4PY6A

Crystal structure of bromodomain of pfa0510w from plasmodium falciparum
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
ENSNKRLLKQWEKILRDNVLKLLKNDNNAFYFKTPVLEDININDNIKEEYRIKIKKPMDYITISRNLSDGIYKEPIDFYHDMKLIYKNCIDFNPDIEENKYIIEAAKSSDMKFEFLWNKWKEKINNNFCDLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain protein, putative
publication title Crystal Structure of bromodomain of PFA0510w from Plasmodium Falciparum
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Protein binding
total genus 40
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4py6A00
4N4IA 3UV5A 4Z6HA 4QSPA 5IGNA 4Z93A 3GG3A 2RNWA 4BW2A 4YAXA 4CFLA 4J1PA 5ETBA 5E0RA 4HBXA 4UYDA 5KTXA 4C66A 4N4HA 4YYHA 5CTLA 5C89A 2GRCA 5H1VA 5J0DA 4QYDA 4O77A 5EPRA 3UVDA 5D25A 5KO4A 5CUBA 4NYXA 5L96A 3SVHA 4TT6A 3AQAA 5DKDA 4QR4A 3TLPA 5A5PA 5D3NA 5JI8A 5LKTA 5FFVA 3UV2A 4HBWA 4O7AA 5FE9A 5FB0A 4NR5A 5E3DA 5CGPA 3HMEA 5CZGA 4NRBA 5ENEA 5FE7A 5CFWA 5E3GA 5FE0A 4HBVA 4A9HA 4XY8A 5K29A 1JSPB 4BW1A 5HFQA 5FE8A 4NUCA 5E74A 5DLXA 5TCMA 4UITA 1WUMA 4UIWA 5D24A 4BW3A 4TZ2A 5L97A 5D3TA 3U5OA 4CUQA 4A9KA 3JVLA 5CQ6A 3ONIA 5DKCA 4NR9A 4QSRA 3QZTA 3UV4A 4UYGA 4NQMA 4YYNA 5HM0A 4YBTA 4Q0OA 3IU6A 4NR8A 5DYXA 5F1LA 4O75A 5EICA 5F1HA 2FSAA 3MQMA 5I7YA 4MR6A 4A9IA 4IOOA 4BW4A 4MEOA 5FB1A 4A9LA 4QSSA 3S91A 5I80A 5F3AA 4UIYA 4YH4A 4F3IA 5EQ1A 3U5KA 3SVGA 4IOQA 5LJ0A 5D0CA 5D3LA 2RI7A 3Q2EA 5D7XA 4TZ8A 4Y03A 2DVSA 4YABA 4QEVA 5E9LA 5CUAA 1EQFA 4TU4A 5EPBA 5CQ3A 4O7CA 5CP5A 5JWMA 4CFKA 4QR5A 5CY9A 5EWHA 5TB6A 5BT4A 4HXOA 4MR5A 4LDFA 4A9FA 4TYLA 5I1QA 2E7OA 4UIVA 4PS5A 5E7DA 4TTEA 4QSVA 4Q0NA 2DATA 5IBNA 5EGUA 3O35A 5EWDA 2RFJA 5HLSA 5AMEA 3K2JA 4WHWA 5E73A 4UYFB 4YADA 5HRWA 4PY6A 2E3KA 5F25A 4HXKA 4TT4A 1N72A 3U5NA 5DBMA 5I83A 2YQDA 5E9IA 3NXBA 3D7CA 4YYIA 4YH3A 4YATA 5FG6A 4QSTA 4CUSA 4AKNA 5AD2A 5LUUA 4YYMA 4BJXA 4LYSA 4CUPA 4QNSA 4YC9A 5E9KA 4OGIA 4MR4A 2D9EA 5IG6A 5FFWA 5ENJA 5CQ5A 4QSUA 5DFCA 4A9EA 4CUUA 4MEPA 4CURA 2KTBB 5DKHA 1E6IA 3JVKA 5ENCA 5BT5A 4IR6A 4XUBA 5L8UA 2L5EA 5I29A 5DFDA 4LRGA 3U5MA 5LVRA 5F5ZA 2DVVA 4MENA 5F36A 5KTUA 5CQ7A 5ENIA 5A83A 4IORA 4KV1A 3QZVA 4NS5A 5FG5A 5AD3A 5F62A 2F6JA 3SVFA 5LKZA 4NYWA 4LC2A 5E9VA 2R10A 2DVQA 5H1UA 4QEUA 2OUOA 5CQ4A 5L8TA 3U5LA 5HEMA 3P1DA 2YYNA 2DKWA 4N4FA 5DYAA 5FE3A 5HQ7A 3LQIA 2H60A 3O37A 5EPSA 5ETDA 2I7KA 3UVWA 2YW5A 3MB3A 4KV4A 5EK9A 2OO1A 4O72A 5A5OA 4HXNA 2G4AA 4NXJA 4TS8A 4WHUA 5HELA 4Z1SA 5CUCA 3UVXA 5FG4A 4PKLA 5G4SA 4LYWA 5FBXA 4TQNA 5LJ2A 5KTWA 4IR3A 4YYDA 5C87A 2LSPB 3Q2FA 4J0RA 4O78A 4BHWA 5CQTA 5HENA 3DAIA 4UIXA 5EWWA 2NXBA 3RCWA 5CPEA 5KHMA 5HRVA 5DW2A 5D3PA 3MULA 5EI4A 4YY4A 5A85A 4QBMA 5DFBA 5HRXA 5L98A 2RO1A 5A82A 2MJVB 4DONA 4XUAA 5F60A 4ALHA 5ENFA 5D26A 5HJCA 4TT2A 4QSQA 4NRAA 4HXLA 4J0SA 5II2A 1X0JA 1JM4B 5C8GA 5E9YA 4QC1A 5A5SA 4UYHA 5CU8A 2DWWA 5DY7A 5CUEA 4PTBA 2F6NA 5LKUA 5G4RA 5AMFA 4QUUA 4O76A 4ZW1A 4NR4A 5EWVA 4X2IA 3HMHA 3O33A 4N4GA 2YELA 5IGKA 4QC3A 3IU5A 4YYGA 4OGJA 3P1FA 5LKXA 5HQ5A 5CS8A 5FFYA 4CUTA 3AADA 4YYKA 4O70A 4MR3A 5CUDA 4A9JA 3O36A 3LXJA 4XYAA 4HXPA 3P5OA 5F61A 4OUFA 5FH6A 5DYUA 5FE4A 4LZRA 4Z1QA 5FE2A 5FH8A 4UIUA 4QEWA 4IR5A 4UYEA 5H1TA 4NRCA 5BT3A 5F2PA 3LJWA 5D3RA 4NUEA 5EU1A 3G0LA 5D3HA 2N9GA 3HMFA 5FDZA 1F68A 5A5NA 4WIVA 5C85A 5C7NA 4CL9A 3UVYA 5CRZA 3UW9A 3P1EA 5IGLA 4ZC9A 4FLPA 2D82A 4YK0A 4J3IA 3U5JA 4TU6A 3FKMX 4YYJA 4NR6A 3P1CA 5II1A 5IIDA 3JVJA 4QSXA 2L85A 4QUTA 5CQ8A 2E7NA 4O71A 3DWYA 3G0JA 5LVQA 5DX4A 4XY9A 5EVAA 2WP1A 5LJ1A 2YEKA 2YEMA 5COIA 2I8NA 5CQAA 3MXFA 5FH7A 5A81A 5ENHA 5DW1A 4QSWA 5FE5A 3U5PA 5HQ6A 5E9MA 4HBYA 5CRMA 2OSSA 3LQHA 4LYIA 5EV9A 4O7FA 4RVRA 5D3SA 4UYFA 5ENGA 4LR6A 4YBMA 1ZS5A 5A5QA 4ALGA 5I40A 4O7EA 5I86A 4NYVA 5KU3A 5I89A 2DVRA 5EP7A 3QZSA 4HXRA 2RNXA 4YY6A 2RS9B 5EM3A 3S92A 4QYLA 5EISA 5A7CA 5I88A 5F63A 5ENBA 5C4QA 5ACYA 4A9NA 3LQJA 2R0VA 4PCEA 1WUGA 4E96A 2R0YA 4HXMA 4IR4A 4O7BA 3MUKA 2R0SA 4QR3A 4Z6IA 3MB4A 4GPJA 4NQNA 5D3JA 5EA1A 4A9OA 5EWCA 5FE1A 4N3WA 4LZ2A 4QY4A 3I3JA 4O74A 5HFRA 3JVMA 5I7XA 4KCXA 2L84A 5HCLA 4QB3A 5IGMA 4UIZA 4NUDA 4A9MA 5DYCA 4PCIA 4HXSA 5FE6A 3ZYUA 5L99A 2YDWA 4LZSA 5A5RA 4YBSA 5DLZA 4MEQA 4NR7A 5H85A 4CLBA 3O34A 4QZSA 2RNYA 4ZQLA 2WP2A 5CUGA 4C67A
chains in the Genus database with same CATH superfamily
4N4IA 3UV5A 4Z6HA 4QSPA 5IGNA 4Z93A 3GG3A 2RNWA 4BW2A 4YAXA 4CFLA 4J1PA 5ETBA 5E0RA 4HBXA 2EJNA 4UYDA 5KTXA 4C66A 4N4HA 4YYHA 5CTLA 5C89A 2GRCA 5H1VA 5J0DA 4QYDA 4O77A 5EPRA 3UVDA 5D25A 5KO4A 5CUBA 4NYXA 5L96A 3SVHA 4TT6A 3AQAA 5DKDA 4QR4A 3TLPA 5A5PA 5D3NA 5JI8A 5LKTA 5FFVA 3UV2A 4HBWA 4O7AA 5FE9A 5FB0A 4NR5A 5E3DA 5CGPA 3HMEA 5CZGA 4NRBA 5ENEA 5FE7A 5CFWA 5E3GA 5FE0A 4HBVA 4A9HA 4XY8A 5K29A 1JSPB 4BW1A 5HFQA 5FE8A 4NUCA 5E74A 5DLXA 5TCMA 4UITA 1WUMA 4UIWA 5D24A 4BW3A 4TZ2A 5L97A 5D3TA 3U5OA 4CUQA 4A9KA 3JVLA 5CQ6A 3ONIA 5DKCA 4NR9A 4QSRA 3QZTA 3UV4A 4UYGA 4AKIA 4NQMA 4YYNA 5HM0A 4YBTA 4Q0OA 3IU6A 4NR8A 5DYXA 5F1LA 4O75A 5EICA 5F1HA 2FSAA 3MQMA 5I7YA 4MR6A 4A9IA 4IOOA 3ERRA 4BW4A 4MEOA 5FB1A 4A9LA 1ZKRA 4QSSA 3S91A 5I80A 5F3AA 4UIYA 4YH4A 4F3IA 5EQ1A 3U5KA 3SVGA 4IOQA 5LJ0A 5D0CA 5D3LA 2RI7A 3Q2EA 5D7XA 4TZ8A 4Y03A 2DVSA 4YABA 4QEVA 5E9LA 5CUAA 1EQFA 4TU4A 5EPBA 4AKHA 5CQ3A 4O7CA 5CP5A 5JWMA 4CFKA 4QR5A 5CY9A 5EWHA 5TB6A 5BT4A 4HXOA 4MR5A 4LDFA 4A9FA 4TYLA 5I1QA 2E7OA 4UIVA 4PS5A 5E7DA 4AKGA 4TTEA 4QSVA 4Q0NA 2DATA 5IBNA 5EGUA 3O35A 5EWDA 2RFJA 5HLSA 5AMEA 3K2JA 4WHWA 5E73A 4UYFB 4YADA 3D1DA 5HRWA 4PY6A 2E3KA 5F25A 4HXKA 4TT4A 1N72A 3U5NA 5DBMA 5I83A 2YQDA 5E9IA 3NXBA 3D7CA 4YYIA 4YH3A 4YATA 5FG6A 4QSTA 4CUSA 4AKNA 5AD2A 5LUUA 3VKGA 4YYMA 4BJXA 4LYSA 4CUPA 4QNSA 4YC9A 5E9KA 4OGIA 4MR4A 2D9EA 5IG6A 5FFWA 5ENJA 5CQ5A 4QSUA 5DFCA 4A9EA 4CUUA 4MEPA 4CURA 2KTBB 5DKHA 1E6IA 3JVKA 5ENCA 5BT5A 4IR6A 4XUBA 5L8UA 2L5EA 5I29A 5DFDA 4LRGA 3U5MA 5LVRA 3VKHA 5F5ZA 2DVVA 4MENA 5F36A 5KTUA 5CQ7A 5ENIA 5A83A 4IORA 4KV1A 3QZVA 4NS5A 5FG5A 5AD3A 5F62A 2F6JA 3SVFA 5LKZA 4NYWA 4LC2A 5E9VA 2R10A 2DVQA 5H1UA 4QEUA 2OUOA 5CQ4A 5L8TA 3U5LA 5HEMA 3P1DA 2YYNA 2DKWA 4N4FA 5DYAA 5FE3A 5HQ7A 3LQIA 2H60A 3O37A 5EPSA 5ETDA 2I7KA 3UVWA 2YW5A 3MB3A 4KV4A 5EK9A 2OO1A 4O72A 5A5OA 4HXNA 2G4AA 4NXJA 4TS8A 4WHUA 5HELA 4Z1SA 5CUCA 3UVXA 5FG4A 4PKLA 5G4SA 4LYWA 5FBXA 4TQNA 5LJ2A 5KTWA 4IR3A 4YYDA 5C87A 2LSPB 3Q2FA 4J0RA 4O78A 4BHWA 5CQTA 5HENA 3DAIA 4UIXA 5EWWA 2NXBA 3RCWA 5CPEA 5KHMA 5HRVA 5DW2A 5D3PA 3MULA 5EI4A 4YY4A 5A85A 4QBMA 5DFBA 5HRXA 5L98A 2RO1A 5A82A 3D1BA 2MJVB 4DONA 4XUAA 5F60A 4ALHA 5ENFA 5D26A 5HJCA 4TT2A 4QSQA 4NRAA 4HXLA 4J0SA 5II2A 1X0JA 1JM4B 1PUOA 5C8GA 5E9YA 4QC1A 5A5SA 4UYHA 5CU8A 2DWWA 5DY7A 5CUEA 4PTBA 2F6NA 5LKUA 5G4RA 5AMFA 4QUUA 4O76A 4ZW1A 4NR4A 5EWVA 4X2IA 3HMHA 3O33A 4N4GA 2YELA 5IGKA 4QC3A 3IU5A 4YYGA 4OGJA 3P1FA 5LKXA 5HQ5A 5CS8A 5FFYA 4CUTA 3AADA 4YYKA 4O70A 4MR3A 5CUDA 4A9JA 3O36A 3LXJA 4XYAA 4HXPA 3P5OA 5F61A 4OUFA 5FH6A 5DYUA 5FE4A 4LZRA 4Z1QA 5FE2A 5FH8A 4UIUA 4QEWA 4IR5A 4UYEA 5H1TA 4NRCA 5BT3A 5F2PA 3LJWA 5D3RA 4NUEA 5EU1A 3G0LA 5D3HA 2N9GA 3HMFA 5FDZA 1F68A 5A5NA 4WIVA 5C85A 5C7NA 4CL9A 3UVYA 5CRZA 3UW9A 3P1EA 5IGLA 4ZC9A 4FLPA 2D82A 4YK0A 4J3IA 3U5JA 4TU6A 3FKMX 4YYJA 4NR6A 3P1CA 5II1A 5IIDA 3JVJA 4QSXA 2L85A 4QUTA 5CQ8A 2E7NA 4O71A 3DWYA 3G0JA 5LVQA 5DX4A 4XY9A 5EVAA 2WP1A 5LJ1A 2YEKA 2YEMA 5COIA 2I8NA 5CQAA 3MXFA 5FH7A 5A81A 5ENHA 5DW1A 4QSWA 5FE5A 3U5PA 5HQ6A 5E9MA 4HBYA 5CRMA 2OSSA 3LQHA 4LYIA 5EV9A 4O7FA 4RVRA 5D3SA 4UYFA 5ENGA 4LR6A 4YBMA 1ZS5A 5A5QA 4ALGA 5I40A 4O7EA 5I86A 4NYVA 5KU3A 5I89A 2DVRA 5EP7A 3QZSA 4HXRA 2RNXA 4YY6A 2RS9B 5EM3A 3S92A 4QYLA 5EISA 5A7CA 5I88A 5F63A 5ENBA 5C4QA 5ACYA 4A9NA 3LQJA 2R0VA 4PCEA 1WUGA 4E96A 2R0YA 4HXMA 4IR4A 4O7BA 3MUKA 2R0SA 4QR3A 4Z6IA 3MB4A 4GPJA 4NQNA 5D3JA 5EA1A 4A9OA 5EWCA 5FE1A 4N3WA 4LZ2A 4QY4A 3I3JA 4O74A 5HFRA 3JVMA 5I7XA 4KCXA 2L84A 5HCLA 4QB3A 5IGMA 4UIZA 4NUDA 4A9MA 5DYCA 4PCIA 4HXSA 5FE6A 3ZYUA 5L99A 2YDWA 4LZSA 5A5RA 4YBSA 5DLZA 4MEQA 4NR7A 5H85A 4CLBA 3O34A 4AI6A 4QZSA 2RNYA 4ZQLA 2WP2A 5CUGA 4C67A
chains in the Genus database with same CATH topology
4N4IA 3UV5A 4Z6HA 4QSPA 5IGNA 4Z93A 3GG3A 2RNWA 4BW2A 4YAXA 4CFLA 4J1PA 5ETBA 5E0RA 4HBXA 4UYDA 5KTXA 4C66A 4N4HA 4YYHA 5CTLA 5C89A 2GRCA 5H1VA 5J0DA 4QYDA 4O77A 5EPRA 3UVDA 5D25A 5KO4A 5CUBA 4NYXA 5L96A 3SVHA 4TT6A 3AQAA 5DKDA 4QR4A 3TLPA 5A5PA 5D3NA 5JI8A 5LKTA 5FFVA 3UV2A 4HBWA 4O7AA 5FE9A 5FB0A 4NR5A 5E3DA 5CGPA 3HMEA 5CZGA 4NRBA 5ENEA 5FE7A 5CFWA 5E3GA 5FE0A 4HBVA 4A9HA 4XY8A 5K29A 1JSPB 4BW1A 5HFQA 5FE8A 4NUCA 5E74A 5DLXA 5TCMA 4UITA 1WUMA 4UIWA 5D24A 4BW3A 4TZ2A 5L97A 5D3TA 3U5OA 4CUQA 4A9KA 3JVLA 5CQ6A 3ONIA 5DKCA 4NR9A 4QSRA 3QZTA 3UV4A 4UYGA 4NQMA 4YYNA 5HM0A 4YBTA 4Q0OA 3IU6A 4NR8A 5DYXA 5F1LA 4O75A 5EICA 5F1HA 2FSAA 3MQMA 5I7YA 4MR6A 4A9IA 4IOOA 4BW4A 4MEOA 5FB1A 4A9LA 4QSSA 3S91A 5I80A 5F3AA 4UIYA 4YH4A 4F3IA 5EQ1A 3U5KA 3SVGA 4IOQA 5LJ0A 5D0CA 5D3LA 2RI7A 3Q2EA 5D7XA 4TZ8A 4Y03A 2DVSA 4YABA 4QEVA 5E9LA 5CUAA 1EQFA 4TU4A 5EPBA 5CQ3A 4O7CA 5CP5A 5JWMA 4CFKA 4QR5A 5CY9A 5EWHA 5TB6A 5BT4A 4HXOA 4MR5A 4LDFA 4A9FA 4TYLA 5I1QA 2E7OA 4UIVA 4PS5A 5E7DA 4TTEA 4QSVA 4Q0NA 2DATA 5IBNA 5EGUA 3O35A 5EWDA 2RFJA 5HLSA 5AMEA 3K2JA 4WHWA 5E73A 4UYFB 4YADA 5HRWA 4PY6A 2E3KA 5F25A 4HXKA 4TT4A 1N72A 3U5NA 5DBMA 5I83A 2YQDA 5E9IA 3NXBA 3D7CA 4YYIA 4YH3A 4YATA 5FG6A 4QSTA 4CUSA 4AKNA 5AD2A 5LUUA 4YYMA 4BJXA 4LYSA 4CUPA 4QNSA 4YC9A 5E9KA 4OGIA 4MR4A 2D9EA 5IG6A 5FFWA 5ENJA 5CQ5A 4QSUA 5DFCA 4A9EA 4CUUA 4MEPA 4CURA 2KTBB 5DKHA 1E6IA 3JVKA 5ENCA 5BT5A 4IR6A 4XUBA 5L8UA 2L5EA 5I29A 5DFDA 4LRGA 3U5MA 5LVRA 5F5ZA 2DVVA 4MENA 5F36A 5KTUA 5CQ7A 5ENIA 5A83A 4IORA 4KV1A 3QZVA 4NS5A 5FG5A 5AD3A 5F62A 2F6JA 3SVFA 5LKZA 4NYWA 4LC2A 5E9VA 2R10A 2DVQA 5H1UA 4QEUA 2OUOA 5CQ4A 5L8TA 3U5LA 5HEMA 3P1DA 2YYNA 2DKWA 4N4FA 5DYAA 5FE3A 5HQ7A 3LQIA 2H60A 3O37A 5EPSA 5ETDA 2I7KA 3UVWA 2YW5A 3MB3A 4KV4A 5EK9A 2OO1A 4O72A 5A5OA 4HXNA 2G4AA 4NXJA 4TS8A 4WHUA 5HELA 4Z1SA 5CUCA 3UVXA 5FG4A 4PKLA 5G4SA 4LYWA 5FBXA 4TQNA 5LJ2A 5KTWA 4IR3A 4YYDA 5C87A 2LSPB 3Q2FA 4J0RA 4O78A 4BHWA 5CQTA 5HENA 3DAIA 4UIXA 5EWWA 2NXBA 3RCWA 5CPEA 5KHMA 5HRVA 5DW2A 5D3PA 3MULA 5EI4A 4YY4A 5A85A 4QBMA 5DFBA 5HRXA 5L98A 2RO1A 5A82A 2MJVB 4DONA 4XUAA 5F60A 4ALHA 5ENFA 5D26A 5HJCA 4TT2A 4QSQA 4NRAA 4HXLA 4J0SA 5II2A 1X0JA 1JM4B 5C8GA 5E9YA 4QC1A 5A5SA 4UYHA 5CU8A 2DWWA 5DY7A 5CUEA 4PTBA 2F6NA 5LKUA 5G4RA 5AMFA 4QUUA 4O76A 4ZW1A 4NR4A 5EWVA 4X2IA 3HMHA 3O33A 4N4GA 2YELA 5IGKA 4QC3A 3IU5A 4YYGA 4OGJA 3P1FA 5LKXA 5HQ5A 5CS8A 5FFYA 4CUTA 3AADA 4YYKA 4O70A 4MR3A 5CUDA 4A9JA 3O36A 3LXJA 4XYAA 4HXPA 3P5OA 5F61A 4OUFA 5FH6A 5DYUA 5FE4A 4LZRA 4Z1QA 5FE2A 5FH8A 4UIUA 4QEWA 4IR5A 4UYEA 5H1TA 4NRCA 5BT3A 5F2PA 3LJWA 5D3RA 4NUEA 5EU1A 3G0LA 5D3HA 2N9GA 3HMFA 5FDZA 1F68A 5A5NA 4WIVA 5C85A 5C7NA 4CL9A 3UVYA 5CRZA 3UW9A 3P1EA 5IGLA 4ZC9A 4FLPA 2D82A 4YK0A 4J3IA 3U5JA 4TU6A 3FKMX 4YYJA 4NR6A 3P1CA 5II1A 5IIDA 3JVJA 4QSXA 2L85A 4QUTA 5CQ8A 2E7NA 4O71A 3DWYA 3G0JA 5LVQA 5DX4A 4XY9A 5EVAA 2WP1A 5LJ1A 2YEKA 2YEMA 5COIA 2I8NA 5CQAA 3MXFA 5FH7A 5A81A 5ENHA 5DW1A 4QSWA 5FE5A 3U5PA 5HQ6A 5E9MA 4HBYA 5CRMA 2OSSA 3LQHA 4LYIA 5EV9A 4O7FA 4RVRA 5D3SA 4UYFA 5ENGA 4LR6A 4YBMA 1ZS5A 5A5QA 4ALGA 5I40A 4O7EA 5I86A 4NYVA 5KU3A 5I89A 2DVRA 5EP7A 3QZSA 4HXRA 2RNXA 4YY6A 2RS9B 5EM3A 3S92A 4QYLA 5EISA 5A7CA 5I88A 5F63A 5ENBA 5C4QA 5ACYA 4A9NA 3LQJA 2R0VA 4PCEA 1WUGA 4E96A 2R0YA 4HXMA 4IR4A 4O7BA 3MUKA 2R0SA 4QR3A 4Z6IA 3MB4A 4GPJA 4NQNA 5D3JA 5EA1A 4A9OA 5EWCA 5FE1A 4N3WA 4LZ2A 4QY4A 3I3JA 4O74A 5HFRA 3JVMA 5I7XA 4KCXA 2L84A 5HCLA 4QB3A 5IGMA 4UIZA 4NUDA 4A9MA 5DYCA 4PCIA 4HXSA 5FE6A 3ZYUA 5L99A 2YDWA 4LZSA 5A5RA 4YBSA 5DLZA 4MEQA 4NR7A 5H85A 4CLBA 3O34A 4QZSA 2RNYA 4ZQLA 2WP2A 5CUGA 4C67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4I A;  3UV5 A;  4Z6H A;  4QSP A;  5IGN A;  4Z93 A;  3GG3 A;  2RNW A;  4BW2 A;  4YAX A;  4CFL A;  4J1P A;  5ETB A;  5E0R A;  4HBX A;  4UYD A;  5KTX A;  4C66 A;  4N4H A;  4YYH A;  5CTL A;  5C89 A;  2GRC A;  5H1V A;  5J0D A;  4QYD A;  4O77 A;  5EPR A;  3UVD A;  5D25 A;  5KO4 A;  5CUB A;  4NYX A;  5L96 A;  3SVH A;  4TT6 A;  3AQA A;  5DKD A;  4QR4 A;  3TLP A;  5A5P A;  5D3N A;  5JI8 A;  5LKT A;  5FFV A;  3UV2 A;  4HBW A;  4O7A A;  5FE9 A;  5FB0 A;  4NR5 A;  5E3D A;  5CGP A;  3HME A;  5CZG A;  4NRB A;  5ENE A;  5FE7 A;  5CFW A;  5E3G A;  5FE0 A;  4HBV A;  4A9H A;  4XY8 A;  5K29 A;  1JSP B;  4BW1 A;  5HFQ A;  5FE8 A;  4NUC A;  5E74 A;  5DLX A;  5TCM A;  4UIT A;  1WUM A;  4UIW A;  5D24 A;  4BW3 A;  4TZ2 A;  5L97 A;  5D3T A;  3U5O A;  4CUQ A;  4A9K A;  3JVL A;  5CQ6 A;  3ONI A;  5DKC A;  4NR9 A;  4QSR A;  3QZT A;  3UV4 A;  4UYG A;  4NQM A;  4YYN A;  5HM0 A;  4YBT A;  4Q0O A;  3IU6 A;  4NR8 A;  5DYX A;  5F1L A;  4O75 A;  5EIC A;  5F1H A;  2FSA A;  3MQM A;  5I7Y A;  4MR6 A;  4A9I A;  4IOO A;  4BW4 A;  4MEO A;  5FB1 A;  4A9L A;  4QSS A;  3S91 A;  5I80 A;  5F3A A;  4UIY A;  4YH4 A;  4F3I A;  5EQ1 A;  3U5K A;  3SVG A;  4IOQ A;  5LJ0 A;  5D0C A;  5D3L A;  2RI7 A;  3Q2E A;  5D7X A;  4TZ8 A;  4Y03 A;  2DVS A;  4YAB A;  4QEV A;  5E9L A;  5CUA A;  1EQF A;  4TU4 A;  5EPB A;  5CQ3 A;  4O7C A;  5CP5 A;  5JWM A;  4CFK A;  4QR5 A;  5CY9 A;  5EWH A;  5TB6 A;  5BT4 A;  4HXO A;  4MR5 A;  4LDF A;  4A9F A;  4TYL A;  5I1Q A;  2E7O A;  4UIV A;  4PS5 A;  5E7D A;  4TTE A;  4QSV A;  4Q0N A;  2DAT A;  5IBN A;  5EGU A;  3O35 A;  5EWD A;  2RFJ A;  5HLS A;  5AME A;  3K2J A;  4WHW A;  5E73 A;  4UYF B;  4YAD A;  5HRW A;  4PY6 A;  2E3K A;  5F25 A;  4HXK A;  4TT4 A;  1N72 A;  3U5N A;  5DBM A;  5I83 A;  2YQD A;  5E9I A;  3NXB A;  3D7C A;  4YYI A;  4YH3 A;  4YAT A;  5FG6 A;  4QST A;  4CUS A;  4AKN A;  5AD2 A;  5LUU A;  4YYM A;  4BJX A;  4LYS A;  4CUP A;  4QNS A;  4YC9 A;  5E9K A;  4OGI A;  4MR4 A;  2D9E A;  5IG6 A;  5FFW A;  5ENJ A;  5CQ5 A;  4QSU A;  5DFC A;  4A9E A;  4CUU A;  4MEP A;  4CUR A;  2KTB B;  5DKH A;  1E6I A;  3JVK A;  5ENC A;  5BT5 A;  4IR6 A;  4XUB A;  5L8U A;  2L5E A;  5I29 A;  5DFD A;  4LRG A;  3U5M A;  5LVR A;  5F5Z A;  2DVV A;  4MEN A;  5F36 A;  5KTU A;  5CQ7 A;  5ENI A;  5A83 A;  4IOR A;  4KV1 A;  3QZV A;  4NS5 A;  5FG5 A;  5AD3 A;  5F62 A;  2F6J A;  3SVF A;  5LKZ A;  4NYW A;  4LC2 A;  5E9V A;  2R10 A;  2DVQ A;  5H1U A;  4QEU A;  2OUO A;  5CQ4 A;  5L8T A;  3U5L A;  5HEM A;  3P1D A;  2YYN A;  2DKW A;  4N4F A;  5DYA A;  5FE3 A;  5HQ7 A;  3LQI A;  2H60 A;  3O37 A;  5EPS A;  5ETD A;  2I7K A;  3UVW A;  2YW5 A;  3MB3 A;  4KV4 A;  5EK9 A;  2OO1 A;  4O72 A;  5A5O A;  4HXN A;  2G4A A;  4NXJ A;  4TS8 A;  4WHU A;  5HEL A;  4Z1S A;  5CUC A;  3UVX A;  5FG4 A;  4PKL A;  5G4S A;  4LYW A;  5FBX A;  4TQN A;  5LJ2 A;  5KTW A;  4IR3 A;  4YYD A;  5C87 A;  2LSP B;  3Q2F A;  4J0R A;  4O78 A;  4BHW A;  5CQT A;  5HEN A;  3DAI A;  4UIX A;  5EWW A;  2NXB A;  3RCW A;  5CPE A;  5KHM A;  5HRV A;  5DW2 A;  5D3P A;  3MUL A;  5EI4 A;  4YY4 A;  5A85 A;  4QBM A;  5DFB A;  5HRX A;  5L98 A;  2RO1 A;  5A82 A;  2MJV B;  4DON A;  4XUA A;  5F60 A;  4ALH A;  5ENF A;  5D26 A;  5HJC A;  4TT2 A;  4QSQ A;  4NRA A;  4HXL A;  4J0S A;  5II2 A;  1X0J A;  1JM4 B;  5C8G A;  5E9Y A;  4QC1 A;  5A5S A;  4UYH A;  5CU8 A;  2DWW A;  5DY7 A;  5CUE A;  4PTB A;  2F6N A;  5LKU A;  5G4R A;  5AMF A;  4QUU A;  4O76 A;  4ZW1 A;  4NR4 A;  5EWV A;  4X2I A;  3HMH A;  3O33 A;  4N4G A;  2YEL A;  5IGK A;  4QC3 A;  3IU5 A;  4YYG A;  4OGJ A;  3P1F A;  5LKX A;  5HQ5 A;  5CS8 A;  5FFY A;  4CUT A;  3AAD A;  4YYK A;  4O70 A;  4MR3 A;  5CUD A;  4A9J A;  3O36 A;  3LXJ A;  4XYA A;  4HXP A;  3P5O A;  5F61 A;  4OUF A;  5FH6 A;  5DYU A;  5FE4 A;  4LZR A;  4Z1Q A;  5FE2 A;  5FH8 A;  4UIU A;  4QEW A;  4IR5 A;  4UYE A;  5H1T A;  4NRC A;  5BT3 A;  5F2P A;  3LJW A;  5D3R A;  4NUE A;  5EU1 A;  3G0L A;  5D3H A;  2N9G A;  3HMF A;  5FDZ A;  1F68 A;  5A5N A;  4WIV A;  5C85 A;  5C7N A;  4CL9 A;  3UVY A;  5CRZ A;  3UW9 A;  3P1E A;  5IGL A;  4ZC9 A;  4FLP A;  2D82 A;  4YK0 A;  4J3I A;  3U5J A;  4TU6 A;  3FKM X;  4YYJ A;  4NR6 A;  3P1C A;  5II1 A;  5IID A;  3JVJ A;  4QSX A;  2L85 A;  4QUT A;  5CQ8 A;  2E7N A;  4O71 A;  3DWY A;  3G0J A;  5LVQ A;  5DX4 A;  4XY9 A;  5EVA A;  2WP1 A;  5LJ1 A;  2YEK A;  2YEM A;  5COI A;  2I8N A;  5CQA A;  3MXF A;  5FH7 A;  5A81 A;  5ENH A;  5DW1 A;  4QSW A;  5FE5 A;  3U5P A;  5HQ6 A;  5E9M A;  4HBY A;  5CRM A;  2OSS A;  3LQH A;  4LYI A;  5EV9 A;  4O7F A;  4RVR A;  5D3S A;  4UYF A;  5ENG A;  4LR6 A;  4YBM A;  1ZS5 A;  5A5Q A;  4ALG A;  5I40 A;  4O7E A;  5I86 A;  4NYV A;  5KU3 A;  5I89 A;  2DVR A;  5EP7 A;  3QZS A;  4HXR A;  2RNX A;  4YY6 A;  2RS9 B;  5EM3 A;  3S92 A;  4QYL A;  5EIS A;  5A7C A;  5I88 A;  5F63 A;  5ENB A;  5C4Q A;  5ACY A;  4A9N A;  3LQJ A;  2R0V A;  4PCE A;  1WUG A;  4E96 A;  2R0Y A;  4HXM A;  4IR4 A;  4O7B A;  3MUK A;  2R0S A;  4QR3 A;  4Z6I A;  3MB4 A;  4GPJ A;  4NQN A;  5D3J A;  5EA1 A;  4A9O A;  5EWC A;  5FE1 A;  4N3W A;  4LZ2 A;  4QY4 A;  3I3J A;  4O74 A;  5HFR A;  3JVM A;  5I7X A;  4KCX A;  2L84 A;  5HCL A;  4QB3 A;  5IGM A;  4UIZ A;  4NUD A;  4A9M A;  5DYC A;  4PCI A;  4HXS A;  5FE6 A;  3ZYU A;  5L99 A;  2YDW A;  4LZS A;  5A5R A;  4YBS A;  5DLZ A;  4MEQ A;  4NR7 A;  5H85 A;  4CLB A;  3O34 A;  4QZS A;  2RNY A;  4ZQL A;  2WP2 A;  5CUG A;  4C67 A; 
#chains in the Genus database with same CATH topology
 4N4I A;  3UV5 A;  4Z6H A;  4QSP A;  5IGN A;  4Z93 A;  3GG3 A;  2RNW A;  4BW2 A;  4YAX A;  4CFL A;  4J1P A;  5ETB A;  5E0R A;  4HBX A;  2EJN A;  4UYD A;  5KTX A;  4C66 A;  4N4H A;  4YYH A;  5CTL A;  5C89 A;  2GRC A;  5H1V A;  5J0D A;  4QYD A;  4O77 A;  5EPR A;  3UVD A;  5D25 A;  5KO4 A;  5CUB A;  4NYX A;  5L96 A;  3SVH A;  4TT6 A;  3AQA A;  5DKD A;  4QR4 A;  3TLP A;  5A5P A;  5D3N A;  5JI8 A;  5LKT A;  5FFV A;  3UV2 A;  4HBW A;  4O7A A;  5FE9 A;  5FB0 A;  4NR5 A;  5E3D A;  5CGP A;  3HME A;  5CZG A;  4NRB A;  5ENE A;  5FE7 A;  5CFW A;  5E3G A;  5FE0 A;  4HBV A;  4A9H A;  4XY8 A;  5K29 A;  1JSP B;  4BW1 A;  5HFQ A;  5FE8 A;  4NUC A;  5E74 A;  5DLX A;  5TCM A;  4UIT A;  1WUM A;  4UIW A;  5D24 A;  4BW3 A;  4TZ2 A;  5L97 A;  5D3T A;  3U5O A;  4CUQ A;  4A9K A;  3JVL A;  5CQ6 A;  3ONI A;  5DKC A;  4NR9 A;  4QSR A;  3QZT A;  3UV4 A;  4UYG A;  4AKI A;  4NQM A;  4YYN A;  5HM0 A;  4YBT A;  4Q0O A;  3IU6 A;  4NR8 A;  5DYX A;  5F1L A;  4O75 A;  5EIC A;  5F1H A;  2FSA A;  3MQM A;  5I7Y A;  4MR6 A;  4A9I A;  4IOO A;  3ERR A;  4BW4 A;  4MEO A;  5FB1 A;  4A9L A;  1ZKR A;  4QSS A;  3S91 A;  5I80 A;  5F3A A;  4UIY A;  4YH4 A;  4F3I A;  5EQ1 A;  3U5K A;  3SVG A;  4IOQ A;  5LJ0 A;  5D0C A;  5D3L A;  2RI7 A;  3Q2E A;  5D7X A;  4TZ8 A;  4Y03 A;  2DVS A;  4YAB A;  4QEV A;  5E9L A;  5CUA A;  1EQF A;  4TU4 A;  5EPB A;  4AKH A;  5CQ3 A;  4O7C A;  5CP5 A;  5JWM A;  4CFK A;  4QR5 A;  5CY9 A;  5EWH A;  5TB6 A;  5BT4 A;  4HXO A;  4MR5 A;  4LDF A;  4A9F A;  4TYL A;  5I1Q A;  2E7O A;  4UIV A;  4PS5 A;  5E7D A;  4AKG A;  4TTE A;  4QSV A;  4Q0N A;  2DAT A;  5IBN A;  5EGU A;  3O35 A;  5EWD A;  2RFJ A;  5HLS A;  5AME A;  3K2J A;  4WHW A;  5E73 A;  4UYF B;  4YAD A;  3D1D A;  5HRW A;  4PY6 A;  2E3K A;  5F25 A;  4HXK A;  4TT4 A;  1N72 A;  3U5N A;  5DBM A;  5I83 A;  2YQD A;  5E9I A;  3NXB A;  3D7C A;  4YYI A;  4YH3 A;  4YAT A;  5FG6 A;  4QST A;  4CUS A;  4AKN A;  5AD2 A;  5LUU A;  3VKG A;  4YYM A;  4BJX A;  4LYS A;  4CUP A;  4QNS A;  4YC9 A;  5E9K A;  4OGI A;  4MR4 A;  2D9E A;  5IG6 A;  5FFW A;  5ENJ A;  5CQ5 A;  4QSU A;  5DFC A;  4A9E A;  4CUU A;  4MEP A;  4CUR A;  2KTB B;  5DKH A;  1E6I A;  3JVK A;  5ENC A;  5BT5 A;  4IR6 A;  4XUB A;  5L8U A;  2L5E A;  5I29 A;  5DFD A;  4LRG A;  3U5M A;  5LVR A;  3VKH A;  5F5Z A;  2DVV A;  4MEN A;  5F36 A;  5KTU A;  5CQ7 A;  5ENI A;  5A83 A;  4IOR A;  4KV1 A;  3QZV A;  4NS5 A;  5FG5 A;  5AD3 A;  5F62 A;  2F6J A;  3SVF A;  5LKZ A;  4NYW A;  4LC2 A;  5E9V A;  2R10 A;  2DVQ A;  5H1U A;  4QEU A;  2OUO A;  5CQ4 A;  5L8T A;  3U5L A;  5HEM A;  3P1D A;  2YYN A;  2DKW A;  4N4F A;  5DYA A;  5FE3 A;  5HQ7 A;  3LQI A;  2H60 A;  3O37 A;  5EPS A;  5ETD A;  2I7K A;  3UVW A;  2YW5 A;  3MB3 A;  4KV4 A;  5EK9 A;  2OO1 A;  4O72 A;  5A5O A;  4HXN A;  2G4A A;  4NXJ A;  4TS8 A;  4WHU A;  5HEL A;  4Z1S A;  5CUC A;  3UVX A;  5FG4 A;  4PKL A;  5G4S A;  4LYW A;  5FBX A;  4TQN A;  5LJ2 A;  5KTW A;  4IR3 A;  4YYD A;  5C87 A;  2LSP B;  3Q2F A;  4J0R A;  4O78 A;  4BHW A;  5CQT A;  5HEN A;  3DAI A;  4UIX A;  5EWW A;  2NXB A;  3RCW A;  5CPE A;  5KHM A;  5HRV A;  5DW2 A;  5D3P A;  3MUL A;  5EI4 A;  4YY4 A;  5A85 A;  4QBM A;  5DFB A;  5HRX A;  5L98 A;  2RO1 A;  5A82 A;  3D1B A;  2MJV B;  4DON A;  4XUA A;  5F60 A;  4ALH A;  5ENF A;  5D26 A;  5HJC A;  4TT2 A;  4QSQ A;  4NRA A;  4HXL A;  4J0S A;  5II2 A;  1X0J A;  1JM4 B;  1PUO A;  5C8G A;  5E9Y A;  4QC1 A;  5A5S A;  4UYH A;  5CU8 A;  2DWW A;  5DY7 A;  5CUE A;  4PTB A;  2F6N A;  5LKU A;  5G4R A;  5AMF A;  4QUU A;  4O76 A;  4ZW1 A;  4NR4 A;  5EWV A;  4X2I A;  3HMH A;  3O33 A;  4N4G A;  2YEL A;  5IGK A;  4QC3 A;  3IU5 A;  4YYG A;  4OGJ A;  3P1F A;  5LKX A;  5HQ5 A;  5CS8 A;  5FFY A;  4CUT A;  3AAD A;  4YYK A;  4O70 A;  4MR3 A;  5CUD A;  4A9J A;  3O36 A;  3LXJ A;  4XYA A;  4HXP A;  3P5O A;  5F61 A;  4OUF A;  5FH6 A;  5DYU A;  5FE4 A;  4LZR A;  4Z1Q A;  5FE2 A;  5FH8 A;  4UIU A;  4QEW A;  4IR5 A;  4UYE A;  5H1T A;  4NRC A;  5BT3 A;  5F2P A;  3LJW A;  5D3R A;  4NUE A;  5EU1 A;  3G0L A;  5D3H A;  2N9G A;  3HMF A;  5FDZ A;  1F68 A;  5A5N A;  4WIV A;  5C85 A;  5C7N A;  4CL9 A;  3UVY A;  5CRZ A;  3UW9 A;  3P1E A;  5IGL A;  4ZC9 A;  4FLP A;  2D82 A;  4YK0 A;  4J3I A;  3U5J A;  4TU6 A;  3FKM X;  4YYJ A;  4NR6 A;  3P1C A;  5II1 A;  5IID A;  3JVJ A;  4QSX A;  2L85 A;  4QUT A;  5CQ8 A;  2E7N A;  4O71 A;  3DWY A;  3G0J A;  5LVQ A;  5DX4 A;  4XY9 A;  5EVA A;  2WP1 A;  5LJ1 A;  2YEK A;  2YEM A;  5COI A;  2I8N A;  5CQA A;  3MXF A;  5FH7 A;  5A81 A;  5ENH A;  5DW1 A;  4QSW A;  5FE5 A;  3U5P A;  5HQ6 A;  5E9M A;  4HBY A;  5CRM A;  2OSS A;  3LQH A;  4LYI A;  5EV9 A;  4O7F A;  4RVR A;  5D3S A;  4UYF A;  5ENG A;  4LR6 A;  4YBM A;  1ZS5 A;  5A5Q A;  4ALG A;  5I40 A;  4O7E A;  5I86 A;  4NYV A;  5KU3 A;  5I89 A;  2DVR A;  5EP7 A;  3QZS A;  4HXR A;  2RNX A;  4YY6 A;  2RS9 B;  5EM3 A;  3S92 A;  4QYL A;  5EIS A;  5A7C A;  5I88 A;  5F63 A;  5ENB A;  5C4Q A;  5ACY A;  4A9N A;  3LQJ A;  2R0V A;  4PCE A;  1WUG A;  4E96 A;  2R0Y A;  4HXM A;  4IR4 A;  4O7B A;  3MUK A;  2R0S A;  4QR3 A;  4Z6I A;  3MB4 A;  4GPJ A;  4NQN A;  5D3J A;  5EA1 A;  4A9O A;  5EWC A;  5FE1 A;  4N3W A;  4LZ2 A;  4QY4 A;  3I3J A;  4O74 A;  5HFR A;  3JVM A;  5I7X A;  4KCX A;  2L84 A;  5HCL A;  4QB3 A;  5IGM A;  4UIZ A;  4NUD A;  4A9M A;  5DYC A;  4PCI A;  4HXS A;  5FE6 A;  3ZYU A;  5L99 A;  2YDW A;  4LZS A;  5A5R A;  4YBS A;  5DLZ A;  4MEQ A;  4NR7 A;  5H85 A;  4CLB A;  3O34 A;  4AI6 A;  4QZS A;  2RNY A;  4ZQL A;  2WP2 A;  5CUG A;  4C67 A; 
#chains in the Genus database with same CATH homology
 4N4I A;  3UV5 A;  4Z6H A;  4QSP A;  5IGN A;  4Z93 A;  3GG3 A;  2RNW A;  4BW2 A;  4YAX A;  4CFL A;  4J1P A;  5ETB A;  5E0R A;  4HBX A;  4UYD A;  5KTX A;  4C66 A;  4N4H A;  4YYH A;  5CTL A;  5C89 A;  2GRC A;  5H1V A;  5J0D A;  4QYD A;  4O77 A;  5EPR A;  3UVD A;  5D25 A;  5KO4 A;  5CUB A;  4NYX A;  5L96 A;  3SVH A;  4TT6 A;  3AQA A;  5DKD A;  4QR4 A;  3TLP A;  5A5P A;  5D3N A;  5JI8 A;  5LKT A;  5FFV A;  3UV2 A;  4HBW A;  4O7A A;  5FE9 A;  5FB0 A;  4NR5 A;  5E3D A;  5CGP A;  3HME A;  5CZG A;  4NRB A;  5ENE A;  5FE7 A;  5CFW A;  5E3G A;  5FE0 A;  4HBV A;  4A9H A;  4XY8 A;  5K29 A;  1JSP B;  4BW1 A;  5HFQ A;  5FE8 A;  4NUC A;  5E74 A;  5DLX A;  5TCM A;  4UIT A;  1WUM A;  4UIW A;  5D24 A;  4BW3 A;  4TZ2 A;  5L97 A;  5D3T A;  3U5O A;  4CUQ A;  4A9K A;  3JVL A;  5CQ6 A;  3ONI A;  5DKC A;  4NR9 A;  4QSR A;  3QZT A;  3UV4 A;  4UYG A;  4NQM A;  4YYN A;  5HM0 A;  4YBT A;  4Q0O A;  3IU6 A;  4NR8 A;  5DYX A;  5F1L A;  4O75 A;  5EIC A;  5F1H A;  2FSA A;  3MQM A;  5I7Y A;  4MR6 A;  4A9I A;  4IOO A;  4BW4 A;  4MEO A;  5FB1 A;  4A9L A;  4QSS A;  3S91 A;  5I80 A;  5F3A A;  4UIY A;  4YH4 A;  4F3I A;  5EQ1 A;  3U5K A;  3SVG A;  4IOQ A;  5LJ0 A;  5D0C A;  5D3L A;  2RI7 A;  3Q2E A;  5D7X A;  4TZ8 A;  4Y03 A;  2DVS A;  4YAB A;  4QEV A;  5E9L A;  5CUA A;  1EQF A;  4TU4 A;  5EPB A;  5CQ3 A;  4O7C A;  5CP5 A;  5JWM A;  4CFK A;  4QR5 A;  5CY9 A;  5EWH A;  5TB6 A;  5BT4 A;  4HXO A;  4MR5 A;  4LDF A;  4A9F A;  4TYL A;  5I1Q A;  2E7O A;  4UIV A;  4PS5 A;  5E7D A;  4TTE A;  4QSV A;  4Q0N A;  2DAT A;  5IBN A;  5EGU A;  3O35 A;  5EWD A;  2RFJ A;  5HLS A;  5AME A;  3K2J A;  4WHW A;  5E73 A;  4UYF B;  4YAD A;  5HRW A;  4PY6 A;  2E3K A;  5F25 A;  4HXK A;  4TT4 A;  1N72 A;  3U5N A;  5DBM A;  5I83 A;  2YQD A;  5E9I A;  3NXB A;  3D7C A;  4YYI A;  4YH3 A;  4YAT A;  5FG6 A;  4QST A;  4CUS A;  4AKN A;  5AD2 A;  5LUU A;  4YYM A;  4BJX A;  4LYS A;  4CUP A;  4QNS A;  4YC9 A;  5E9K A;  4OGI A;  4MR4 A;  2D9E A;  5IG6 A;  5FFW A;  5ENJ A;  5CQ5 A;  4QSU A;  5DFC A;  4A9E A;  4CUU A;  4MEP A;  4CUR A;  2KTB B;  5DKH A;  1E6I A;  3JVK A;  5ENC A;  5BT5 A;  4IR6 A;  4XUB A;  5L8U A;  2L5E A;  5I29 A;  5DFD A;  4LRG A;  3U5M A;  5LVR A;  5F5Z A;  2DVV A;  4MEN A;  5F36 A;  5KTU A;  5CQ7 A;  5ENI A;  5A83 A;  4IOR A;  4KV1 A;  3QZV A;  4NS5 A;  5FG5 A;  5AD3 A;  5F62 A;  2F6J A;  3SVF A;  5LKZ A;  4NYW A;  4LC2 A;  5E9V A;  2R10 A;  2DVQ A;  5H1U A;  4QEU A;  2OUO A;  5CQ4 A;  5L8T A;  3U5L A;  5HEM A;  3P1D A;  2YYN A;  2DKW A;  4N4F A;  5DYA A;  5FE3 A;  5HQ7 A;  3LQI A;  2H60 A;  3O37 A;  5EPS A;  5ETD A;  2I7K A;  3UVW A;  2YW5 A;  3MB3 A;  4KV4 A;  5EK9 A;  2OO1 A;  4O72 A;  5A5O A;  4HXN A;  2G4A A;  4NXJ A;  4TS8 A;  4WHU A;  5HEL A;  4Z1S A;  5CUC A;  3UVX A;  5FG4 A;  4PKL A;  5G4S A;  4LYW A;  5FBX A;  4TQN A;  5LJ2 A;  5KTW A;  4IR3 A;  4YYD A;  5C87 A;  2LSP B;  3Q2F A;  4J0R A;  4O78 A;  4BHW A;  5CQT A;  5HEN A;  3DAI A;  4UIX A;  5EWW A;  2NXB A;  3RCW A;  5CPE A;  5KHM A;  5HRV A;  5DW2 A;  5D3P A;  3MUL A;  5EI4 A;  4YY4 A;  5A85 A;  4QBM A;  5DFB A;  5HRX A;  5L98 A;  2RO1 A;  5A82 A;  2MJV B;  4DON A;  4XUA A;  5F60 A;  4ALH A;  5ENF A;  5D26 A;  5HJC A;  4TT2 A;  4QSQ A;  4NRA A;  4HXL A;  4J0S A;  5II2 A;  1X0J A;  1JM4 B;  5C8G A;  5E9Y A;  4QC1 A;  5A5S A;  4UYH A;  5CU8 A;  2DWW A;  5DY7 A;  5CUE A;  4PTB A;  2F6N A;  5LKU A;  5G4R A;  5AMF A;  4QUU A;  4O76 A;  4ZW1 A;  4NR4 A;  5EWV A;  4X2I A;  3HMH A;  3O33 A;  4N4G A;  2YEL A;  5IGK A;  4QC3 A;  3IU5 A;  4YYG A;  4OGJ A;  3P1F A;  5LKX A;  5HQ5 A;  5CS8 A;  5FFY A;  4CUT A;  3AAD A;  4YYK A;  4O70 A;  4MR3 A;  5CUD A;  4A9J A;  3O36 A;  3LXJ A;  4XYA A;  4HXP A;  3P5O A;  5F61 A;  4OUF A;  5FH6 A;  5DYU A;  5FE4 A;  4LZR A;  4Z1Q A;  5FE2 A;  5FH8 A;  4UIU A;  4QEW A;  4IR5 A;  4UYE A;  5H1T A;  4NRC A;  5BT3 A;  5F2P A;  3LJW A;  5D3R A;  4NUE A;  5EU1 A;  3G0L A;  5D3H A;  2N9G A;  3HMF A;  5FDZ A;  1F68 A;  5A5N A;  4WIV A;  5C85 A;  5C7N A;  4CL9 A;  3UVY A;  5CRZ A;  3UW9 A;  3P1E A;  5IGL A;  4ZC9 A;  4FLP A;  2D82 A;  4YK0 A;  4J3I A;  3U5J A;  4TU6 A;  3FKM X;  4YYJ A;  4NR6 A;  3P1C A;  5II1 A;  5IID A;  3JVJ A;  4QSX A;  2L85 A;  4QUT A;  5CQ8 A;  2E7N A;  4O71 A;  3DWY A;  3G0J A;  5LVQ A;  5DX4 A;  4XY9 A;  5EVA A;  2WP1 A;  5LJ1 A;  2YEK A;  2YEM A;  5COI A;  2I8N A;  5CQA A;  3MXF A;  5FH7 A;  5A81 A;  5ENH A;  5DW1 A;  4QSW A;  5FE5 A;  3U5P A;  5HQ6 A;  5E9M A;  4HBY A;  5CRM A;  2OSS A;  3LQH A;  4LYI A;  5EV9 A;  4O7F A;  4RVR A;  5D3S A;  4UYF A;  5ENG A;  4LR6 A;  4YBM A;  1ZS5 A;  5A5Q A;  4ALG A;  5I40 A;  4O7E A;  5I86 A;  4NYV A;  5KU3 A;  5I89 A;  2DVR A;  5EP7 A;  3QZS A;  4HXR A;  2RNX A;  4YY6 A;  2RS9 B;  5EM3 A;  3S92 A;  4QYL A;  5EIS A;  5A7C A;  5I88 A;  5F63 A;  5ENB A;  5C4Q A;  5ACY A;  4A9N A;  3LQJ A;  2R0V A;  4PCE A;  1WUG A;  4E96 A;  2R0Y A;  4HXM A;  4IR4 A;  4O7B A;  3MUK A;  2R0S A;  4QR3 A;  4Z6I A;  3MB4 A;  4GPJ A;  4NQN A;  5D3J A;  5EA1 A;  4A9O A;  5EWC A;  5FE1 A;  4N3W A;  4LZ2 A;  4QY4 A;  3I3J A;  4O74 A;  5HFR A;  3JVM A;  5I7X A;  4KCX A;  2L84 A;  5HCL A;  4QB3 A;  5IGM A;  4UIZ A;  4NUD A;  4A9M A;  5DYC A;  4PCI A;  4HXS A;  5FE6 A;  3ZYU A;  5L99 A;  2YDW A;  4LZS A;  5A5R A;  4YBS A;  5DLZ A;  4MEQ A;  4NR7 A;  5H85 A;  4CLB A;  3O34 A;  4QZS A;  2RNY A;  4ZQL A;  2WP2 A;  5CUG A;  4C67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...