5EU1A

Crystal structure of brd9 in complex with bi-7273
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRD9
publication title Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5eu1A00
4XY9A 5G4RA 5CY9A 3UV5A 5D3HA 4OUFA 3U5PA 5E9IA 2KTBB 4Z6HA 4TTEA 3O36A 4LC2A 3UV2A 4TU6A 4NR9A 4N4FA 4YBSA 4TT2A 2YW5A 4FLPA 5E3GA 5ENHA 4N3WA 5EPRA 4WIVA 2YELA 5A5QA 3G0LA 3ZYUA 5ENGA 2DWWA 4O71A 4NS5A 4TT4A 3QZTA 5I86A 5FB0A 3JVJA 2RFJA 4O70A 1N72A 5F2PA 5L99A 4TYLA 5ENEA 5FE3A 4UIZA 4YH4A 4Z93A 5CUCA 3HMFA 2RO1A 4A9OA 5EI4A 4NUDA 4HXLA 4YYKA 3JVKA 3D7CA 2L85A 3NXBA 5A83A 3O34A 5L98A 3P5OA 2DVQA 5J0DA 5EWWA 4LRGA 3SVGA 5AMFA 5I1QA 5FE2A 4YYNA 4TU4A 5EWVA 4QSSA 4CUQA 4YYDA 5BT3A 5A85A 4O72A 4BHWA 5C4QA 5DFCA 5KTXA 5HFRA 5G4SA 5C85A 4O78A 4QR4A 5D3PA 5DKHA 4MEOA 4HXNA 4CL9A 5FE4A 4QEWA 4Z1SA 5ENBA 4AKNA 5CP5A 5CQ3A 4NYVA 4YH3A 5I89A 3RCWA 5EM3A 4CLBA 4CUPA 5D7XA 2DATA 4QY4A 4GPJA 4MR3A 4CUTA 5AD2A 5LKZA 5H1VA 4KV4A 4HXKA 3SVHA 2DVSA 1JSPB 4NRAA 5DBMA 4XUBA 1JM4B 5CFWA 1F68A 4NUEA 5COIA 3U5LA 4YYGA 3UVXA 5F36A 1E6IA 5D3SA 4BJXA 3G0JA 3UVWA 4TS8A 5F1LA 5BT4A 4PKLA 4TT6A 2LSPB 5CQ5A 4NRCA 2I8NA 5FB1A 4BW1A 5EP7A 4KCXA 5LJ1A 2G4AA 5DYXA 4O76A 3U5OA 4UIUA 4O7FA 5HRXA 5ETBA 5I40A 4UYFB 5E0RA 4YYJA 3MUKA 4QSXA 4YYMA 5FE6A 2D9EA 5I7YA 5IBNA 5IGKA 4J1PA 2N9GA 5CRMA 5DLXA 2RNWA 5FH7A 4LDFA 4CURA 4YATA 5IGMA 5F5ZA 2OO1A 5D3JA 4A9JA 5F25A 4MR6A 5CQ7A 4PY6A 4CFKA 4UYEA 2F6JA 5AMEA 4QYDA 5D3NA 5FG6A 3AQAA 4IORA 4NUCA 5DW2A 3LQHA 5KHMA 5FE0A 5I88A 5E73A 4CFLA 3P1CA 4HBYA 4LZRA 5CQ4A 4QYLA 3U5JA 2YEKA 5ENFA 5ENIA 4A9HA 3Q2FA 2GRCA 5D25A 4NYXA 4C66A 2RS9B 5IIDA 2R0VA 4O7AA 4PCEA 3O35A 5CS8A 4Z6IA 4NR6A 4YC9A 2R0SA 4N4GA 4YBMA 4HXPA 5KTUA 1X0JA 5F1HA 5FFWA 2DVVA 4QSPA 2H60A 2RNXA 5EQ1A 5II1A 4UYDA 5CQ8A 4HXSA 5CUDA 2F6NA 5IGNA 3S91A 3P1EA 4XYAA 4A9IA 4YY6A 4CUUA 4NRBA 4QSTA 4PS5A 3JVLA 4E96A 5I83A 2L5EA 4J0SA 5LUUA 4QR5A 5L97A 4NXJA 5E9KA 5FFYA 4NQNA 5E7DA 5AD3A 5HRWA 5HCLA 5LVQA 4OGIA 5ENCA 5HLSA 3UVYA 5CUGA 4MR4A 4QB3A 4HXOA 5II2A 4ALGA 5D26A 4QUTA 3IU5A 2R0YA 3U5MA 2RNYA 4YAXA 5CZGA 4MENA 5LKUA 4HBWA 5EK9A 5DYCA 5F61A 5D24A 4Q0NA 5C7NA 5D3TA 4NR5A 5EPSA 5LJ2A 5FE7A 4QNSA 3MB3A 5DFDA 4UYFA 5L8UA 2YEMA 5A82A 4F3IA 4UYGA 5EWCA 5FDZA 4YYIA 4QEVA 3QZSA 3UVDA 4QSWA 5EICA 4QBMA 4PTBA 3U5NA 3UW9A 4HXRA 5KTWA 3LJWA 4YY4A 5LJ0A 4IR6A 1ZS5A 5FE9A 4Q0OA 4TQNA 5ETDA 3P1DA 2E7OA 5HM0A 4YK0A 5FH6A 4A9EA 2E3KA 4YYHA 4A9KA 4UYHA 4QSUA 5A5PA 5CQTA 4KV1A 4LZSA 4N4IA 4BW3A 5CQAA 4YBTA 4Y03A 5EVAA 4WHWA 3SVFA 2OUOA 4O77A 5CPEA 5I29A 4QUUA 5HJCA 4YABA 3K2JA 5CTLA 5IG6A 4QC3A 5CQ6A 5KU3A 4QSRA 5HEMA 3GG3A 4ZW1A 5E9VA 4QSQA 4ALHA 2OSSA 5A5NA 4O7CA 3DAIA 5DFBA 5D3RA 4A9LA 2DKWA 5EWHA 2NXBA 4LYWA 5TCMA 3TLPA 3DWYA 3LQIA 4UIWA 4PCIA 4ZQLA 5BT5A 3S92A 5HQ6A 5HFQA 5A5RA 4RVRA 5TB6A 2D82A 4O74A 5C8GA 5HELA 5L96A 5FG4A 5DKCA 2MJVB 5JI8A 3QZVA 3ONIA 4IOQA 5CRZA 5IGLA 2WP2A 3LXJA 5ACYA 5C89A 3UV4A 4LYIA 4QZSA 5FE1A 3FKMX 4N4HA 3Q2EA 5KO4A 4C67A 5A81A 5FH8A 3MB4A 5HQ5A 4LYSA 4O7BA 4UIYA 5F62A 5E9LA 2I7KA 1EQFA 4BW2A 5A7CA 4TZ2A 3MQMA 4QC1A 4A9NA 5E9YA 4LZ2A 5HQ7A 5DLZA 5CU8A 4LR6A 3P1FA 5LKTA 5CUEA 5I80A 3IU6A 5DKDA 4J0RA 5F63A 4OGJA 5LKXA 4A9FA 5ENJA 5K29A 5EWDA 4IR5A 5H85A 5F3AA 5E74A 4NR8A 4WHUA 3LQJA 2YDWA 4ZC9A 4IR4A 5EISA 4XUAA 2L84A 2YQDA 5FG5A 2E7NA 5DYUA 5DYAA 2DVRA 2WP1A 5LVRA 5CGPA 4NYWA 4HXMA 4YADA 5DY7A 5HRVA 4QEUA 1WUMA 4A9MA 2YYNA 3JVMA 4HBVA 4UIVA 5A5OA 2FSAA 4HBXA 4MR5A 5E3DA 5EPBA 4J3IA 4UITA 4NR4A 3MULA 5F60A 5D0CA 3MXFA 4MEPA 3U5KA 4NQMA 5FE8A 4UIXA 4QSVA 5EGUA 2RI7A 5I7XA 4BW4A 3I3JA 5CUAA 5A5SA 5EA1A 5DW1A 5HENA 4QR3A 5L8TA 4O75A 4O7EA 5EV9A 1WUGA 5C87A 5DX4A 4DONA 3HMHA 5H1UA 5FBXA 4X2IA 5CUBA 3O33A 5E9MA 4MEQA 4IR3A 4NR7A 5D3LA 4Z1QA 5FFVA 3HMEA 4XY8A 5EU1A 4IOOA 3AADA 4TZ8A 5JWMA 3O37A 2R10A 5H1TA 5FE5A 4CUSA
chains in the Genus database with same CATH superfamily
4XY9A 5G4RA 5CY9A 3UV5A 5D3HA 4OUFA 3U5PA 5E9IA 2KTBB 4Z6HA 4TTEA 3O36A 4LC2A 3UV2A 4TU6A 4NR9A 4N4FA 4YBSA 4TT2A 2YW5A 4FLPA 5E3GA 5ENHA 4N3WA 5EPRA 4WIVA 2YELA 5A5QA 3G0LA 3ZYUA 5ENGA 2DWWA 4O71A 4NS5A 4TT4A 3QZTA 5I86A 5FB0A 3JVJA 2RFJA 4O70A 1N72A 5F2PA 5L99A 4TYLA 5ENEA 5FE3A 4UIZA 4YH4A 4Z93A 5CUCA 3HMFA 2RO1A 4A9OA 5EI4A 4NUDA 4HXLA 4YYKA 3JVKA 3D7CA 2L85A 3NXBA 5A83A 3O34A 5L98A 3P5OA 2DVQA 5J0DA 5EWWA 4LRGA 3SVGA 5AMFA 5I1QA 5FE2A 4YYNA 4TU4A 5EWVA 4QSSA 4CUQA 4YYDA 5BT3A 5A85A 4O72A 4BHWA 5C4QA 5DFCA 5KTXA 5HFRA 5G4SA 5C85A 4O78A 4QR4A 5D3PA 5DKHA 4MEOA 4HXNA 4CL9A 5FE4A 4QEWA 4Z1SA 5ENBA 4AKNA 5CP5A 5CQ3A 4NYVA 4YH3A 5I89A 3RCWA 5EM3A 4CLBA 4CUPA 2DATA 4QY4A 5D7XA 4GPJA 4MR3A 4CUTA 5AD2A 5LKZA 5H1VA 4KV4A 4HXKA 3SVHA 2DVSA 1JSPB 4NRAA 5DBMA 4XUBA 1JM4B 5CFWA 1F68A 4NUEA 5COIA 3U5LA 4YYGA 3UVXA 5F36A 1E6IA 5D3SA 4BJXA 3G0JA 3UVWA 4TS8A 5F1LA 5BT4A 4PKLA 4TT6A 2LSPB 2EJNA 5CQ5A 4NRCA 2I8NA 5FB1A 4BW1A 5EP7A 4KCXA 5LJ1A 2G4AA 5DYXA 4O76A 3U5OA 3ERRA 4UIUA 4O7FA 5HRXA 5ETBA 5I40A 4UYFB 5E0RA 4YYJA 3MUKA 4QSXA 4YYMA 5FE6A 2D9EA 5I7YA 5IBNA 5IGKA 4J1PA 2N9GA 5CRMA 5DLXA 2RNWA 5FH7A 4LDFA 3D1DA 4CURA 4YATA 5IGMA 5F5ZA 2OO1A 5D3JA 3D1BA 4A9JA 5F25A 4MR6A 5CQ7A 4PY6A 4CFKA 4UYEA 2F6JA 5AMEA 4QYDA 5D3NA 5FG6A 3AQAA 4IORA 4NUCA 5DW2A 3LQHA 5KHMA 5FE0A 5I88A 5E73A 4CFLA 3P1CA 4HBYA 4LZRA 5CQ4A 4QYLA 3U5JA 2YEKA 5ENFA 5ENIA 4A9HA 3Q2FA 2GRCA 5D25A 4NYXA 4C66A 2RS9B 5IIDA 2R0VA 4O7AA 4PCEA 3O35A 5CS8A 4Z6IA 4NR6A 4YC9A 2R0SA 4N4GA 4YBMA 4HXPA 5KTUA 1X0JA 5F1HA 5FFWA 2DVVA 4QSPA 2H60A 2RNXA 5EQ1A 5II1A 4UYDA 5CQ8A 4HXSA 5CUDA 2F6NA 5IGNA 3S91A 3P1EA 4XYAA 4A9IA 4YY6A 4CUUA 4NRBA 4QSTA 4PS5A 3JVLA 4E96A 5I83A 2L5EA 4J0SA 5LUUA 4QR5A 5L97A 4NXJA 5E9KA 5FFYA 4NQNA 5E7DA 5AD3A 5HRWA 5HCLA 5LVQA 4OGIA 5ENCA 5HLSA 3UVYA 5CUGA 4MR4A 4QB3A 4HXOA 5II2A 4ALGA 5D26A 4QUTA 3IU5A 4AKGA 2R0YA 3U5MA 2RNYA 4YAXA 5CZGA 4MENA 5LKUA 4HBWA 5EK9A 5DYCA 5F61A 3VKHA 5D24A 4Q0NA 5C7NA 5D3TA 4NR5A 5EPSA 5LJ2A 5FE7A 4QNSA 3MB3A 5DFDA 4UYFA 5L8UA 2YEMA 3VKGA 1PUOA 5A82A 4F3IA 4UYGA 5EWCA 5FDZA 4YYIA 4QEVA 3QZSA 3UVDA 4QSWA 5EICA 4QBMA 4PTBA 3U5NA 3UW9A 4HXRA 5KTWA 3LJWA 4YY4A 5LJ0A 4IR6A 1ZS5A 5FE9A 4Q0OA 4TQNA 5ETDA 3P1DA 2E7OA 5HM0A 4YK0A 5FH6A 4A9EA 2E3KA 4YYHA 4A9KA 4UYHA 4QSUA 5A5PA 5CQTA 4KV1A 4LZSA 4N4IA 4BW3A 5CQAA 4YBTA 4Y03A 5EVAA 4WHWA 3SVFA 2OUOA 4O77A 5CPEA 5I29A 4QUUA 5HJCA 4YABA 3K2JA 5CTLA 5IG6A 4QC3A 5CQ6A 5KU3A 4QSRA 5HEMA 3GG3A 4ZW1A 5E9VA 4QSQA 4ALHA 2OSSA 5A5NA 4O7CA 3DAIA 5DFBA 5D3RA 4A9LA 2DKWA 5EWHA 2NXBA 4LYWA 5TCMA 3TLPA 3DWYA 3LQIA 4UIWA 4PCIA 4ZQLA 5BT5A 3S92A 5HQ6A 5HFQA 5A5RA 4RVRA 5TB6A 2D82A 4O74A 5C8GA 5HELA 5L96A 5FG4A 5DKCA 2MJVB 5JI8A 3QZVA 3ONIA 4IOQA 5CRZA 5IGLA 4AKHA 2WP2A 3LXJA 5ACYA 5C89A 3UV4A 4LYIA 4QZSA 5FE1A 3FKMX 4N4HA 3Q2EA 5KO4A 4C67A 5A81A 5FH8A 3MB4A 5HQ5A 4LYSA 4O7BA 4UIYA 4AI6A 5F62A 5E9LA 2I7KA 1EQFA 4BW2A 5A7CA 4TZ2A 3MQMA 4QC1A 4A9NA 5E9YA 4LZ2A 5HQ7A 5DLZA 5CU8A 4AKIA 4LR6A 3P1FA 5LKTA 5CUEA 5I80A 3IU6A 5DKDA 4J0RA 5F63A 4OGJA 5LKXA 4A9FA 5ENJA 5K29A 5EWDA 4IR5A 5H85A 5F3AA 5E74A 4NR8A 4WHUA 3LQJA 2YDWA 4ZC9A 4IR4A 5EISA 4XUAA 2L84A 2YQDA 5FG5A 2E7NA 5DYUA 5DYAA 1ZKRA 2DVRA 2WP1A 5LVRA 5CGPA 4NYWA 4HXMA 4YADA 5DY7A 5HRVA 4QEUA 1WUMA 4A9MA 2YYNA 3JVMA 4HBVA 4UIVA 5A5OA 2FSAA 4HBXA 4MR5A 5E3DA 5EPBA 4J3IA 4UITA 4NR4A 3MULA 5F60A 5D0CA 3MXFA 4MEPA 3U5KA 4NQMA 5FE8A 4UIXA 4QSVA 5EGUA 2RI7A 5I7XA 4BW4A 3I3JA 5CUAA 5A5SA 5EA1A 5DW1A 5HENA 4QR3A 5L8TA 4O75A 4O7EA 5EV9A 1WUGA 5C87A 5DX4A 4DONA 3HMHA 5H1UA 5FBXA 4X2IA 5CUBA 3O33A 5E9MA 4MEQA 4IR3A 4NR7A 5D3LA 4Z1QA 5FFVA 3HMEA 4XY8A 5EU1A 4IOOA 3AADA 4TZ8A 5JWMA 3O37A 2R10A 5H1TA 5FE5A 4CUSA
chains in the Genus database with same CATH topology
4XY9A 5G4RA 5CY9A 3UV5A 5D3HA 4OUFA 3U5PA 5E9IA 2KTBB 4Z6HA 4TTEA 3O36A 4LC2A 3UV2A 4TU6A 4NR9A 4N4FA 4YBSA 4TT2A 2YW5A 4FLPA 5E3GA 5ENHA 4N3WA 5EPRA 4WIVA 2YELA 5A5QA 3G0LA 3ZYUA 5ENGA 2DWWA 4O71A 4NS5A 4TT4A 3QZTA 5I86A 5FB0A 3JVJA 2RFJA 4O70A 1N72A 5F2PA 5L99A 4TYLA 5ENEA 5FE3A 4UIZA 4YH4A 4Z93A 5CUCA 3HMFA 2RO1A 4A9OA 5EI4A 4NUDA 4HXLA 4YYKA 3JVKA 3D7CA 2L85A 3NXBA 5A83A 3O34A 5L98A 3P5OA 2DVQA 5J0DA 5EWWA 4LRGA 3SVGA 5AMFA 5I1QA 5FE2A 4YYNA 4TU4A 5EWVA 4QSSA 4CUQA 4YYDA 5BT3A 5A85A 4O72A 4BHWA 5C4QA 5DFCA 5KTXA 5HFRA 5G4SA 5C85A 4O78A 4QR4A 5D3PA 5DKHA 4MEOA 4HXNA 4CL9A 5FE4A 4QEWA 4Z1SA 5ENBA 4AKNA 5CP5A 5CQ3A 4NYVA 4YH3A 5I89A 3RCWA 5EM3A 4CLBA 4CUPA 5D7XA 2DATA 4QY4A 4GPJA 4MR3A 4CUTA 5AD2A 5LKZA 5H1VA 4KV4A 4HXKA 3SVHA 2DVSA 1JSPB 4NRAA 5DBMA 4XUBA 1JM4B 5CFWA 1F68A 4NUEA 5COIA 3U5LA 4YYGA 3UVXA 5F36A 1E6IA 5D3SA 4BJXA 3G0JA 3UVWA 4TS8A 5F1LA 5BT4A 4PKLA 4TT6A 2LSPB 5CQ5A 4NRCA 2I8NA 5FB1A 4BW1A 5EP7A 4KCXA 5LJ1A 2G4AA 5DYXA 4O76A 3U5OA 4UIUA 4O7FA 5HRXA 5ETBA 5I40A 4UYFB 5E0RA 4YYJA 3MUKA 4QSXA 4YYMA 5FE6A 2D9EA 5I7YA 5IBNA 5IGKA 4J1PA 2N9GA 5CRMA 5DLXA 2RNWA 5FH7A 4LDFA 4CURA 4YATA 5IGMA 5F5ZA 2OO1A 5D3JA 4A9JA 5F25A 4MR6A 5CQ7A 4PY6A 4CFKA 4UYEA 2F6JA 5AMEA 4QYDA 5D3NA 5FG6A 3AQAA 4IORA 4NUCA 5DW2A 3LQHA 5KHMA 5FE0A 5I88A 5E73A 4CFLA 3P1CA 4HBYA 4LZRA 5CQ4A 4QYLA 3U5JA 2YEKA 5ENFA 5ENIA 4A9HA 3Q2FA 2GRCA 5D25A 4NYXA 4C66A 2RS9B 5IIDA 2R0VA 4O7AA 4PCEA 3O35A 5CS8A 4Z6IA 4NR6A 4YC9A 2R0SA 4N4GA 4YBMA 4HXPA 5KTUA 1X0JA 5F1HA 5FFWA 2DVVA 4QSPA 2H60A 2RNXA 5EQ1A 5II1A 4UYDA 5CQ8A 4HXSA 5CUDA 2F6NA 5IGNA 3S91A 3P1EA 4XYAA 4A9IA 4YY6A 4CUUA 4NRBA 4QSTA 4PS5A 3JVLA 4E96A 5I83A 2L5EA 4J0SA 5LUUA 4QR5A 5L97A 4NXJA 5E9KA 5FFYA 4NQNA 5E7DA 5AD3A 5HRWA 5HCLA 5LVQA 4OGIA 5ENCA 5HLSA 3UVYA 5CUGA 4MR4A 4QB3A 4HXOA 5II2A 4ALGA 5D26A 4QUTA 3IU5A 2R0YA 3U5MA 2RNYA 4YAXA 5CZGA 4MENA 5LKUA 4HBWA 5EK9A 5DYCA 5F61A 5D24A 4Q0NA 5C7NA 5D3TA 4NR5A 5EPSA 5LJ2A 5FE7A 4QNSA 3MB3A 5DFDA 4UYFA 5L8UA 2YEMA 5A82A 4F3IA 4UYGA 5EWCA 5FDZA 4YYIA 4QEVA 3QZSA 3UVDA 4QSWA 5EICA 4QBMA 4PTBA 3U5NA 3UW9A 4HXRA 5KTWA 3LJWA 4YY4A 5LJ0A 4IR6A 1ZS5A 5FE9A 4Q0OA 4TQNA 5ETDA 3P1DA 2E7OA 5HM0A 4YK0A 5FH6A 4A9EA 2E3KA 4YYHA 4A9KA 4UYHA 4QSUA 5A5PA 5CQTA 4KV1A 4LZSA 4N4IA 4BW3A 5CQAA 4YBTA 4Y03A 5EVAA 4WHWA 3SVFA 2OUOA 4O77A 5CPEA 5I29A 4QUUA 5HJCA 4YABA 3K2JA 5CTLA 5IG6A 4QC3A 5CQ6A 5KU3A 4QSRA 5HEMA 3GG3A 4ZW1A 5E9VA 4QSQA 4ALHA 2OSSA 5A5NA 4O7CA 3DAIA 5DFBA 5D3RA 4A9LA 2DKWA 5EWHA 2NXBA 4LYWA 5TCMA 3TLPA 3DWYA 3LQIA 4UIWA 4PCIA 4ZQLA 5BT5A 3S92A 5HQ6A 5HFQA 5A5RA 4RVRA 5TB6A 2D82A 4O74A 5C8GA 5HELA 5L96A 5FG4A 5DKCA 2MJVB 5JI8A 3QZVA 3ONIA 4IOQA 5CRZA 5IGLA 2WP2A 3LXJA 5ACYA 5C89A 3UV4A 4LYIA 4QZSA 5FE1A 3FKMX 4N4HA 3Q2EA 5KO4A 4C67A 5A81A 5FH8A 3MB4A 5HQ5A 4LYSA 4O7BA 4UIYA 5F62A 5E9LA 2I7KA 1EQFA 4BW2A 5A7CA 4TZ2A 3MQMA 4QC1A 4A9NA 5E9YA 4LZ2A 5HQ7A 5DLZA 5CU8A 4LR6A 3P1FA 5LKTA 5CUEA 5I80A 3IU6A 5DKDA 4J0RA 5F63A 4OGJA 5LKXA 4A9FA 5ENJA 5K29A 5EWDA 4IR5A 5H85A 5F3AA 5E74A 4NR8A 4WHUA 3LQJA 2YDWA 4ZC9A 4IR4A 5EISA 4XUAA 2L84A 2YQDA 5FG5A 2E7NA 5DYUA 5DYAA 2DVRA 2WP1A 5LVRA 5CGPA 4NYWA 4HXMA 4YADA 5DY7A 5HRVA 4QEUA 1WUMA 4A9MA 2YYNA 3JVMA 4HBVA 4UIVA 5A5OA 2FSAA 4HBXA 4MR5A 5E3DA 5EPBA 4J3IA 4UITA 4NR4A 3MULA 5F60A 5D0CA 3MXFA 4MEPA 3U5KA 4NQMA 5FE8A 4UIXA 4QSVA 5EGUA 2RI7A 5I7XA 4BW4A 3I3JA 5CUAA 5A5SA 5EA1A 5DW1A 5HENA 4QR3A 5L8TA 4O75A 4O7EA 5EV9A 1WUGA 5C87A 5DX4A 4DONA 3HMHA 5H1UA 5FBXA 4X2IA 5CUBA 3O33A 5E9MA 4MEQA 4IR3A 4NR7A 5D3LA 4Z1QA 5FFVA 3HMEA 4XY8A 5EU1A 4IOOA 3AADA 4TZ8A 5JWMA 3O37A 2R10A 5H1TA 5FE5A 4CUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XY9 A;  5G4R A;  5CY9 A;  3UV5 A;  5D3H A;  4OUF A;  3U5P A;  5E9I A;  2KTB B;  4Z6H A;  4TTE A;  3O36 A;  4LC2 A;  3UV2 A;  4TU6 A;  4NR9 A;  4N4F A;  4YBS A;  4TT2 A;  2YW5 A;  4FLP A;  5E3G A;  5ENH A;  4N3W A;  5EPR A;  4WIV A;  2YEL A;  5A5Q A;  3G0L A;  3ZYU A;  5ENG A;  2DWW A;  4O71 A;  4NS5 A;  4TT4 A;  3QZT A;  5I86 A;  5FB0 A;  3JVJ A;  2RFJ A;  4O70 A;  1N72 A;  5F2P A;  5L99 A;  4TYL A;  5ENE A;  5FE3 A;  4UIZ A;  4YH4 A;  4Z93 A;  5CUC A;  3HMF A;  2RO1 A;  4A9O A;  5EI4 A;  4NUD A;  4HXL A;  4YYK A;  3JVK A;  3D7C A;  2L85 A;  3NXB A;  5A83 A;  3O34 A;  5L98 A;  3P5O A;  2DVQ A;  5J0D A;  5EWW A;  4LRG A;  3SVG A;  5AMF A;  5I1Q A;  5FE2 A;  4YYN A;  4TU4 A;  5EWV A;  4QSS A;  4CUQ A;  4YYD A;  5BT3 A;  5A85 A;  4O72 A;  4BHW A;  5C4Q A;  5DFC A;  5KTX A;  5HFR A;  5G4S A;  5C85 A;  4O78 A;  4QR4 A;  5D3P A;  5DKH A;  4MEO A;  4HXN A;  4CL9 A;  5FE4 A;  4QEW A;  4Z1S A;  5ENB A;  4AKN A;  5CP5 A;  5CQ3 A;  4NYV A;  4YH3 A;  5I89 A;  3RCW A;  5EM3 A;  4CLB A;  4CUP A;  5D7X A;  2DAT A;  4QY4 A;  4GPJ A;  4MR3 A;  4CUT A;  5AD2 A;  5LKZ A;  5H1V A;  4KV4 A;  4HXK A;  3SVH A;  2DVS A;  1JSP B;  4NRA A;  5DBM A;  4XUB A;  1JM4 B;  5CFW A;  1F68 A;  4NUE A;  5COI A;  3U5L A;  4YYG A;  3UVX A;  5F36 A;  1E6I A;  5D3S A;  4BJX A;  3G0J A;  3UVW A;  4TS8 A;  5F1L A;  5BT4 A;  4PKL A;  4TT6 A;  2LSP B;  5CQ5 A;  4NRC A;  2I8N A;  5FB1 A;  4BW1 A;  5EP7 A;  4KCX A;  5LJ1 A;  2G4A A;  5DYX A;  4O76 A;  3U5O A;  4UIU A;  4O7F A;  5HRX A;  5ETB A;  5I40 A;  4UYF B;  5E0R A;  4YYJ A;  3MUK A;  4QSX A;  4YYM A;  5FE6 A;  2D9E A;  5I7Y A;  5IBN A;  5IGK A;  4J1P A;  2N9G A;  5CRM A;  5DLX A;  2RNW A;  5FH7 A;  4LDF A;  4CUR A;  4YAT A;  5IGM A;  5F5Z A;  2OO1 A;  5D3J A;  4A9J A;  5F25 A;  4MR6 A;  5CQ7 A;  4PY6 A;  4CFK A;  4UYE A;  2F6J A;  5AME A;  4QYD A;  5D3N A;  5FG6 A;  3AQA A;  4IOR A;  4NUC A;  5DW2 A;  3LQH A;  5KHM A;  5FE0 A;  5I88 A;  5E73 A;  4CFL A;  3P1C A;  4HBY A;  4LZR A;  5CQ4 A;  4QYL A;  3U5J A;  2YEK A;  5ENF A;  5ENI A;  4A9H A;  3Q2F A;  2GRC A;  5D25 A;  4NYX A;  4C66 A;  2RS9 B;  5IID A;  2R0V A;  4O7A A;  4PCE A;  3O35 A;  5CS8 A;  4Z6I A;  4NR6 A;  4YC9 A;  2R0S A;  4N4G A;  4YBM A;  4HXP A;  5KTU A;  1X0J A;  5F1H A;  5FFW A;  2DVV A;  4QSP A;  2H60 A;  2RNX A;  5EQ1 A;  5II1 A;  4UYD A;  5CQ8 A;  4HXS A;  5CUD A;  2F6N A;  5IGN A;  3S91 A;  3P1E A;  4XYA A;  4A9I A;  4YY6 A;  4CUU A;  4NRB A;  4QST A;  4PS5 A;  3JVL A;  4E96 A;  5I83 A;  2L5E A;  4J0S A;  5LUU A;  4QR5 A;  5L97 A;  4NXJ A;  5E9K A;  5FFY A;  4NQN A;  5E7D A;  5AD3 A;  5HRW A;  5HCL A;  5LVQ A;  4OGI A;  5ENC A;  5HLS A;  3UVY A;  5CUG A;  4MR4 A;  4QB3 A;  4HXO A;  5II2 A;  4ALG A;  5D26 A;  4QUT A;  3IU5 A;  2R0Y A;  3U5M A;  2RNY A;  4YAX A;  5CZG A;  4MEN A;  5LKU A;  4HBW A;  5EK9 A;  5DYC A;  5F61 A;  5D24 A;  4Q0N A;  5C7N A;  5D3T A;  4NR5 A;  5EPS A;  5LJ2 A;  5FE7 A;  4QNS A;  3MB3 A;  5DFD A;  4UYF A;  5L8U A;  2YEM A;  5A82 A;  4F3I A;  4UYG A;  5EWC A;  5FDZ A;  4YYI A;  4QEV A;  3QZS A;  3UVD A;  4QSW A;  5EIC A;  4QBM A;  4PTB A;  3U5N A;  3UW9 A;  4HXR A;  5KTW A;  3LJW A;  4YY4 A;  5LJ0 A;  4IR6 A;  1ZS5 A;  5FE9 A;  4Q0O A;  4TQN A;  5ETD A;  3P1D A;  2E7O A;  5HM0 A;  4YK0 A;  5FH6 A;  4A9E A;  2E3K A;  4YYH A;  4A9K A;  4UYH A;  4QSU A;  5A5P A;  5CQT A;  4KV1 A;  4LZS A;  4N4I A;  4BW3 A;  5CQA A;  4YBT A;  4Y03 A;  5EVA A;  4WHW A;  3SVF A;  2OUO A;  4O77 A;  5CPE A;  5I29 A;  4QUU A;  5HJC A;  4YAB A;  3K2J A;  5CTL A;  5IG6 A;  4QC3 A;  5CQ6 A;  5KU3 A;  4QSR A;  5HEM A;  3GG3 A;  4ZW1 A;  5E9V A;  4QSQ A;  4ALH A;  2OSS A;  5A5N A;  4O7C A;  3DAI A;  5DFB A;  5D3R A;  4A9L A;  2DKW A;  5EWH A;  2NXB A;  4LYW A;  5TCM A;  3TLP A;  3DWY A;  3LQI A;  4UIW A;  4PCI A;  4ZQL A;  5BT5 A;  3S92 A;  5HQ6 A;  5HFQ A;  5A5R A;  4RVR A;  5TB6 A;  2D82 A;  4O74 A;  5C8G A;  5HEL A;  5L96 A;  5FG4 A;  5DKC A;  2MJV B;  5JI8 A;  3QZV A;  3ONI A;  4IOQ A;  5CRZ A;  5IGL A;  2WP2 A;  3LXJ A;  5ACY A;  5C89 A;  3UV4 A;  4LYI A;  4QZS A;  5FE1 A;  3FKM X;  4N4H A;  3Q2E A;  5KO4 A;  4C67 A;  5A81 A;  5FH8 A;  3MB4 A;  5HQ5 A;  4LYS A;  4O7B A;  4UIY A;  5F62 A;  5E9L A;  2I7K A;  1EQF A;  4BW2 A;  5A7C A;  4TZ2 A;  3MQM A;  4QC1 A;  4A9N A;  5E9Y A;  4LZ2 A;  5HQ7 A;  5DLZ A;  5CU8 A;  4LR6 A;  3P1F A;  5LKT A;  5CUE A;  5I80 A;  3IU6 A;  5DKD A;  4J0R A;  5F63 A;  4OGJ A;  5LKX A;  4A9F A;  5ENJ A;  5K29 A;  5EWD A;  4IR5 A;  5H85 A;  5F3A A;  5E74 A;  4NR8 A;  4WHU A;  3LQJ A;  2YDW A;  4ZC9 A;  4IR4 A;  5EIS A;  4XUA A;  2L84 A;  2YQD A;  5FG5 A;  2E7N A;  5DYU A;  5DYA A;  2DVR A;  2WP1 A;  5LVR A;  5CGP A;  4NYW A;  4HXM A;  4YAD A;  5DY7 A;  5HRV A;  4QEU A;  1WUM A;  4A9M A;  2YYN A;  3JVM A;  4HBV A;  4UIV A;  5A5O A;  2FSA A;  4HBX A;  4MR5 A;  5E3D A;  5EPB A;  4J3I A;  4UIT A;  4NR4 A;  3MUL A;  5F60 A;  5D0C A;  3MXF A;  4MEP A;  3U5K A;  4NQM A;  5FE8 A;  4UIX A;  4QSV A;  5EGU A;  2RI7 A;  5I7X A;  4BW4 A;  3I3J A;  5CUA A;  5A5S A;  5EA1 A;  5DW1 A;  5HEN A;  4QR3 A;  5L8T A;  4O75 A;  4O7E A;  5EV9 A;  1WUG A;  5C87 A;  5DX4 A;  4DON A;  3HMH A;  5H1U A;  5FBX A;  4X2I A;  5CUB A;  3O33 A;  5E9M A;  4MEQ A;  4IR3 A;  4NR7 A;  5D3L A;  4Z1Q A;  5FFV A;  3HME A;  4XY8 A;  5EU1 A;  4IOO A;  3AAD A;  4TZ8 A;  5JWM A;  3O37 A;  2R10 A;  5H1T A;  5FE5 A;  4CUS A; 
#chains in the Genus database with same CATH topology
 4XY9 A;  5G4R A;  5CY9 A;  3UV5 A;  5D3H A;  4OUF A;  3U5P A;  5E9I A;  2KTB B;  4Z6H A;  4TTE A;  3O36 A;  4LC2 A;  3UV2 A;  4TU6 A;  4NR9 A;  4N4F A;  4YBS A;  4TT2 A;  2YW5 A;  4FLP A;  5E3G A;  5ENH A;  4N3W A;  5EPR A;  4WIV A;  2YEL A;  5A5Q A;  3G0L A;  3ZYU A;  5ENG A;  2DWW A;  4O71 A;  4NS5 A;  4TT4 A;  3QZT A;  5I86 A;  5FB0 A;  3JVJ A;  2RFJ A;  4O70 A;  1N72 A;  5F2P A;  5L99 A;  4TYL A;  5ENE A;  5FE3 A;  4UIZ A;  4YH4 A;  4Z93 A;  5CUC A;  3HMF A;  2RO1 A;  4A9O A;  5EI4 A;  4NUD A;  4HXL A;  4YYK A;  3JVK A;  3D7C A;  2L85 A;  3NXB A;  5A83 A;  3O34 A;  5L98 A;  3P5O A;  2DVQ A;  5J0D A;  5EWW A;  4LRG A;  3SVG A;  5AMF A;  5I1Q A;  5FE2 A;  4YYN A;  4TU4 A;  5EWV A;  4QSS A;  4CUQ A;  4YYD A;  5BT3 A;  5A85 A;  4O72 A;  4BHW A;  5C4Q A;  5DFC A;  5KTX A;  5HFR A;  5G4S A;  5C85 A;  4O78 A;  4QR4 A;  5D3P A;  5DKH A;  4MEO A;  4HXN A;  4CL9 A;  5FE4 A;  4QEW A;  4Z1S A;  5ENB A;  4AKN A;  5CP5 A;  5CQ3 A;  4NYV A;  4YH3 A;  5I89 A;  3RCW A;  5EM3 A;  4CLB A;  4CUP A;  2DAT A;  4QY4 A;  5D7X A;  4GPJ A;  4MR3 A;  4CUT A;  5AD2 A;  5LKZ A;  5H1V A;  4KV4 A;  4HXK A;  3SVH A;  2DVS A;  1JSP B;  4NRA A;  5DBM A;  4XUB A;  1JM4 B;  5CFW A;  1F68 A;  4NUE A;  5COI A;  3U5L A;  4YYG A;  3UVX A;  5F36 A;  1E6I A;  5D3S A;  4BJX A;  3G0J A;  3UVW A;  4TS8 A;  5F1L A;  5BT4 A;  4PKL A;  4TT6 A;  2LSP B;  2EJN A;  5CQ5 A;  4NRC A;  2I8N A;  5FB1 A;  4BW1 A;  5EP7 A;  4KCX A;  5LJ1 A;  2G4A A;  5DYX A;  4O76 A;  3U5O A;  3ERR A;  4UIU A;  4O7F A;  5HRX A;  5ETB A;  5I40 A;  4UYF B;  5E0R A;  4YYJ A;  3MUK A;  4QSX A;  4YYM A;  5FE6 A;  2D9E A;  5I7Y A;  5IBN A;  5IGK A;  4J1P A;  2N9G A;  5CRM A;  5DLX A;  2RNW A;  5FH7 A;  4LDF A;  3D1D A;  4CUR A;  4YAT A;  5IGM A;  5F5Z A;  2OO1 A;  5D3J A;  3D1B A;  4A9J A;  5F25 A;  4MR6 A;  5CQ7 A;  4PY6 A;  4CFK A;  4UYE A;  2F6J A;  5AME A;  4QYD A;  5D3N A;  5FG6 A;  3AQA A;  4IOR A;  4NUC A;  5DW2 A;  3LQH A;  5KHM A;  5FE0 A;  5I88 A;  5E73 A;  4CFL A;  3P1C A;  4HBY A;  4LZR A;  5CQ4 A;  4QYL A;  3U5J A;  2YEK A;  5ENF A;  5ENI A;  4A9H A;  3Q2F A;  2GRC A;  5D25 A;  4NYX A;  4C66 A;  2RS9 B;  5IID A;  2R0V A;  4O7A A;  4PCE A;  3O35 A;  5CS8 A;  4Z6I A;  4NR6 A;  4YC9 A;  2R0S A;  4N4G A;  4YBM A;  4HXP A;  5KTU A;  1X0J A;  5F1H A;  5FFW A;  2DVV A;  4QSP A;  2H60 A;  2RNX A;  5EQ1 A;  5II1 A;  4UYD A;  5CQ8 A;  4HXS A;  5CUD A;  2F6N A;  5IGN A;  3S91 A;  3P1E A;  4XYA A;  4A9I A;  4YY6 A;  4CUU A;  4NRB A;  4QST A;  4PS5 A;  3JVL A;  4E96 A;  5I83 A;  2L5E A;  4J0S A;  5LUU A;  4QR5 A;  5L97 A;  4NXJ A;  5E9K A;  5FFY A;  4NQN A;  5E7D A;  5AD3 A;  5HRW A;  5HCL A;  5LVQ A;  4OGI A;  5ENC A;  5HLS A;  3UVY A;  5CUG A;  4MR4 A;  4QB3 A;  4HXO A;  5II2 A;  4ALG A;  5D26 A;  4QUT A;  3IU5 A;  4AKG A;  2R0Y A;  3U5M A;  2RNY A;  4YAX A;  5CZG A;  4MEN A;  5LKU A;  4HBW A;  5EK9 A;  5DYC A;  5F61 A;  3VKH A;  5D24 A;  4Q0N A;  5C7N A;  5D3T A;  4NR5 A;  5EPS A;  5LJ2 A;  5FE7 A;  4QNS A;  3MB3 A;  5DFD A;  4UYF A;  5L8U A;  2YEM A;  3VKG A;  1PUO A;  5A82 A;  4F3I A;  4UYG A;  5EWC A;  5FDZ A;  4YYI A;  4QEV A;  3QZS A;  3UVD A;  4QSW A;  5EIC A;  4QBM A;  4PTB A;  3U5N A;  3UW9 A;  4HXR A;  5KTW A;  3LJW A;  4YY4 A;  5LJ0 A;  4IR6 A;  1ZS5 A;  5FE9 A;  4Q0O A;  4TQN A;  5ETD A;  3P1D A;  2E7O A;  5HM0 A;  4YK0 A;  5FH6 A;  4A9E A;  2E3K A;  4YYH A;  4A9K A;  4UYH A;  4QSU A;  5A5P A;  5CQT A;  4KV1 A;  4LZS A;  4N4I A;  4BW3 A;  5CQA A;  4YBT A;  4Y03 A;  5EVA A;  4WHW A;  3SVF A;  2OUO A;  4O77 A;  5CPE A;  5I29 A;  4QUU A;  5HJC A;  4YAB A;  3K2J A;  5CTL A;  5IG6 A;  4QC3 A;  5CQ6 A;  5KU3 A;  4QSR A;  5HEM A;  3GG3 A;  4ZW1 A;  5E9V A;  4QSQ A;  4ALH A;  2OSS A;  5A5N A;  4O7C A;  3DAI A;  5DFB A;  5D3R A;  4A9L A;  2DKW A;  5EWH A;  2NXB A;  4LYW A;  5TCM A;  3TLP A;  3DWY A;  3LQI A;  4UIW A;  4PCI A;  4ZQL A;  5BT5 A;  3S92 A;  5HQ6 A;  5HFQ A;  5A5R A;  4RVR A;  5TB6 A;  2D82 A;  4O74 A;  5C8G A;  5HEL A;  5L96 A;  5FG4 A;  5DKC A;  2MJV B;  5JI8 A;  3QZV A;  3ONI A;  4IOQ A;  5CRZ A;  5IGL A;  4AKH A;  2WP2 A;  3LXJ A;  5ACY A;  5C89 A;  3UV4 A;  4LYI A;  4QZS A;  5FE1 A;  3FKM X;  4N4H A;  3Q2E A;  5KO4 A;  4C67 A;  5A81 A;  5FH8 A;  3MB4 A;  5HQ5 A;  4LYS A;  4O7B A;  4UIY A;  4AI6 A;  5F62 A;  5E9L A;  2I7K A;  1EQF A;  4BW2 A;  5A7C A;  4TZ2 A;  3MQM A;  4QC1 A;  4A9N A;  5E9Y A;  4LZ2 A;  5HQ7 A;  5DLZ A;  5CU8 A;  4AKI A;  4LR6 A;  3P1F A;  5LKT A;  5CUE A;  5I80 A;  3IU6 A;  5DKD A;  4J0R A;  5F63 A;  4OGJ A;  5LKX A;  4A9F A;  5ENJ A;  5K29 A;  5EWD A;  4IR5 A;  5H85 A;  5F3A A;  5E74 A;  4NR8 A;  4WHU A;  3LQJ A;  2YDW A;  4ZC9 A;  4IR4 A;  5EIS A;  4XUA A;  2L84 A;  2YQD A;  5FG5 A;  2E7N A;  5DYU A;  5DYA A;  1ZKR A;  2DVR A;  2WP1 A;  5LVR A;  5CGP A;  4NYW A;  4HXM A;  4YAD A;  5DY7 A;  5HRV A;  4QEU A;  1WUM A;  4A9M A;  2YYN A;  3JVM A;  4HBV A;  4UIV A;  5A5O A;  2FSA A;  4HBX A;  4MR5 A;  5E3D A;  5EPB A;  4J3I A;  4UIT A;  4NR4 A;  3MUL A;  5F60 A;  5D0C A;  3MXF A;  4MEP A;  3U5K A;  4NQM A;  5FE8 A;  4UIX A;  4QSV A;  5EGU A;  2RI7 A;  5I7X A;  4BW4 A;  3I3J A;  5CUA A;  5A5S A;  5EA1 A;  5DW1 A;  5HEN A;  4QR3 A;  5L8T A;  4O75 A;  4O7E A;  5EV9 A;  1WUG A;  5C87 A;  5DX4 A;  4DON A;  3HMH A;  5H1U A;  5FBX A;  4X2I A;  5CUB A;  3O33 A;  5E9M A;  4MEQ A;  4IR3 A;  4NR7 A;  5D3L A;  4Z1Q A;  5FFV A;  3HME A;  4XY8 A;  5EU1 A;  4IOO A;  3AAD A;  4TZ8 A;  5JWM A;  3O37 A;  2R10 A;  5H1T A;  5FE5 A;  4CUS A; 
#chains in the Genus database with same CATH homology
 4XY9 A;  5G4R A;  5CY9 A;  3UV5 A;  5D3H A;  4OUF A;  3U5P A;  5E9I A;  2KTB B;  4Z6H A;  4TTE A;  3O36 A;  4LC2 A;  3UV2 A;  4TU6 A;  4NR9 A;  4N4F A;  4YBS A;  4TT2 A;  2YW5 A;  4FLP A;  5E3G A;  5ENH A;  4N3W A;  5EPR A;  4WIV A;  2YEL A;  5A5Q A;  3G0L A;  3ZYU A;  5ENG A;  2DWW A;  4O71 A;  4NS5 A;  4TT4 A;  3QZT A;  5I86 A;  5FB0 A;  3JVJ A;  2RFJ A;  4O70 A;  1N72 A;  5F2P A;  5L99 A;  4TYL A;  5ENE A;  5FE3 A;  4UIZ A;  4YH4 A;  4Z93 A;  5CUC A;  3HMF A;  2RO1 A;  4A9O A;  5EI4 A;  4NUD A;  4HXL A;  4YYK A;  3JVK A;  3D7C A;  2L85 A;  3NXB A;  5A83 A;  3O34 A;  5L98 A;  3P5O A;  2DVQ A;  5J0D A;  5EWW A;  4LRG A;  3SVG A;  5AMF A;  5I1Q A;  5FE2 A;  4YYN A;  4TU4 A;  5EWV A;  4QSS A;  4CUQ A;  4YYD A;  5BT3 A;  5A85 A;  4O72 A;  4BHW A;  5C4Q A;  5DFC A;  5KTX A;  5HFR A;  5G4S A;  5C85 A;  4O78 A;  4QR4 A;  5D3P A;  5DKH A;  4MEO A;  4HXN A;  4CL9 A;  5FE4 A;  4QEW A;  4Z1S A;  5ENB A;  4AKN A;  5CP5 A;  5CQ3 A;  4NYV A;  4YH3 A;  5I89 A;  3RCW A;  5EM3 A;  4CLB A;  4CUP A;  5D7X A;  2DAT A;  4QY4 A;  4GPJ A;  4MR3 A;  4CUT A;  5AD2 A;  5LKZ A;  5H1V A;  4KV4 A;  4HXK A;  3SVH A;  2DVS A;  1JSP B;  4NRA A;  5DBM A;  4XUB A;  1JM4 B;  5CFW A;  1F68 A;  4NUE A;  5COI A;  3U5L A;  4YYG A;  3UVX A;  5F36 A;  1E6I A;  5D3S A;  4BJX A;  3G0J A;  3UVW A;  4TS8 A;  5F1L A;  5BT4 A;  4PKL A;  4TT6 A;  2LSP B;  5CQ5 A;  4NRC A;  2I8N A;  5FB1 A;  4BW1 A;  5EP7 A;  4KCX A;  5LJ1 A;  2G4A A;  5DYX A;  4O76 A;  3U5O A;  4UIU A;  4O7F A;  5HRX A;  5ETB A;  5I40 A;  4UYF B;  5E0R A;  4YYJ A;  3MUK A;  4QSX A;  4YYM A;  5FE6 A;  2D9E A;  5I7Y A;  5IBN A;  5IGK A;  4J1P A;  2N9G A;  5CRM A;  5DLX A;  2RNW A;  5FH7 A;  4LDF A;  4CUR A;  4YAT A;  5IGM A;  5F5Z A;  2OO1 A;  5D3J A;  4A9J A;  5F25 A;  4MR6 A;  5CQ7 A;  4PY6 A;  4CFK A;  4UYE A;  2F6J A;  5AME A;  4QYD A;  5D3N A;  5FG6 A;  3AQA A;  4IOR A;  4NUC A;  5DW2 A;  3LQH A;  5KHM A;  5FE0 A;  5I88 A;  5E73 A;  4CFL A;  3P1C A;  4HBY A;  4LZR A;  5CQ4 A;  4QYL A;  3U5J A;  2YEK A;  5ENF A;  5ENI A;  4A9H A;  3Q2F A;  2GRC A;  5D25 A;  4NYX A;  4C66 A;  2RS9 B;  5IID A;  2R0V A;  4O7A A;  4PCE A;  3O35 A;  5CS8 A;  4Z6I A;  4NR6 A;  4YC9 A;  2R0S A;  4N4G A;  4YBM A;  4HXP A;  5KTU A;  1X0J A;  5F1H A;  5FFW A;  2DVV A;  4QSP A;  2H60 A;  2RNX A;  5EQ1 A;  5II1 A;  4UYD A;  5CQ8 A;  4HXS A;  5CUD A;  2F6N A;  5IGN A;  3S91 A;  3P1E A;  4XYA A;  4A9I A;  4YY6 A;  4CUU A;  4NRB A;  4QST A;  4PS5 A;  3JVL A;  4E96 A;  5I83 A;  2L5E A;  4J0S A;  5LUU A;  4QR5 A;  5L97 A;  4NXJ A;  5E9K A;  5FFY A;  4NQN A;  5E7D A;  5AD3 A;  5HRW A;  5HCL A;  5LVQ A;  4OGI A;  5ENC A;  5HLS A;  3UVY A;  5CUG A;  4MR4 A;  4QB3 A;  4HXO A;  5II2 A;  4ALG A;  5D26 A;  4QUT A;  3IU5 A;  2R0Y A;  3U5M A;  2RNY A;  4YAX A;  5CZG A;  4MEN A;  5LKU A;  4HBW A;  5EK9 A;  5DYC A;  5F61 A;  5D24 A;  4Q0N A;  5C7N A;  5D3T A;  4NR5 A;  5EPS A;  5LJ2 A;  5FE7 A;  4QNS A;  3MB3 A;  5DFD A;  4UYF A;  5L8U A;  2YEM A;  5A82 A;  4F3I A;  4UYG A;  5EWC A;  5FDZ A;  4YYI A;  4QEV A;  3QZS A;  3UVD A;  4QSW A;  5EIC A;  4QBM A;  4PTB A;  3U5N A;  3UW9 A;  4HXR A;  5KTW A;  3LJW A;  4YY4 A;  5LJ0 A;  4IR6 A;  1ZS5 A;  5FE9 A;  4Q0O A;  4TQN A;  5ETD A;  3P1D A;  2E7O A;  5HM0 A;  4YK0 A;  5FH6 A;  4A9E A;  2E3K A;  4YYH A;  4A9K A;  4UYH A;  4QSU A;  5A5P A;  5CQT A;  4KV1 A;  4LZS A;  4N4I A;  4BW3 A;  5CQA A;  4YBT A;  4Y03 A;  5EVA A;  4WHW A;  3SVF A;  2OUO A;  4O77 A;  5CPE A;  5I29 A;  4QUU A;  5HJC A;  4YAB A;  3K2J A;  5CTL A;  5IG6 A;  4QC3 A;  5CQ6 A;  5KU3 A;  4QSR A;  5HEM A;  3GG3 A;  4ZW1 A;  5E9V A;  4QSQ A;  4ALH A;  2OSS A;  5A5N A;  4O7C A;  3DAI A;  5DFB A;  5D3R A;  4A9L A;  2DKW A;  5EWH A;  2NXB A;  4LYW A;  5TCM A;  3TLP A;  3DWY A;  3LQI A;  4UIW A;  4PCI A;  4ZQL A;  5BT5 A;  3S92 A;  5HQ6 A;  5HFQ A;  5A5R A;  4RVR A;  5TB6 A;  2D82 A;  4O74 A;  5C8G A;  5HEL A;  5L96 A;  5FG4 A;  5DKC A;  2MJV B;  5JI8 A;  3QZV A;  3ONI A;  4IOQ A;  5CRZ A;  5IGL A;  2WP2 A;  3LXJ A;  5ACY A;  5C89 A;  3UV4 A;  4LYI A;  4QZS A;  5FE1 A;  3FKM X;  4N4H A;  3Q2E A;  5KO4 A;  4C67 A;  5A81 A;  5FH8 A;  3MB4 A;  5HQ5 A;  4LYS A;  4O7B A;  4UIY A;  5F62 A;  5E9L A;  2I7K A;  1EQF A;  4BW2 A;  5A7C A;  4TZ2 A;  3MQM A;  4QC1 A;  4A9N A;  5E9Y A;  4LZ2 A;  5HQ7 A;  5DLZ A;  5CU8 A;  4LR6 A;  3P1F A;  5LKT A;  5CUE A;  5I80 A;  3IU6 A;  5DKD A;  4J0R A;  5F63 A;  4OGJ A;  5LKX A;  4A9F A;  5ENJ A;  5K29 A;  5EWD A;  4IR5 A;  5H85 A;  5F3A A;  5E74 A;  4NR8 A;  4WHU A;  3LQJ A;  2YDW A;  4ZC9 A;  4IR4 A;  5EIS A;  4XUA A;  2L84 A;  2YQD A;  5FG5 A;  2E7N A;  5DYU A;  5DYA A;  2DVR A;  2WP1 A;  5LVR A;  5CGP A;  4NYW A;  4HXM A;  4YAD A;  5DY7 A;  5HRV A;  4QEU A;  1WUM A;  4A9M A;  2YYN A;  3JVM A;  4HBV A;  4UIV A;  5A5O A;  2FSA A;  4HBX A;  4MR5 A;  5E3D A;  5EPB A;  4J3I A;  4UIT A;  4NR4 A;  3MUL A;  5F60 A;  5D0C A;  3MXF A;  4MEP A;  3U5K A;  4NQM A;  5FE8 A;  4UIX A;  4QSV A;  5EGU A;  2RI7 A;  5I7X A;  4BW4 A;  3I3J A;  5CUA A;  5A5S A;  5EA1 A;  5DW1 A;  5HEN A;  4QR3 A;  5L8T A;  4O75 A;  4O7E A;  5EV9 A;  1WUG A;  5C87 A;  5DX4 A;  4DON A;  3HMH A;  5H1U A;  5FBX A;  4X2I A;  5CUB A;  3O33 A;  5E9M A;  4MEQ A;  4IR3 A;  4NR7 A;  5D3L A;  4Z1Q A;  5FFV A;  3HME A;  4XY8 A;  5EU1 A;  4IOO A;  3AAD A;  4TZ8 A;  5JWM A;  3O37 A;  2R10 A;  5H1T A;  5FE5 A;  4CUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...