4UIT A;  4O76 A;  4YH4 A;  4QB3 A;  4YYK A;  5C89 A;  4FLP A;  5L97 A;  5HFQ A;  4YYD A;  4PTB A;  3UV4 A;  4LDF A;  5KTU A;  2RO1 A;  3D1D A;  5CQ3 A;  5LKT A;  5DYX A;  5DFB A;  2YDW A;  4UYG A;  4A9M A;  5E9I A;  5FH8 A;  4PY6 A;  5A5N A;  4MR6 A;  4HBV A;  5IID A;  4YYI A;  5I29 A;  4J0R A;  5I89 A;  5HLS A;  3P1F A;  4XY9 A;  4NRA A;  5A5S A;  5HRW A;  3SVG A;  2YEK A;  5L99 A;  3VKG A;  2YEM A;  4Z6H A;  5I86 A;  5D3T A;  4BW4 A;  4LYS A;  4IOO A;  4YH3 A;  4YAT A;  4QY4 A;  4IOQ A;  3O33 A;  5EWC A;  4NR4 A;  4A9E A;  4C67 A;  5CQA A;  5A81 A;  4CLB A;  4CUU A;  3O34 A;  4J0S A;  4OGI A;  3ZYU A;  4YBT A;  5LVQ A;  5FG5 A;  4HXL A;  3P1D A;  5FE6 A;  4Q0N A;  4XYA A;  4NRC A;  1JSP B;  4UYF A;  4UYH A;  4TU6 A;  4CL9 A;  4IOR A;  4CUQ A;  4AI6 A;  4WIV A;  4OUF A;  5LJ1 A;  5CUC A;  3DWY A;  5H1V A;  5HJC A;  2E7O A;  5E73 A;  5DYU A;  4UIW A;  4QSQ A;  5D25 A;  4XY8 A;  5EGU A;  5G4S A;  4N4F A;  4WHW A;  5D24 A;  4BW1 A;  4HXN A;  4YBM A;  3U5K A;  1ZS5 A;  4TU4 A;  4YAX A;  4PS5 A;  5CRZ A;  5E9K A;  4A9N A;  5ETB A;  5I40 A;  5DYC A;  5CUE A;  5F36 A;  5EP7 A;  2R0V A;  1E6I A;  4NYX A;  4UIV A;  5EPB A;  4QUU A;  3MQM A;  5HQ5 A;  4KV4 A;  3MB3 A;  4CFK A;  5LJ0 A;  4QZS A;  3JVM A;  5FFY A;  2NXB A;  3DAI A;  3RCW A;  4Z6I A;  5CRM A;  4QEV A;  4QR5 A;  4MEN A;  5G4R A;  4MR3 A;  2DWW A;  3TLP A;  4LRG A;  3UW9 A;  3U5J A;  5CQ4 A;  5FB1 A;  5CQ7 A;  4BHW A;  4CUT A;  4ALH A;  5ACY A;  5I88 A;  4MEQ A;  2G4A A;  4XUB A;  4A9J A;  3LQH A;  3ONI A;  4YYJ A;  5FE9 A;  5CUD A;  5FE1 A;  5BT5 A;  3Q2E A;  4Z93 A;  4O7F A;  5CQ5 A;  3JVL A;  4CUS A;  4HXP A;  3HMF A;  3P1E A;  4MR5 A;  5DFD A;  4YYH A;  5LKX A;  3O35 A;  4A9F A; 
#chains in the Genus database with same CATH homology
 5ENE A;  5DW2 A;  5DY7 A;  5FFW A;  5LVR A;  3MXF A;  5L8T A;  3LQI A;  5J0D A;  5II2 A;  5FE0 A;  4UIZ A;  4QSP A;  5FE8 A;  4ZQL A;  5FG6 A;  4O71 A;  4O77 A;  4O70 A;  4WHU A;  5DKC A;  4YK0 A;  5CQ8 A;  2YQD A;  5EA1 A;  1N72 A;  4MEO A;  5EWD A;  4UYF B;  2DVQ A;  4QNS A;  2OO1 A;  4MR4 A;  5FFV A;  4YAB A;  4ALG A;  4GPJ A;  1F68 A;  4Z1Q A;  4ZC9 A;  5DYA A;  4O75 A;  5CP5 A;  5F61 A;  4NUE A;  5CPE A;  4QEW A;  5D26 A;  3JVK A;  5F60 A;  2E3K A;  3UV2 A;  4A9H A;  4LC2 A;  4XUA A;  2YW5 A;  2WP1 A;  5E7D A;  4QYD A;  4QSW A;  4LZR A;  4QSS A;  4TZ8 A;  3S91 A;  5FE3 A;  4MEP A;  4CFL A;  4KCX A;  3G0J A;  5FE5 A;  4N4G A;  2OUO A;  5IG6 A;  5KHM A;  4OGJ A;  3UVD A;  4LZS A;  5ETD A;  3Q2F A;  2R0S A;  4NQN A;  4X2I A;  5I7X A;  4UYE A;  4O74 A;  4PCE A;  5F63 A;  5D3P A;  4NYV A;  2RFJ A;  5DW1 A;  2RNY A;  2MJV B;  2DVR A;  2L85 A;  4NR9 A;  5KTW A;  3LXJ A;  2DAT A;  3SVF A;  4IR6 A;  5EVA A;  3MUK A;  3HMH A;  4NS5 A;  1EQF A;  3QZT A;  5LJ2 A;  4N4H A;  4QBM A;  5LUU A;  5DX4 A;  5EIC A;  5FB0 A;  5L8U A;  5KO4 A;  5EM3 A;  3MUL A;  5DLX A;  5I83 A;  4UIU A;  3S92 A;  5HM0 A;  5ENJ A;  4QC1 A;  3UVY A;  4YYG A;  2DVV A;  3D7C A;  5I1Q A;  2RNX A;  4A9O A;  4IR3 A;  1X0J A;  5LKU A;  5CU8 A;  2WP2 A;  2H60 A;  5C4Q A;  5F1L A;  5ENI A;  5DKH A;  4QR4 A;  3QZS A;  5D3N A;  4NR7 A;  4RVR A;  2L84 A;  3O37 A;  2YEL A;  4QSU A;  4NRB A;  5D3R A;  5E0R A;  4A9K A;  5EPS A;  4HXM A;  5CS8 A;  5F3A A;  5TCM A;  5A5P A;  5F5Z A;  4KV1 A;  5H85 A;  5AMF A;  5HQ6 A;  3IU6 A;  5DBM A;  4LR6 A;  5CTL A;  4YYN A;  5IGN A;  5E74 A;  5H1T A;  5E3D A;  5A5O A;  5D3S A;  2D82 A;  5II1 A;  4A9I A;  5CFW A;  4CUR A;  5CUB A;  4QUT A;  2E7N A;  3IU5 A;  4HXS A;  5JI8 A;  4TT6 A;  4LZ2 A;  2F6J A;  2F6N A;  4TQN A;  5HEM A;  5HQ7 A;  5AD3 A;  3LQJ A;  4QEU A;  3G0L A;  5IGM A;  4HXK A;  4QSR A;  2DKW A;  3UVW A;  4BJX A;  4NR6 A;  3U5L A;  5EV9 A;  5EWV A;  4CUP A;  5IGK A;  5FDZ A;  5HRV A;  5EQ1 A;  5A83 A;  5CY9 A;  5D7X A;  4ZW1 A;  3HME A;  4Z1S A;  5A5Q A;  3U5N A;  5C8G A;  4LYW A;  5HCL A;  5FE2 A;  5CUG A;  2LSP B;  4LYI A;  5ENG A;  4J1P A;  4N4I A;  2R0Y A;  4NQM A;  5DLZ A;  4NR5 A;  5HRX A;  4TTE A;  2OSS A;  3QZV A;  5FH6 A;  4YAD A;  4NR8 A;  5EK9 A;  3P5O A;  5C87 A;  5D3J A;  4YBS A;  4QSV A;  5EWH A;  5C7N A;  5I80 A;  3UV5 A;  4HBX A;  4O78 A;  5KTX A;  2RI7 A;  5K29 A;  2GRC A;  4N3W A;  5EPR A;  3AQA A;  5FG4 A;  2FSA A;  1WUM A;  4TZ2 A;  5IBN A;  4J3I A;  5C85 A;  5D0C A;  5E9L A;  5TB6 A;  3LJW A;  5AME A;  4C66 A;  4QYL A;  2I7K A;  5IGL A;  5FH7 A;  4YY6 A;  5F62 A;  4YYM A;  5KU3 A;  5E9M A;  3U5M A;  4UYD A;  4TT4 A;  4YC9 A;  1JM4 B;  3JVJ A;  4TYL A;  5HFR A;  4QC3 A;  5ENB A;  4IR5 A;  3O36 A;  5EIS A;  4UIX A;  3U5P A;  4QSX A;  2DVS A;  5F2P A;  5JWM A;  4PKL A;  2RNW A;  2L5E A;  5A82 A;  5ENF A;  5ENC A;  5FE7 A;  3I3J A;  2KTB B;  5CQ6 A;  5LKZ A;  5E3G A;  4Q0O A;  4DON A;  4PCI A;  5HEL A;  4QR3 A;  5CQT A;  2RS9 B;  5DKD A;  2D9E A;  5HEN A;  5L96 A;  4O72 A;  4HXR A;  5D3H A;  4TS8 A;  4QST A;  5CGP A;  5FBX A;  4Y03 A;  4A9L A;  5BT3 A;  5I7Y A;  3GG3 A;  2R10 A;  3K2J A;  5A5R A;  4YY4 A;  5AD2 A;  5CZG A;  4NXJ A;  4TT2 A;  4NUC A;  3NXB A;  4HXO A;  5H1U A;  4O7A A;  4O7C A;  5COI A;  5A85 A;  1WUG A;  4HBW A;  4NYW A;  5DFC A;  5BT4 A;  3MB4 A;  5EI4 A;  5E9Y A;  4O7B A;  5D3L A;  2I8N A;  3AAD A;  4NUD A;  3U5O A;  4E96 A;  5F25 A;  5A7C A;  5ENH A;  5EWW A;  3FKM X;  4F3I A;  3SVH A;  3UVX A;  4O7E A;  5E9V A;  5CUA A;  4BW3 A;  2N9G A;  4AKN A;  4BW2 A;  2YYN A;  5L98 A;  4UIY A;  4IR4 A;  5FE4 A;  5EU1 A;  3P1C A;  4HBY A;  5F1H A;  4UIT A;  4O76 A;  4YH4 A;  4QB3 A;  4YYK A;  5C89 A;  4FLP A;  5L97 A;  5HFQ A;  4YYD A;  4PTB A;  3UV4 A;  4LDF A;  5KTU A;  2RO1 A;  5CQ3 A;  5LKT A;  5DYX A;  5DFB A;  2YDW A;  4UYG A;  4A9M A;  5E9I A;  5FH8 A;  4PY6 A;  5A5N A;  4MR6 A;  4HBV A;  5IID A;  4YYI A;  5I29 A;  4J0R A;  5I89 A;  5HLS A;  3P1F A;  4XY9 A;  4NRA A;  5A5S A;  5HRW A;  3SVG A;  2YEK A;  5L99 A;  2YEM A;  4Z6H A;  5I86 A;  5D3T A;  4BW4 A;  4LYS A;  4IOO A;  4YH3 A;  4YAT A;  4QY4 A;  4IOQ A;  3O33 A;  5EWC A;  4NR4 A;  4A9E A;  4C67 A;  5CQA A;  5A81 A;  4CLB A;  4CUU A;  3O34 A;  4J0S A;  4OGI A;  3ZYU A;  4YBT A;  5LVQ A;  5FG5 A;  4HXL A;  3P1D A;  5FE6 A;  4Q0N A;  4XYA A;  4NRC A;  1JSP B;  4UYF A;  4UYH A;  4TU6 A;  4CL9 A;  4IOR A;  4CUQ A;  4WIV A;  4OUF A;  5LJ1 A;  5CUC A;  3DWY A;  5H1V A;  5HJC A;  2E7O A;  5E73 A;  5DYU A;  4UIW A;  4QSQ A;  5D25 A;  4XY8 A;  5EGU A;  5G4S A;  4N4F A;  4WHW A;  5D24 A;  4BW1 A;  4HXN A;  4YBM A;  3U5K A;  1ZS5 A;  4TU4 A;  4YAX A;  4PS5 A;  5CRZ A;  5E9K A;  4A9N A;  5ETB A;  5I40 A;  5DYC A;  5CUE A;  5F36 A;  5EP7 A;  2R0V A;  1E6I A;  4NYX A;  4UIV A;  5EPB A;  4QUU A;  3MQM A;  5HQ5 A;  4KV4 A;  3MB3 A;  4CFK A;  5LJ0 A;  4QZS A;  3JVM A;  5FFY A;  2NXB A;  3DAI A;  3RCW A;  4Z6I A;  5CRM A;  4QEV A;  4QR5 A;  4MEN A;  5G4R A;  4MR3 A;  2DWW A;  3TLP A;  4LRG A;  3UW9 A;  3U5J A;  5CQ4 A;  5FB1 A;  5CQ7 A;  4BHW A;  4CUT A;  4ALH A;  5ACY A;  5I88 A;  4MEQ A;  2G4A A;  4XUB A;  4A9J A;  3LQH A;  3ONI A;  4YYJ A;  5FE9 A;  5CUD A;  5FE1 A;  5BT5 A;  3Q2E A;  4Z93 A;  4O7F A;  5CQ5 A;  3JVL A;  4CUS A;  4HXP A;  3HMF A;  3P1E A;  4MR5 A;  5DFD A;  4YYH A;  5LKX A;  3O35 A;  4A9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...