5EU1A

Crystal structure of brd9 in complex with bi-7273
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords BRD9
publication title Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5eu1A00
4HXNA 5LKZA 3MB3A 5D25A 5ENIA 5FE8A 4XYAA 5IGLA 5IGMA 4HXOA 5LVRA 4LDFA 4RVRA 4NRCA 4YYJA 4OGIA 5FDZA 3D7CA 5H1TA 4O7AA 4BW1A 5CUDA 4QYDA 4O78A 4HXMA 5FB0A 3S92A 5LJ2A 4QEUA 4QR4A 4Z6IA 3O35A 4QSRA 4MEQA 5L98A 4BJXA 5CU8A 4NRBA 2OSSA 4GPJA 5I83A 3AQAA 2YDWA 4CFKA 5D3PA 5E9VA 4A9FA 4QNSA 2NXBA 5CFWA 5ENFA 4A9HA 4N3WA 4BHWA 4HBWA 4YH4A 4ALHA 2H60A 5HRXA 2RNXA 5CUBA 2DVQA 4TT4A 4O7FA 5CQAA 5CY9A 4QYLA 4UITA 4J1PA 5D3SA 5JWMA 4QSSA 5IBNA 4WIVA 5A5SA 5E3DA 4WHWA 4MEOA 5D3NA 3UW9A 5E74A 4YBSA 4MEPA 4TU4A 4QSWA 4UIZA 4O7EA 4A9IA 4UYEA 2YEMA 5CQ3A 4QSUA 5FE9A 2DVSA 2RNWA 5H1VA 5HQ6A 1WUGA 3Q2EA 5CP5A 5FG5A 2R0YA 5CQ4A 4C67A 4NRAA 4TS8A 5HRWA 4YYGA 5F25A 5F36A 5TCMA 5HQ5A 5LJ1A 4YH3A 3O33A 3Q2FA 4HBVA 3ONIA 4N4IA 3LQIA 4QB3A 5L8UA 5HLSA 5FE1A 5E73A 4HXPA 3MULA 4ZC9A 5ACYA 4BW2A 4YYKA 5F1HA 3QZSA 2YW5A 5CUEA 5EWDA 4TQNA 3UV4A 3O37A 5F62A 5FE7A 5EWVA 4ZQLA 5A81A 4XUBA 5CUAA 3HMFA 5ENJA 5E9LA 5COIA 4CUPA 4UYHA 3G0JA 3QZTA 5F3AA 5FH6A 4LR6A 2RS9B 5EU1A 2DWWA 3U5LA 4N4GA 5EQ1A 4NQNA 4CUQA 5FH7A 5G4SA 4NXJA 5AD3A 5J0DA 5FFWA 3U5OA 4IOQA 4LYSA 5A83A 5EVAA 3JVMA 4NR8A 4ALGA 1N72A 5DYCA 4A9JA 4NUEA 5TB6A 5EPSA 5FG6A 4NR9A 5DYUA 4Q0NA 3S91A 3UV5A 4Z1SA 2DVVA 5E3GA 4NR7A 5I86A 3NXBA 1X0JA 2LSPB 5DFBA 5LUUA 4TTEA 3U5JA 5CRZA 3DAIA 5IIDA 5D24A 5AD2A 4LZ2A 5A82A 4YYMA 4NR6A 4E96A 3SVFA 4FLPA 5CTLA 5I80A 5H85A 5KHMA 3JVKA 4LC2A 3SVHA 4IR5A 2YQDA 5CQ7A 4J3IA 5HFQA 5FE0A 3GG3A 2DATA 5KTWA 5E9KA 4UYGA 4O77A 2R0SA 5LJ0A 4J0SA 5CQTA 5F2PA 1ZS5A 5ENGA 4MR5A 2R0VA 2L85A 4QSQA 4KV1A 4MR6A 1JM4B 5D26A 4IORA 3U5MA 3JVLA 4HXKA 5FE4A 5I89A 5BT3A 5ENHA 4O70A 5CPEA 5DW2A 5BT4A 5EWCA 3U5PA 5EA1A 4PS5A 4YADA 5DKDA 3HMEA 5EGUA 2FSAA 5DKHA 1F68A 5I29A 4TT2A 5EI4A 5II1A 3UVWA 5DFDA 3IU5A 5LKXA 4A9KA 5I7YA 3LJWA 3TLPA 5LKTA 5DLXA 4YK0A 4A9LA 4BW3A 5FE6A 4TT6A 4CURA 3I3JA 4CFLA 5BT5A 4UIUA 2YELA 3MB4A 5HELA 5HENA 4LYIA 2WP2A 4MR3A 4BW4A 5IGKA 5FE3A 5F61A 3UVDA 5HM0A 5E0RA 3QZVA 4ZW1A 4WHUA 5DFCA 4QC3A 2I8NA 4TYLA 5I40A 5DYXA 5ETDA 2F6NA 5DBMA 4UYFB 4QY4A 5ETBA 4Z6HA 5I88A 5D7XA 5EICA 4O75A 4J0RA 2G4AA 5C7NA 3UVYA 4QSXA 4QSVA 3MQMA 5ENBA 3AADA 5EPBA 5FG4A 5JI8A 4NYVA 4O76A 5C87A 3HMHA 4YAXA 4Z1QA 4O71A 4KV4A 3SVGA 5CRMA 4HXRA 2F6JA 5AMFA 4QR5A 2OUOA 2YEKA 4MENA 4CLBA 4YABA 2L84A 4O72A 3UV2A 2R10A 4CL9A 5LVQA 4A9OA 5E7DA 2GRCA 5EWWA 5L96A 5K29A 4A9MA 5CGPA 4NYXA 5I7XA 4HXSA 5DYAA 2DKWA 5F5ZA 3U5KA 5D3RA 4YY6A 5HJCA 5HQ7A 4CUTA 3P1DA 5LKUA 5KU3A 3P1CA 5A5RA 5FBXA 5KTXA 4C66A 4HBXA 2MJVB 3IU6A 4O7BA 5FFYA 5D3LA 2L5EA 5C8GA 4UIVA 5EV9A 5HFRA 4XY8A 5CS8A 4CUSA 4QUUA 4O7CA 4MR4A 5HCLA 5A5QA 1JSPB 5ENCA 4HBYA 4UIXA 4UYDA 5C85A 3U5NA 4HXLA 5FE5A 4TU6A 5FE2A 4NUCA 5CZGA 4QZSA 4TZ8A 3O36A 1WUMA 4NR4A 5HEMA 4F3IA 4PCEA 4PY6A 4A9NA 3MUKA 4QC1A 5CUCA 4QSPA 5A5PA 1E6IA 2RFJA 4IR3A 5L8TA 5IG6A 4NQMA 3P1EA 4A9EA 5I1QA 4Z93A 2N9GA 4QBMA 1EQFA 2E7NA 4UIYA 4QEWA 5DKCA 4Q0OA 5KTUA 5II2A 2WP1A 3O34A 5FH8A 3MXFA 5CUGA 4NUDA 5ENEA 4CUUA 5C4QA 5DLZA 4UIWA 5D3TA 4YBMA 5F1LA 2RO1A 2YYNA 4DONA 5DY7A 2E3KA 4N4HA 3LQJA 4XY9A 4YC9A 4IOOA 4OGJA 5D3JA 3UVXA 4LZRA 4TZ2A 5AMEA 5F60A 4PCIA 3DWYA 4Y03A 5IGNA 5E9YA 5HRVA 5H1UA 2E7OA 4YYDA 3LXJA 3G0LA 3P5OA 3FKMX 4LYWA 4YYIA 4NS5A 4OUFA 3ZYUA 3LQHA 4XUAA 3P1FA 3RCWA 3JVJA 4PTBA 5A5OA 5C89A 4NR5A 4N4FA 5L99A 4QEVA 2RI7A 5D3HA 4QSTA 4YBTA 5E9IA 5D0CA 4KCXA 2OO1A 4QR3A 4AKNA 5CQ6A 5F63A 4LRGA 4QUTA 5DW1A 5FB1A 4YYNA 5EP7A 5EM3A 4X2IA 2D9EA 4NYWA 4O74A 5DX4A 2RNYA 4YYHA 5L97A 5EWHA 2KTBB 4LZSA 4YATA 5CQ5A 5FFVA 5E9MA 3K2JA 5A5NA 4YY4A 2D82A 5EISA 5G4RA 4IR6A 5CQ8A 4IR4A 2DVRA 4PKLA 5EK9A 5KO4A 5A85A 2I7KA 5A7CA 4UYFA 5EPRA
chains in the Genus database with same CATH superfamily
4HXNA 5LKZA 3MB3A 5D25A 5ENIA 5FE8A 4XYAA 5IGLA 5IGMA 4HXOA 5LVRA 4LDFA 4RVRA 4NRCA 4YYJA 4OGIA 5FDZA 3D7CA 5H1TA 4O7AA 4BW1A 5CUDA 4QYDA 4O78A 4HXMA 5FB0A 3S92A 5LJ2A 4QEUA 4QR4A 4Z6IA 3O35A 4QSRA 4MEQA 5L98A 4BJXA 5CU8A 4NRBA 2OSSA 4GPJA 5I83A 3AQAA 2YDWA 4CFKA 1PUOA 5D3PA 5E9VA 4A9FA 4QNSA 2NXBA 5CFWA 5ENFA 4A9HA 4N3WA 4BHWA 4HBWA 4YH4A 4ALHA 2H60A 5HRXA 2RNXA 5CUBA 2DVQA 4TT4A 4O7FA 5CQAA 5CY9A 4QYLA 4UITA 4J1PA 5D3SA 5JWMA 4QSSA 5IBNA 4WIVA 5A5SA 5E3DA 4WHWA 4MEOA 5D3NA 3UW9A 5E74A 4YBSA 4MEPA 4TU4A 4QSWA 4UIZA 4O7EA 4A9IA 4UYEA 2YEMA 5CQ3A 4QSUA 5FE9A 2DVSA 2RNWA 5H1VA 5HQ6A 1WUGA 3Q2EA 5CP5A 5FG5A 2R0YA 5CQ4A 4C67A 4NRAA 4TS8A 5HRWA 4YYGA 5F25A 5F36A 5TCMA 5HQ5A 5LJ1A 4YH3A 3O33A 3Q2FA 4HBVA 3ONIA 4N4IA 3LQIA 4QB3A 5L8UA 5HLSA 5FE1A 5E73A 4HXPA 3MULA 4ZC9A 5ACYA 4BW2A 4YYKA 5F1HA 3QZSA 2YW5A 5CUEA 5EWDA 4TQNA 3UV4A 3O37A 5F62A 5FE7A 5EWVA 4ZQLA 5A81A 4XUBA 5CUAA 3HMFA 5ENJA 5E9LA 5COIA 4CUPA 4UYHA 3G0JA 3QZTA 5F3AA 5FH6A 4LR6A 2RS9B 5EU1A 2DWWA 3U5LA 4N4GA 5EQ1A 4NQNA 4CUQA 5FH7A 5G4SA 4NXJA 5AD3A 5J0DA 5FFWA 3U5OA 4IOQA 4LYSA 5A83A 5EVAA 3JVMA 4NR8A 4ALGA 1N72A 5DYCA 4A9JA 4NUEA 5TB6A 5EPSA 5FG6A 4NR9A 5DYUA 4Q0NA 3S91A 3UV5A 4Z1SA 2DVVA 5E3GA 4NR7A 5I86A 3NXBA 1X0JA 2LSPB 5DFBA 5LUUA 4TTEA 3U5JA 5CRZA 3DAIA 5IIDA 5D24A 5AD2A 4LZ2A 5A82A 4YYMA 4NR6A 4E96A 3SVFA 4FLPA 5CTLA 5I80A 5H85A 5KHMA 3JVKA 4LC2A 3SVHA 4IR5A 2YQDA 5CQ7A 4J3IA 5HFQA 5FE0A 3GG3A 2DATA 5KTWA 5E9KA 3VKHA 4UYGA 4O77A 2R0SA 5LJ0A 4J0SA 5CQTA 5F2PA 1ZKRA 1ZS5A 5ENGA 4MR5A 2R0VA 2L85A 4QSQA 4KV1A 4MR6A 1JM4B 5D26A 4IORA 3U5MA 3JVLA 4HXKA 5FE4A 5I89A 5BT3A 5ENHA 4O70A 5CPEA 5DW2A 5BT4A 5EWCA 3U5PA 5EA1A 4PS5A 4YADA 5DKDA 3HMEA 5EGUA 2FSAA 5DKHA 1F68A 5I29A 4TT2A 5EI4A 5II1A 3UVWA 5DFDA 3IU5A 5LKXA 4A9KA 5I7YA 3LJWA 3TLPA 5LKTA 5DLXA 4YK0A 4A9LA 4BW3A 5FE6A 4TT6A 4CURA 3I3JA 4CFLA 5BT5A 4UIUA 2YELA 3MB4A 5HELA 5HENA 4LYIA 2WP2A 4MR3A 4BW4A 5IGKA 5FE3A 5F61A 3UVDA 5HM0A 5E0RA 3QZVA 4ZW1A 4WHUA 5DFCA 4QC3A 2I8NA 4TYLA 5I40A 5DYXA 5ETDA 2F6NA 5DBMA 4UYFB 4QY4A 5ETBA 4Z6HA 5I88A 5D7XA 5EICA 4AKHA 4O75A 4J0RA 2G4AA 5C7NA 3UVYA 4QSXA 4QSVA 3MQMA 5ENBA 3AADA 5EPBA 5FG4A 5JI8A 4NYVA 4O76A 5C87A 3HMHA 4YAXA 4Z1QA 4AI6A 4O71A 4KV4A 3SVGA 5CRMA 4HXRA 2F6JA 5AMFA 4QR5A 2OUOA 2YEKA 4MENA 4CLBA 4YABA 2L84A 4O72A 3UV2A 2R10A 4CL9A 5LVQA 4A9OA 5E7DA 2GRCA 5EWWA 5L96A 5K29A 4A9MA 5CGPA 4NYXA 5I7XA 3D1BA 4HXSA 5DYAA 2DKWA 5F5ZA 2EJNA 3U5KA 5D3RA 4YY6A 5HJCA 5HQ7A 4CUTA 3P1DA 5LKUA 5KU3A 3D1DA 3P1CA 5A5RA 5FBXA 5KTXA 4C66A 4HBXA 2MJVB 3IU6A 4O7BA 5FFYA 5D3LA 2L5EA 5C8GA 4UIVA 5EV9A 5HFRA 4XY8A 5CS8A 4CUSA 4QUUA 4O7CA 4MR4A 5HCLA 5A5QA 1JSPB 5ENCA 4HBYA 4UIXA 4UYDA 5C85A 3U5NA 4HXLA 5FE5A 4TU6A 5FE2A 4NUCA 5CZGA 4QZSA 4TZ8A 3O36A 1WUMA 4NR4A 5HEMA 4F3IA 4PCEA 4PY6A 4A9NA 3MUKA 4QC1A 5CUCA 4QSPA 5A5PA 1E6IA 2RFJA 4IR3A 5L8TA 5IG6A 4NQMA 3P1EA 4A9EA 5I1QA 4Z93A 2N9GA 4QBMA 1EQFA 2E7NA 4UIYA 4QEWA 5DKCA 4Q0OA 5KTUA 5II2A 2WP1A 3O34A 5FH8A 3MXFA 5CUGA 4NUDA 5ENEA 4CUUA 5C4QA 5DLZA 4UIWA 5D3TA 4YBMA 5F1LA 4AKGA 2RO1A 2YYNA 3ERRA 4DONA 5DY7A 2E3KA 4N4HA 3LQJA 4XY9A 4YC9A 4IOOA 4OGJA 5D3JA 3UVXA 4LZRA 4TZ2A 5AMEA 5F60A 4PCIA 3DWYA 4AKIA 4Y03A 5IGNA 5E9YA 5HRVA 5H1UA 2E7OA 4YYDA 3LXJA 3G0LA 3P5OA 3FKMX 4LYWA 4YYIA 4NS5A 4OUFA 3ZYUA 3LQHA 4XUAA 3P1FA 3RCWA 3JVJA 4PTBA 5A5OA 5C89A 4NR5A 4N4FA 5L99A 4QEVA 2RI7A 5D3HA 4QSTA 4YBTA 5E9IA 5D0CA 4KCXA 2OO1A 4QR3A 4AKNA 5CQ6A 5F63A 4LRGA 4QUTA 5DW1A 5FB1A 4YYNA 5EP7A 5EM3A 4X2IA 2D9EA 4NYWA 4O74A 5DX4A 2RNYA 4YYHA 5L97A 5EWHA 2KTBB 4LZSA 3VKGA 4YATA 5CQ5A 5FFVA 5E9MA 3K2JA 5A5NA 4YY4A 2D82A 5EISA 5G4RA 4IR6A 5CQ8A 4IR4A 2DVRA 4PKLA 5EK9A 5KO4A 5A85A 2I7KA 5A7CA 4UYFA 5EPRA
chains in the Genus database with same CATH topology
4HXNA 5LKZA 3MB3A 5D25A 5ENIA 5FE8A 4XYAA 5IGLA 5IGMA 4HXOA 5LVRA 4LDFA 4RVRA 4NRCA 4YYJA 4OGIA 5FDZA 3D7CA 5H1TA 4O7AA 4BW1A 5CUDA 4QYDA 4O78A 4HXMA 5FB0A 3S92A 5LJ2A 4QEUA 4QR4A 4Z6IA 3O35A 4QSRA 4MEQA 5L98A 4BJXA 5CU8A 4NRBA 2OSSA 4GPJA 5I83A 3AQAA 2YDWA 4CFKA 5D3PA 5E9VA 4A9FA 4QNSA 2NXBA 5CFWA 5ENFA 4A9HA 4N3WA 4BHWA 4HBWA 4YH4A 4ALHA 2H60A 5HRXA 2RNXA 5CUBA 2DVQA 4TT4A 4O7FA 5CQAA 5CY9A 4QYLA 4UITA 4J1PA 5D3SA 5JWMA 4QSSA 5IBNA 4WIVA 5A5SA 5E3DA 4WHWA 4MEOA 5D3NA 3UW9A 5E74A 4YBSA 4MEPA 4TU4A 4QSWA 4UIZA 4O7EA 4A9IA 4UYEA 2YEMA 5CQ3A 4QSUA 5FE9A 2DVSA 2RNWA 5H1VA 5HQ6A 1WUGA 3Q2EA 5CP5A 5FG5A 2R0YA 5CQ4A 4C67A 4NRAA 4TS8A 5HRWA 4YYGA 5F25A 5F36A 5TCMA 5HQ5A 5LJ1A 4YH3A 3O33A 3Q2FA 4HBVA 3ONIA 4N4IA 3LQIA 4QB3A 5L8UA 5HLSA 5FE1A 5E73A 4HXPA 3MULA 4ZC9A 5ACYA 4BW2A 4YYKA 5F1HA 3QZSA 2YW5A 5CUEA 5EWDA 4TQNA 3UV4A 3O37A 5F62A 5FE7A 5EWVA 4ZQLA 5A81A 4XUBA 5CUAA 3HMFA 5ENJA 5E9LA 5COIA 4CUPA 4UYHA 3G0JA 3QZTA 5F3AA 5FH6A 4LR6A 2RS9B 5EU1A 2DWWA 3U5LA 4N4GA 5EQ1A 4NQNA 4CUQA 5FH7A 5G4SA 4NXJA 5AD3A 5J0DA 5FFWA 3U5OA 4IOQA 4LYSA 5A83A 5EVAA 3JVMA 4NR8A 4ALGA 1N72A 5DYCA 4A9JA 4NUEA 5TB6A 5EPSA 5FG6A 4NR9A 5DYUA 4Q0NA 3S91A 3UV5A 4Z1SA 2DVVA 5E3GA 4NR7A 5I86A 3NXBA 1X0JA 2LSPB 5DFBA 5LUUA 4TTEA 3U5JA 5CRZA 3DAIA 5IIDA 5D24A 5AD2A 4LZ2A 5A82A 4YYMA 4NR6A 4E96A 3SVFA 4FLPA 5CTLA 5I80A 5H85A 5KHMA 3JVKA 4LC2A 3SVHA 4IR5A 2YQDA 5CQ7A 4J3IA 5HFQA 5FE0A 3GG3A 2DATA 5KTWA 5E9KA 4UYGA 4O77A 2R0SA 5LJ0A 4J0SA 5CQTA 5F2PA 1ZS5A 5ENGA 4MR5A 2R0VA 2L85A 4QSQA 4KV1A 4MR6A 1JM4B 5D26A 4IORA 3U5MA 3JVLA 4HXKA 5FE4A 5I89A 5BT3A 5ENHA 4O70A 5CPEA 5DW2A 5BT4A 5EWCA 3U5PA 5EA1A 4PS5A 4YADA 5DKDA 3HMEA 5EGUA 2FSAA 5DKHA 1F68A 5I29A 4TT2A 5EI4A 5II1A 3UVWA 5DFDA 3IU5A 5LKXA 4A9KA 5I7YA 3LJWA 3TLPA 5LKTA 5DLXA 4YK0A 4A9LA 4BW3A 5FE6A 4TT6A 4CURA 3I3JA 4CFLA 5BT5A 4UIUA 2YELA 3MB4A 5HELA 5HENA 4LYIA 2WP2A 4MR3A 4BW4A 5IGKA 5FE3A 5F61A 3UVDA 5HM0A 5E0RA 3QZVA 4ZW1A 4WHUA 5DFCA 4QC3A 2I8NA 4TYLA 5I40A 5DYXA 5ETDA 2F6NA 5DBMA 4UYFB 4QY4A 5ETBA 4Z6HA 5I88A 5D7XA 5EICA 4O75A 4J0RA 2G4AA 5C7NA 3UVYA 4QSXA 4QSVA 3MQMA 5ENBA 3AADA 5EPBA 5FG4A 5JI8A 4NYVA 4O76A 5C87A 3HMHA 4YAXA 4Z1QA 4O71A 4KV4A 3SVGA 5CRMA 4HXRA 2F6JA 5AMFA 4QR5A 2OUOA 2YEKA 4MENA 4CLBA 4YABA 2L84A 4O72A 3UV2A 2R10A 4CL9A 5LVQA 4A9OA 5E7DA 2GRCA 5EWWA 5L96A 5K29A 4A9MA 5CGPA 4NYXA 5I7XA 4HXSA 5DYAA 2DKWA 5F5ZA 3U5KA 5D3RA 4YY6A 5HJCA 5HQ7A 4CUTA 3P1DA 5LKUA 5KU3A 3P1CA 5A5RA 5FBXA 5KTXA 4C66A 4HBXA 2MJVB 3IU6A 4O7BA 5FFYA 5D3LA 2L5EA 5C8GA 4UIVA 5EV9A 5HFRA 4XY8A 5CS8A 4CUSA 4QUUA 4O7CA 4MR4A 5HCLA 5A5QA 1JSPB 5ENCA 4HBYA 4UIXA 4UYDA 5C85A 3U5NA 4HXLA 5FE5A 4TU6A 5FE2A 4NUCA 5CZGA 4QZSA 4TZ8A 3O36A 1WUMA 4NR4A 5HEMA 4F3IA 4PCEA 4PY6A 4A9NA 3MUKA 4QC1A 5CUCA 4QSPA 5A5PA 1E6IA 2RFJA 4IR3A 5L8TA 5IG6A 4NQMA 3P1EA 4A9EA 5I1QA 4Z93A 2N9GA 4QBMA 1EQFA 2E7NA 4UIYA 4QEWA 5DKCA 4Q0OA 5KTUA 5II2A 2WP1A 3O34A 5FH8A 3MXFA 5CUGA 4NUDA 5ENEA 4CUUA 5C4QA 5DLZA 4UIWA 5D3TA 4YBMA 5F1LA 2RO1A 2YYNA 4DONA 5DY7A 2E3KA 4N4HA 3LQJA 4XY9A 4YC9A 4IOOA 4OGJA 5D3JA 3UVXA 4LZRA 4TZ2A 5AMEA 5F60A 4PCIA 3DWYA 4Y03A 5IGNA 5E9YA 5HRVA 5H1UA 2E7OA 4YYDA 3LXJA 3G0LA 3P5OA 3FKMX 4LYWA 4YYIA 4NS5A 4OUFA 3ZYUA 3LQHA 4XUAA 3P1FA 3RCWA 3JVJA 4PTBA 5A5OA 5C89A 4NR5A 4N4FA 5L99A 4QEVA 2RI7A 5D3HA 4QSTA 4YBTA 5E9IA 5D0CA 4KCXA 2OO1A 4QR3A 4AKNA 5CQ6A 5F63A 4LRGA 4QUTA 5DW1A 5FB1A 4YYNA 5EP7A 5EM3A 4X2IA 2D9EA 4NYWA 4O74A 5DX4A 2RNYA 4YYHA 5L97A 5EWHA 2KTBB 4LZSA 4YATA 5CQ5A 5FFVA 5E9MA 3K2JA 5A5NA 4YY4A 2D82A 5EISA 5G4RA 4IR6A 5CQ8A 4IR4A 2DVRA 4PKLA 5EK9A 5KO4A 5A85A 2I7KA 5A7CA 4UYFA 5EPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXN A;  5LKZ A;  3MB3 A;  5D25 A;  5ENI A;  5FE8 A;  4XYA A;  5IGL A;  5IGM A;  4HXO A;  5LVR A;  4LDF A;  4RVR A;  4NRC A;  4YYJ A;  4OGI A;  5FDZ A;  3D7C A;  5H1T A;  4O7A A;  4BW1 A;  5CUD A;  4QYD A;  4O78 A;  4HXM A;  5FB0 A;  3S92 A;  5LJ2 A;  4QEU A;  4QR4 A;  4Z6I A;  3O35 A;  4QSR A;  4MEQ A;  5L98 A;  4BJX A;  5CU8 A;  4NRB A;  2OSS A;  4GPJ A;  5I83 A;  3AQA A;  2YDW A;  4CFK A;  5D3P A;  5E9V A;  4A9F A;  4QNS A;  2NXB A;  5CFW A;  5ENF A;  4A9H A;  4N3W A;  4BHW A;  4HBW A;  4YH4 A;  4ALH A;  2H60 A;  5HRX A;  2RNX A;  5CUB A;  2DVQ A;  4TT4 A;  4O7F A;  5CQA A;  5CY9 A;  4QYL A;  4UIT A;  4J1P A;  5D3S A;  5JWM A;  4QSS A;  5IBN A;  4WIV A;  5A5S A;  5E3D A;  4WHW A;  4MEO A;  5D3N A;  3UW9 A;  5E74 A;  4YBS A;  4MEP A;  4TU4 A;  4QSW A;  4UIZ A;  4O7E A;  4A9I A;  4UYE A;  2YEM A;  5CQ3 A;  4QSU A;  5FE9 A;  2DVS A;  2RNW A;  5H1V A;  5HQ6 A;  1WUG A;  3Q2E A;  5CP5 A;  5FG5 A;  2R0Y A;  5CQ4 A;  4C67 A;  4NRA A;  4TS8 A;  5HRW A;  4YYG A;  5F25 A;  5F36 A;  5TCM A;  5HQ5 A;  5LJ1 A;  4YH3 A;  3O33 A;  3Q2F A;  4HBV A;  3ONI A;  4N4I A;  3LQI A;  4QB3 A;  5L8U A;  5HLS A;  5FE1 A;  5E73 A;  4HXP A;  3MUL A;  4ZC9 A;  5ACY A;  4BW2 A;  4YYK A;  5F1H A;  3QZS A;  2YW5 A;  5CUE A;  5EWD A;  4TQN A;  3UV4 A;  3O37 A;  5F62 A;  5FE7 A;  5EWV A;  4ZQL A;  5A81 A;  4XUB A;  5CUA A;  3HMF A;  5ENJ A;  5E9L A;  5COI A;  4CUP A;  4UYH A;  3G0J A;  3QZT A;  5F3A A;  5FH6 A;  4LR6 A;  2RS9 B;  5EU1 A;  2DWW A;  3U5L A;  4N4G A;  5EQ1 A;  4NQN A;  4CUQ A;  5FH7 A;  5G4S A;  4NXJ A;  5AD3 A;  5J0D A;  5FFW A;  3U5O A;  4IOQ A;  4LYS A;  5A83 A;  5EVA A;  3JVM A;  4NR8 A;  4ALG A;  1N72 A;  5DYC A;  4A9J A;  4NUE A;  5TB6 A;  5EPS A;  5FG6 A;  4NR9 A;  5DYU A;  4Q0N A;  3S91 A;  3UV5 A;  4Z1S A;  2DVV A;  5E3G A;  4NR7 A;  5I86 A;  3NXB A;  1X0J A;  2LSP B;  5DFB A;  5LUU A;  4TTE A;  3U5J A;  5CRZ A;  3DAI A;  5IID A;  5D24 A;  5AD2 A;  4LZ2 A;  5A82 A;  4YYM A;  4NR6 A;  4E96 A;  3SVF A;  4FLP A;  5CTL A;  5I80 A;  5H85 A;  5KHM A;  3JVK A;  4LC2 A;  3SVH A;  4IR5 A;  2YQD A;  5CQ7 A;  4J3I A;  5HFQ A;  5FE0 A;  3GG3 A;  2DAT A;  5KTW A;  5E9K A;  4UYG A;  4O77 A;  2R0S A;  5LJ0 A;  4J0S A;  5CQT A;  5F2P A;  1ZS5 A;  5ENG A;  4MR5 A;  2R0V A;  2L85 A;  4QSQ A;  4KV1 A;  4MR6 A;  1JM4 B;  5D26 A;  4IOR A;  3U5M A;  3JVL A;  4HXK A;  5FE4 A;  5I89 A;  5BT3 A;  5ENH A;  4O70 A;  5CPE A;  5DW2 A;  5BT4 A;  5EWC A;  3U5P A;  5EA1 A;  4PS5 A;  4YAD A;  5DKD A;  3HME A;  5EGU A;  2FSA A;  5DKH A;  1F68 A;  5I29 A;  4TT2 A;  5EI4 A;  5II1 A;  3UVW A;  5DFD A;  3IU5 A;  5LKX A;  4A9K A;  5I7Y A;  3LJW A;  3TLP A;  5LKT A;  5DLX A;  4YK0 A;  4A9L A;  4BW3 A;  5FE6 A;  4TT6 A;  4CUR A;  3I3J A;  4CFL A;  5BT5 A;  4UIU A;  2YEL A;  3MB4 A;  5HEL A;  5HEN A;  4LYI A;  2WP2 A;  4MR3 A;  4BW4 A;  5IGK A;  5FE3 A;  5F61 A;  3UVD A;  5HM0 A;  5E0R A;  3QZV A;  4ZW1 A;  4WHU A;  5DFC A;  4QC3 A;  2I8N A;  4TYL A;  5I40 A;  5DYX A;  5ETD A;  2F6N A;  5DBM A;  4UYF B;  4QY4 A;  5ETB A;  4Z6H A;  5I88 A;  5D7X A;  5EIC A;  4O75 A;  4J0R A;  2G4A A;  5C7N A;  3UVY A;  4QSX A;  4QSV A;  3MQM A;  5ENB A;  3AAD A;  5EPB A;  5FG4 A;  5JI8 A;  4NYV A;  4O76 A;  5C87 A;  3HMH A;  4YAX A;  4Z1Q A;  4O71 A;  4KV4 A;  3SVG A;  5CRM A;  4HXR A;  2F6J A;  5AMF A;  4QR5 A;  2OUO A;  2YEK A;  4MEN A;  4CLB A;  4YAB A;  2L84 A;  4O72 A;  3UV2 A;  2R10 A;  4CL9 A;  5LVQ A;  4A9O A;  5E7D A;  2GRC A;  5EWW A;  5L96 A;  5K29 A;  4A9M A;  5CGP A;  4NYX A;  5I7X A;  4HXS A;  5DYA A;  2DKW A;  5F5Z A;  3U5K A;  5D3R A;  4YY6 A;  5HJC A;  5HQ7 A;  4CUT A;  3P1D A;  5LKU A;  5KU3 A;  3P1C A;  5A5R A;  5FBX A;  5KTX A;  4C66 A;  4HBX A;  2MJV B;  3IU6 A;  4O7B A;  5FFY A;  5D3L A;  2L5E A;  5C8G A;  4UIV A;  5EV9 A;  5HFR A;  4XY8 A;  5CS8 A;  4CUS A;  4QUU A;  4O7C A;  4MR4 A;  5HCL A;  5A5Q A;  1JSP B;  5ENC A;  4HBY A;  4UIX A;  4UYD A;  5C85 A;  3U5N A;  4HXL A;  5FE5 A;  4TU6 A;  5FE2 A;  4NUC A;  5CZG A;  4QZS A;  4TZ8 A;  3O36 A;  1WUM A;  4NR4 A;  5HEM A;  4F3I A;  4PCE A;  4PY6 A;  4A9N A;  3MUK A;  4QC1 A;  5CUC A;  4QSP A;  5A5P A;  1E6I A;  2RFJ A;  4IR3 A;  5L8T A;  5IG6 A;  4NQM A;  3P1E A;  4A9E A;  5I1Q A;  4Z93 A;  2N9G A;  4QBM A;  1EQF A;  2E7N A;  4UIY A;  4QEW A;  5DKC A;  4Q0O A;  5KTU A;  5II2 A;  2WP1 A;  3O34 A;  5FH8 A;  3MXF A;  5CUG A;  4NUD A;  5ENE A;  4CUU A;  5C4Q A;  5DLZ A;  4UIW A;  5D3T A;  4YBM A;  5F1L A;  2RO1 A;  2YYN A;  4DON A;  5DY7 A;  2E3K A;  4N4H A;  3LQJ A;  4XY9 A;  4YC9 A;  4IOO A;  4OGJ A;  5D3J A;  3UVX A;  4LZR A;  4TZ2 A;  5AME A;  5F60 A;  4PCI A;  3DWY A;  4Y03 A;  5IGN A;  5E9Y A;  5HRV A;  5H1U A;  2E7O A;  4YYD A;  3LXJ A;  3G0L A;  3P5O A;  3FKM X;  4LYW A;  4YYI A;  4NS5 A;  4OUF A;  3ZYU A;  3LQH A;  4XUA A;  3P1F A;  3RCW A;  3JVJ A;  4PTB A;  5A5O A;  5C89 A;  4NR5 A;  4N4F A;  5L99 A;  4QEV A;  2RI7 A;  5D3H A;  4QST A;  4YBT A;  5E9I A;  5D0C A;  4KCX A;  2OO1 A;  4QR3 A;  4AKN A;  5CQ6 A;  5F63 A;  4LRG A;  4QUT A;  5DW1 A;  5FB1 A;  4YYN A;  5EP7 A;  5EM3 A;  4X2I A;  2D9E A;  4NYW A;  4O74 A;  5DX4 A;  2RNY A;  4YYH A;  5L97 A;  5EWH A;  2KTB B;  4LZS A;  4YAT A;  5CQ5 A;  5FFV A;  5E9M A;  3K2J A;  5A5N A;  4YY4 A;  2D82 A;  5EIS A;  5G4R A;  4IR6 A;  5CQ8 A;  4IR4 A;  2DVR A;  4PKL A;  5EK9 A;  5KO4 A;  5A85 A;  2I7K A;  5A7C A;  4UYF A;  5EPR A; 
#chains in the Genus database with same CATH topology
 4HXN A;  5LKZ A;  3MB3 A;  5D25 A;  5ENI A;  5FE8 A;  4XYA A;  5IGL A;  5IGM A;  4HXO A;  5LVR A;  4LDF A;  4RVR A;  4NRC A;  4YYJ A;  4OGI A;  5FDZ A;  3D7C A;  5H1T A;  4O7A A;  4BW1 A;  5CUD A;  4QYD A;  4O78 A;  4HXM A;  5FB0 A;  3S92 A;  5LJ2 A;  4QEU A;  4QR4 A;  4Z6I A;  3O35 A;  4QSR A;  4MEQ A;  5L98 A;  4BJX A;  5CU8 A;  4NRB A;  2OSS A;  4GPJ A;  5I83 A;  3AQA A;  2YDW A;  4CFK A;  1PUO A;  5D3P A;  5E9V A;  4A9F A;  4QNS A;  2NXB A;  5CFW A;  5ENF A;  4A9H A;  4N3W A;  4BHW A;  4HBW A;  4YH4 A;  4ALH A;  2H60 A;  5HRX A;  2RNX A;  5CUB A;  2DVQ A;  4TT4 A;  4O7F A;  5CQA A;  5CY9 A;  4QYL A;  4UIT A;  4J1P A;  5D3S A;  5JWM A;  4QSS A;  5IBN A;  4WIV A;  5A5S A;  5E3D A;  4WHW A;  4MEO A;  5D3N A;  3UW9 A;  5E74 A;  4YBS A;  4MEP A;  4TU4 A;  4QSW A;  4UIZ A;  4O7E A;  4A9I A;  4UYE A;  2YEM A;  5CQ3 A;  4QSU A;  5FE9 A;  2DVS A;  2RNW A;  5H1V A;  5HQ6 A;  1WUG A;  3Q2E A;  5CP5 A;  5FG5 A;  2R0Y A;  5CQ4 A;  4C67 A;  4NRA A;  4TS8 A;  5HRW A;  4YYG A;  5F25 A;  5F36 A;  5TCM A;  5HQ5 A;  5LJ1 A;  4YH3 A;  3O33 A;  3Q2F A;  4HBV A;  3ONI A;  4N4I A;  3LQI A;  4QB3 A;  5L8U A;  5HLS A;  5FE1 A;  5E73 A;  4HXP A;  3MUL A;  4ZC9 A;  5ACY A;  4BW2 A;  4YYK A;  5F1H A;  3QZS A;  2YW5 A;  5CUE A;  5EWD A;  4TQN A;  3UV4 A;  3O37 A;  5F62 A;  5FE7 A;  5EWV A;  4ZQL A;  5A81 A;  4XUB A;  5CUA A;  3HMF A;  5ENJ A;  5E9L A;  5COI A;  4CUP A;  4UYH A;  3G0J A;  3QZT A;  5F3A A;  5FH6 A;  4LR6 A;  2RS9 B;  5EU1 A;  2DWW A;  3U5L A;  4N4G A;  5EQ1 A;  4NQN A;  4CUQ A;  5FH7 A;  5G4S A;  4NXJ A;  5AD3 A;  5J0D A;  5FFW A;  3U5O A;  4IOQ A;  4LYS A;  5A83 A;  5EVA A;  3JVM A;  4NR8 A;  4ALG A;  1N72 A;  5DYC A;  4A9J A;  4NUE A;  5TB6 A;  5EPS A;  5FG6 A;  4NR9 A;  5DYU A;  4Q0N A;  3S91 A;  3UV5 A;  4Z1S A;  2DVV A;  5E3G A;  4NR7 A;  5I86 A;  3NXB A;  1X0J A;  2LSP B;  5DFB A;  5LUU A;  4TTE A;  3U5J A;  5CRZ A;  3DAI A;  5IID A;  5D24 A;  5AD2 A;  4LZ2 A;  5A82 A;  4YYM A;  4NR6 A;  4E96 A;  3SVF A;  4FLP A;  5CTL A;  5I80 A;  5H85 A;  5KHM A;  3JVK A;  4LC2 A;  3SVH A;  4IR5 A;  2YQD A;  5CQ7 A;  4J3I A;  5HFQ A;  5FE0 A;  3GG3 A;  2DAT A;  5KTW A;  5E9K A;  3VKH A;  4UYG A;  4O77 A;  2R0S A;  5LJ0 A;  4J0S A;  5CQT A;  5F2P A;  1ZKR A;  1ZS5 A;  5ENG A;  4MR5 A;  2R0V A;  2L85 A;  4QSQ A;  4KV1 A;  4MR6 A;  1JM4 B;  5D26 A;  4IOR A;  3U5M A;  3JVL A;  4HXK A;  5FE4 A;  5I89 A;  5BT3 A;  5ENH A;  4O70 A;  5CPE A;  5DW2 A;  5BT4 A;  5EWC A;  3U5P A;  5EA1 A;  4PS5 A;  4YAD A;  5DKD A;  3HME A;  5EGU A;  2FSA A;  5DKH A;  1F68 A;  5I29 A;  4TT2 A;  5EI4 A;  5II1 A;  3UVW A;  5DFD A;  3IU5 A;  5LKX A;  4A9K A;  5I7Y A;  3LJW A;  3TLP A;  5LKT A;  5DLX A;  4YK0 A;  4A9L A;  4BW3 A;  5FE6 A;  4TT6 A;  4CUR A;  3I3J A;  4CFL A;  5BT5 A;  4UIU A;  2YEL A;  3MB4 A;  5HEL A;  5HEN A;  4LYI A;  2WP2 A;  4MR3 A;  4BW4 A;  5IGK A;  5FE3 A;  5F61 A;  3UVD A;  5HM0 A;  5E0R A;  3QZV A;  4ZW1 A;  4WHU A;  5DFC A;  4QC3 A;  2I8N A;  4TYL A;  5I40 A;  5DYX A;  5ETD A;  2F6N A;  5DBM A;  4UYF B;  4QY4 A;  5ETB A;  4Z6H A;  5I88 A;  5D7X A;  5EIC A;  4AKH A;  4O75 A;  4J0R A;  2G4A A;  5C7N A;  3UVY A;  4QSX A;  4QSV A;  3MQM A;  5ENB A;  3AAD A;  5EPB A;  5FG4 A;  5JI8 A;  4NYV A;  4O76 A;  5C87 A;  3HMH A;  4YAX A;  4Z1Q A;  4AI6 A;  4O71 A;  4KV4 A;  3SVG A;  5CRM A;  4HXR A;  2F6J A;  5AMF A;  4QR5 A;  2OUO A;  2YEK A;  4MEN A;  4CLB A;  4YAB A;  2L84 A;  4O72 A;  3UV2 A;  2R10 A;  4CL9 A;  5LVQ A;  4A9O A;  5E7D A;  2GRC A;  5EWW A;  5L96 A;  5K29 A;  4A9M A;  5CGP A;  4NYX A;  5I7X A;  3D1B A;  4HXS A;  5DYA A;  2DKW A;  5F5Z A;  2EJN A;  3U5K A;  5D3R A;  4YY6 A;  5HJC A;  5HQ7 A;  4CUT A;  3P1D A;  5LKU A;  5KU3 A;  3D1D A;  3P1C A;  5A5R A;  5FBX A;  5KTX A;  4C66 A;  4HBX A;  2MJV B;  3IU6 A;  4O7B A;  5FFY A;  5D3L A;  2L5E A;  5C8G A;  4UIV A;  5EV9 A;  5HFR A;  4XY8 A;  5CS8 A;  4CUS A;  4QUU A;  4O7C A;  4MR4 A;  5HCL A;  5A5Q A;  1JSP B;  5ENC A;  4HBY A;  4UIX A;  4UYD A;  5C85 A;  3U5N A;  4HXL A;  5FE5 A;  4TU6 A;  5FE2 A;  4NUC A;  5CZG A;  4QZS A;  4TZ8 A;  3O36 A;  1WUM A;  4NR4 A;  5HEM A;  4F3I A;  4PCE A;  4PY6 A;  4A9N A;  3MUK A;  4QC1 A;  5CUC A;  4QSP A;  5A5P A;  1E6I A;  2RFJ A;  4IR3 A;  5L8T A;  5IG6 A;  4NQM A;  3P1E A;  4A9E A;  5I1Q A;  4Z93 A;  2N9G A;  4QBM A;  1EQF A;  2E7N A;  4UIY A;  4QEW A;  5DKC A;  4Q0O A;  5KTU A;  5II2 A;  2WP1 A;  3O34 A;  5FH8 A;  3MXF A;  5CUG A;  4NUD A;  5ENE A;  4CUU A;  5C4Q A;  5DLZ A;  4UIW A;  5D3T A;  4YBM A;  5F1L A;  4AKG A;  2RO1 A;  2YYN A;  3ERR A;  4DON A;  5DY7 A;  2E3K A;  4N4H A;  3LQJ A;  4XY9 A;  4YC9 A;  4IOO A;  4OGJ A;  5D3J A;  3UVX A;  4LZR A;  4TZ2 A;  5AME A;  5F60 A;  4PCI A;  3DWY A;  4AKI A;  4Y03 A;  5IGN A;  5E9Y A;  5HRV A;  5H1U A;  2E7O A;  4YYD A;  3LXJ A;  3G0L A;  3P5O A;  3FKM X;  4LYW A;  4YYI A;  4NS5 A;  4OUF A;  3ZYU A;  3LQH A;  4XUA A;  3P1F A;  3RCW A;  3JVJ A;  4PTB A;  5A5O A;  5C89 A;  4NR5 A;  4N4F A;  5L99 A;  4QEV A;  2RI7 A;  5D3H A;  4QST A;  4YBT A;  5E9I A;  5D0C A;  4KCX A;  2OO1 A;  4QR3 A;  4AKN A;  5CQ6 A;  5F63 A;  4LRG A;  4QUT A;  5DW1 A;  5FB1 A;  4YYN A;  5EP7 A;  5EM3 A;  4X2I A;  2D9E A;  4NYW A;  4O74 A;  5DX4 A;  2RNY A;  4YYH A;  5L97 A;  5EWH A;  2KTB B;  4LZS A;  3VKG A;  4YAT A;  5CQ5 A;  5FFV A;  5E9M A;  3K2J A;  5A5N A;  4YY4 A;  2D82 A;  5EIS A;  5G4R A;  4IR6 A;  5CQ8 A;  4IR4 A;  2DVR A;  4PKL A;  5EK9 A;  5KO4 A;  5A85 A;  2I7K A;  5A7C A;  4UYF A;  5EPR A; 
#chains in the Genus database with same CATH homology
 4HXN A;  5LKZ A;  3MB3 A;  5D25 A;  5ENI A;  5FE8 A;  4XYA A;  5IGL A;  5IGM A;  4HXO A;  5LVR A;  4LDF A;  4RVR A;  4NRC A;  4YYJ A;  4OGI A;  5FDZ A;  3D7C A;  5H1T A;  4O7A A;  4BW1 A;  5CUD A;  4QYD A;  4O78 A;  4HXM A;  5FB0 A;  3S92 A;  5LJ2 A;  4QEU A;  4QR4 A;  4Z6I A;  3O35 A;  4QSR A;  4MEQ A;  5L98 A;  4BJX A;  5CU8 A;  4NRB A;  2OSS A;  4GPJ A;  5I83 A;  3AQA A;  2YDW A;  4CFK A;  5D3P A;  5E9V A;  4A9F A;  4QNS A;  2NXB A;  5CFW A;  5ENF A;  4A9H A;  4N3W A;  4BHW A;  4HBW A;  4YH4 A;  4ALH A;  2H60 A;  5HRX A;  2RNX A;  5CUB A;  2DVQ A;  4TT4 A;  4O7F A;  5CQA A;  5CY9 A;  4QYL A;  4UIT A;  4J1P A;  5D3S A;  5JWM A;  4QSS A;  5IBN A;  4WIV A;  5A5S A;  5E3D A;  4WHW A;  4MEO A;  5D3N A;  3UW9 A;  5E74 A;  4YBS A;  4MEP A;  4TU4 A;  4QSW A;  4UIZ A;  4O7E A;  4A9I A;  4UYE A;  2YEM A;  5CQ3 A;  4QSU A;  5FE9 A;  2DVS A;  2RNW A;  5H1V A;  5HQ6 A;  1WUG A;  3Q2E A;  5CP5 A;  5FG5 A;  2R0Y A;  5CQ4 A;  4C67 A;  4NRA A;  4TS8 A;  5HRW A;  4YYG A;  5F25 A;  5F36 A;  5TCM A;  5HQ5 A;  5LJ1 A;  4YH3 A;  3O33 A;  3Q2F A;  4HBV A;  3ONI A;  4N4I A;  3LQI A;  4QB3 A;  5L8U A;  5HLS A;  5FE1 A;  5E73 A;  4HXP A;  3MUL A;  4ZC9 A;  5ACY A;  4BW2 A;  4YYK A;  5F1H A;  3QZS A;  2YW5 A;  5CUE A;  5EWD A;  4TQN A;  3UV4 A;  3O37 A;  5F62 A;  5FE7 A;  5EWV A;  4ZQL A;  5A81 A;  4XUB A;  5CUA A;  3HMF A;  5ENJ A;  5E9L A;  5COI A;  4CUP A;  4UYH A;  3G0J A;  3QZT A;  5F3A A;  5FH6 A;  4LR6 A;  2RS9 B;  5EU1 A;  2DWW A;  3U5L A;  4N4G A;  5EQ1 A;  4NQN A;  4CUQ A;  5FH7 A;  5G4S A;  4NXJ A;  5AD3 A;  5J0D A;  5FFW A;  3U5O A;  4IOQ A;  4LYS A;  5A83 A;  5EVA A;  3JVM A;  4NR8 A;  4ALG A;  1N72 A;  5DYC A;  4A9J A;  4NUE A;  5TB6 A;  5EPS A;  5FG6 A;  4NR9 A;  5DYU A;  4Q0N A;  3S91 A;  3UV5 A;  4Z1S A;  2DVV A;  5E3G A;  4NR7 A;  5I86 A;  3NXB A;  1X0J A;  2LSP B;  5DFB A;  5LUU A;  4TTE A;  3U5J A;  5CRZ A;  3DAI A;  5IID A;  5D24 A;  5AD2 A;  4LZ2 A;  5A82 A;  4YYM A;  4NR6 A;  4E96 A;  3SVF A;  4FLP A;  5CTL A;  5I80 A;  5H85 A;  5KHM A;  3JVK A;  4LC2 A;  3SVH A;  4IR5 A;  2YQD A;  5CQ7 A;  4J3I A;  5HFQ A;  5FE0 A;  3GG3 A;  2DAT A;  5KTW A;  5E9K A;  4UYG A;  4O77 A;  2R0S A;  5LJ0 A;  4J0S A;  5CQT A;  5F2P A;  1ZS5 A;  5ENG A;  4MR5 A;  2R0V A;  2L85 A;  4QSQ A;  4KV1 A;  4MR6 A;  1JM4 B;  5D26 A;  4IOR A;  3U5M A;  3JVL A;  4HXK A;  5FE4 A;  5I89 A;  5BT3 A;  5ENH A;  4O70 A;  5CPE A;  5DW2 A;  5BT4 A;  5EWC A;  3U5P A;  5EA1 A;  4PS5 A;  4YAD A;  5DKD A;  3HME A;  5EGU A;  2FSA A;  5DKH A;  1F68 A;  5I29 A;  4TT2 A;  5EI4 A;  5II1 A;  3UVW A;  5DFD A;  3IU5 A;  5LKX A;  4A9K A;  5I7Y A;  3LJW A;  3TLP A;  5LKT A;  5DLX A;  4YK0 A;  4A9L A;  4BW3 A;  5FE6 A;  4TT6 A;  4CUR A;  3I3J A;  4CFL A;  5BT5 A;  4UIU A;  2YEL A;  3MB4 A;  5HEL A;  5HEN A;  4LYI A;  2WP2 A;  4MR3 A;  4BW4 A;  5IGK A;  5FE3 A;  5F61 A;  3UVD A;  5HM0 A;  5E0R A;  3QZV A;  4ZW1 A;  4WHU A;  5DFC A;  4QC3 A;  2I8N A;  4TYL A;  5I40 A;  5DYX A;  5ETD A;  2F6N A;  5DBM A;  4UYF B;  4QY4 A;  5ETB A;  4Z6H A;  5I88 A;  5D7X A;  5EIC A;  4O75 A;  4J0R A;  2G4A A;  5C7N A;  3UVY A;  4QSX A;  4QSV A;  3MQM A;  5ENB A;  3AAD A;  5EPB A;  5FG4 A;  5JI8 A;  4NYV A;  4O76 A;  5C87 A;  3HMH A;  4YAX A;  4Z1Q A;  4O71 A;  4KV4 A;  3SVG A;  5CRM A;  4HXR A;  2F6J A;  5AMF A;  4QR5 A;  2OUO A;  2YEK A;  4MEN A;  4CLB A;  4YAB A;  2L84 A;  4O72 A;  3UV2 A;  2R10 A;  4CL9 A;  5LVQ A;  4A9O A;  5E7D A;  2GRC A;  5EWW A;  5L96 A;  5K29 A;  4A9M A;  5CGP A;  4NYX A;  5I7X A;  4HXS A;  5DYA A;  2DKW A;  5F5Z A;  3U5K A;  5D3R A;  4YY6 A;  5HJC A;  5HQ7 A;  4CUT A;  3P1D A;  5LKU A;  5KU3 A;  3P1C A;  5A5R A;  5FBX A;  5KTX A;  4C66 A;  4HBX A;  2MJV B;  3IU6 A;  4O7B A;  5FFY A;  5D3L A;  2L5E A;  5C8G A;  4UIV A;  5EV9 A;  5HFR A;  4XY8 A;  5CS8 A;  4CUS A;  4QUU A;  4O7C A;  4MR4 A;  5HCL A;  5A5Q A;  1JSP B;  5ENC A;  4HBY A;  4UIX A;  4UYD A;  5C85 A;  3U5N A;  4HXL A;  5FE5 A;  4TU6 A;  5FE2 A;  4NUC A;  5CZG A;  4QZS A;  4TZ8 A;  3O36 A;  1WUM A;  4NR4 A;  5HEM A;  4F3I A;  4PCE A;  4PY6 A;  4A9N A;  3MUK A;  4QC1 A;  5CUC A;  4QSP A;  5A5P A;  1E6I A;  2RFJ A;  4IR3 A;  5L8T A;  5IG6 A;  4NQM A;  3P1E A;  4A9E A;  5I1Q A;  4Z93 A;  2N9G A;  4QBM A;  1EQF A;  2E7N A;  4UIY A;  4QEW A;  5DKC A;  4Q0O A;  5KTU A;  5II2 A;  2WP1 A;  3O34 A;  5FH8 A;  3MXF A;  5CUG A;  4NUD A;  5ENE A;  4CUU A;  5C4Q A;  5DLZ A;  4UIW A;  5D3T A;  4YBM A;  5F1L A;  2RO1 A;  2YYN A;  4DON A;  5DY7 A;  2E3K A;  4N4H A;  3LQJ A;  4XY9 A;  4YC9 A;  4IOO A;  4OGJ A;  5D3J A;  3UVX A;  4LZR A;  4TZ2 A;  5AME A;  5F60 A;  4PCI A;  3DWY A;  4Y03 A;  5IGN A;  5E9Y A;  5HRV A;  5H1U A;  2E7O A;  4YYD A;  3LXJ A;  3G0L A;  3P5O A;  3FKM X;  4LYW A;  4YYI A;  4NS5 A;  4OUF A;  3ZYU A;  3LQH A;  4XUA A;  3P1F A;  3RCW A;  3JVJ A;  4PTB A;  5A5O A;  5C89 A;  4NR5 A;  4N4F A;  5L99 A;  4QEV A;  2RI7 A;  5D3H A;  4QST A;  4YBT A;  5E9I A;  5D0C A;  4KCX A;  2OO1 A;  4QR3 A;  4AKN A;  5CQ6 A;  5F63 A;  4LRG A;  4QUT A;  5DW1 A;  5FB1 A;  4YYN A;  5EP7 A;  5EM3 A;  4X2I A;  2D9E A;  4NYW A;  4O74 A;  5DX4 A;  2RNY A;  4YYH A;  5L97 A;  5EWH A;  2KTB B;  4LZS A;  4YAT A;  5CQ5 A;  5FFV A;  5E9M A;  3K2J A;  5A5N A;  4YY4 A;  2D82 A;  5EIS A;  5G4R A;  4IR6 A;  5CQ8 A;  4IR4 A;  2DVR A;  4PKL A;  5EK9 A;  5KO4 A;  5A85 A;  2I7K A;  5A7C A;  4UYF A;  5EPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...