2D82A

Target structure-based discovery of small molecules that block human p53 and creb binding protein (cbp) association
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
GSHMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Target structure-based discovery of small molecules that block human p53 and CREB binding protein association
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 29
structure length 121
sequence length 121
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2d82A00
5E73A 5E3DA 4PCEA 2YQDA 2D9EA 3IU5A 3LXJA 4MR5A 4A9OA 4AKNA 4QSQA 2R0SA 4IR3A 3O33A 5D3PA 5I86A 5D3LA 5G4RA 2DVVA 3Q2FA 4NR6A 4QSVA 5CY9A 5KU3A 3SVFA 5CUGA 5EVAA 3UV2A 4QC1A 3JVMA 3UVDA 5AMFA 4YAXA 4KV4A 4OGJA 5IG6A 5II2A 5HFQA 4TYLA 5I7XA 5D3SA 5D3JA 4CLBA 4YYMA 3LJWA 4NRBA 3MB3A 5LKXA 4N4IA 5EA1A 4YYNA 4NYXA 2RNYA 4YC9A 4YH3A 4CUQA 4PS5A 4PY6A 3DWYA 4NQMA 4BW3A 4TQNA 5CUAA 5DBMA 5FB0A 5A81A 2G4AA 3ZYUA 4ZQLA 5I88A 4QEVA 2YW5A 5EP7A 3UVYA 5LKTA 3LQHA 5E9MA 4O76A 4O75A 4YABA 4HBVA 4TU4A 3TLPA 2RO1A 5F1HA 5A85A 4QZSA 4QYDA 5JI8A 4NUDA 5CPEA 1JSPB 4LYIA 3HMFA 1E6IA 4CURA 3G0JA 4Z1QA 5FG4A 5HELA 4QSXA 5C89A 5L98A 4PKLA 5FE9A 5D26A 5A5SA 4QSTA 2OO1A 4XY9A 3P5OA 5ENFA 3I3JA 5ACYA 5F1LA 3MUKA 5BT5A 2F6JA 5CZGA 3AQAA 4J0RA 5CTLA 4Z6IA 5LKUA 4O74A 3U5MA 5FH8A 5HENA 4TZ8A 5FFYA 4HXLA 4IR4A 5FE2A 2L84A 5G4SA 2WP2A 4YBSA 5HFRA 4UIUA 5ENCA 4HXPA 4A9NA 5A5OA 4NXJA 3NXBA 5A83A 5AD2A 5EISA 5CQAA 3U5NA 4NRAA 5CU8A 4YATA 4BW1A 5K29A 4N4FA 4BW4A 5EV9A 4NRCA 5FE6A 4XUAA 5E0RA 5KHMA 4ALHA 1ZS5A 1WUMA 3P1DA 4UYFA 4YYJA 2I8NA 4LC2A 2LSPB 5FBXA 5FE4A 5EWVA 4MENA 4HBYA 4TT2A 4NYVA 5CGPA 5ETBA 4OUFA 3RCWA 4QSSA 3P1CA 2H60A 4A9FA 1F68A 4CL9A 5F62A 5HRVA 5A7CA 5ENIA 5I83A 4KV1A 5I80A 4MEOA 4NS5A 5HQ7A 5D25A 4Z6HA 4YYGA 2R10A 5D7XA 5HLSA 5H1VA 5IGNA 5A5QA 2DKWA 4MR3A 4N4HA 2I7KA 4KCXA 4O77A 4QSPA 4CFKA 5H1UA 5LVRA 3ONIA 5JWMA 4MR6A 4O71A 5HCLA 4HXMA 5F36A 2RS9B 5COIA 2OUOA 2MJVB 5DKDA 4CFLA 3Q2EA 5D3HA 2DWWA 5C7NA 4YYIA 4O7FA 5FE5A 4NQNA 4GPJA 5E9LA 5IGLA 5L8UA 3UW9A 1JM4B 4QR4A 3JVLA 4YBTA 5F5ZA 4TS8A 5E9VA 5CUBA 4RVRA 4YYKA 2R0VA 4IR6A 2DVQA 2YELA 5CRZA 5ENEA 5FB1A 4ZC9A 5DYXA 2WP1A 5KTXA 5KTWA 5EPBA 4O7CA 5E9KA 4A9KA 4XUBA 4QBMA 3G0LA 4OGIA 4IR5A 2RFJA 4UIYA 5CQTA 4UIZA 5DW1A 2DVSA 5F2PA 4QB3A 2YDWA 5DX4A 5FG5A 3GG3A 4WHUA 5HQ5A 5D3NA 5AD3A 3DAIA 5D3RA 5CQ8A 5I40A 4HXNA 4NR9A 5LVQA 5A82A 5DLXA 5I1QA 4XY8A 3O36A 3AADA 4C66A 4Y03A 4LZRA 5F60A 4YBMA 5FE8A 3MULA 5LUUA 5DFDA 5HQ6A 5DLZA 5LKZA 5DYCA 4NUEA 5C4QA 4UITA 5EK9A 5FH6A 2KTBB 5DYAA 5FFWA 4IORA 5I29A 4J1PA 4A9JA 2OSSA 4NR5A 3LQIA 5DKHA 4YYDA 4NR4A 5TCMA 4UYEA 2E7OA 4LR6A 4UIXA 3U5OA 5ENBA 5C8GA 4LDFA 5FE7A 5IIDA 4NR8A 2DVRA 3D7CA 5EPRA 4E96A 4ALGA 2RNXA 4YYHA 2R0YA 4LZSA 5EI4A 4UYDA 5CQ4A 5CS8A 5CP5A 3JVKA 4A9HA 5ENGA 4NR7A 5HEMA 3U5JA 4TU6A 4O70A 3UVWA 5LJ0A 2E3KA 3P1EA 5FE3A 4CUTA 5A5PA 4TT4A 5C87A 4HBWA 2N9GA 4CUPA 4QUTA 5EPSA 4HXRA 5DFCA 4BJXA 4Q0OA 5EWHA 5EU1A 5H1TA 4PTBA 4LZ2A 4O7AA 5BT3A 4QSRA 4YH4A 3HMEA 5ENJA 3O34A 4QUUA 5CQ7A 2D82A 4O72A 5IBNA 4QR5A 5CFWA 3QZVA 5FE0A 5FH7A 5CQ6A 5E74A 4LYSA 5ENHA 4BW2A 4N4GA 4A9MA 5D0CA 3SVHA 4QR3A 4J0SA 5LJ2A 3LQJA 5E7DA 4PCIA 4QC3A 3UV4A 5J0DA 5FDZA 5CUEA 2FSAA 3U5KA 5I7YA 4YY6A 4UYHA 2GRCA 3QZTA 4LRGA 4NYWA 3P1FA 4YY4A 4QSUA 5L97A 4FLPA 5E9IA 4QNSA 4QSWA 4HXOA 2F6NA 4CUSA 2YEMA 4QYLA 4C67A 5FFVA 4QEUA 5DY7A 4HXSA 5CRMA 5CUCA 4DONA 5A5NA 5EWCA 1EQFA 5D24A 4Z1SA 4TTEA 4UIWA 5EGUA 5EQ1A 4Q0NA 5IGKA 4UIVA 5DW2A 4HBXA 5LJ1A 5F25A 4QEWA 4MEQA 4O7BA 2RI7A 4TZ2A 5II1A 2YYNA 5EICA 3UV5A 4O7EA 5KO4A 3HMHA 2L85A 4CUUA 5F3AA 4IOQA 4ZW1A 5DFBA 5HRWA 4A9LA 2DATA 4UYGA 4O78A 3U5LA 4UYFB 2E7NA 5FE1A 3MB4A 3U5PA 5CQ5A 5A5RA 5HM0A 5CUDA 2RNWA 4YADA 5EM3A 3MQMA 5FG6A 3IU6A 5HRXA 5D3TA 5F63A 5CQ3A 5EWWA 5BT4A 4QY4A 5I89A 4LYWA 5HJCA 5DYUA 4IOOA 5L96A 1X0JA 4A9EA 5E9YA 4TT6A 2NXBA 4WIVA 3O37A 4HXKA 3FKMX 3K2JA 4A9IA 3O35A 4NUCA 1WUGA 2YEKA 4J3IA 3MXFA 4WHWA 5H85A 5AMEA 5E3GA 3UVXA 4BHWA 2L5EA 5L8TA 5L99A 4YK0A 5DKCA 3SVGA 3S92A 5C85A 4MEPA 4X2IA 5IGMA 3S91A 1N72A 4F3IA 4N3WA 5F61A 4Z93A 5ETDA 5EWDA 4MR4A 5KTUA 3JVJA 3QZSA 4XYAA 5TB6A
chains in the Genus database with same CATH superfamily
5E73A 5E3DA 4PCEA 2YQDA 2D9EA 3IU5A 3LXJA 4MR5A 4A9OA 4AKNA 4QSQA 2R0SA 4IR3A 3O33A 5D3PA 5I86A 5D3LA 5G4RA 2DVVA 3Q2FA 4NR6A 4QSVA 5CY9A 5KU3A 3SVFA 5CUGA 5EVAA 3UV2A 4QC1A 3JVMA 3UVDA 5AMFA 4YAXA 4KV4A 4OGJA 5IG6A 5II2A 5HFQA 4TYLA 5I7XA 5D3SA 5D3JA 4CLBA 4YYMA 3LJWA 4NRBA 3MB3A 5LKXA 4N4IA 5EA1A 4YYNA 4NYXA 1ZKRA 2RNYA 4YC9A 4YH3A 4CUQA 4PS5A 4PY6A 3DWYA 4NQMA 4BW3A 4TQNA 5CUAA 5DBMA 5FB0A 5A81A 2G4AA 3ZYUA 4ZQLA 5I88A 4QEVA 2YW5A 5EP7A 3UVYA 5LKTA 3LQHA 5E9MA 4O76A 4O75A 4YABA 4HBVA 4TU4A 3TLPA 2RO1A 5F1HA 5A85A 4QZSA 4QYDA 5JI8A 4NUDA 5CPEA 1JSPB 4LYIA 3HMFA 1E6IA 4CURA 3G0JA 4Z1QA 5FG4A 5HELA 4QSXA 5C89A 5L98A 4PKLA 5FE9A 5D26A 5A5SA 4QSTA 2OO1A 4XY9A 3P5OA 5ENFA 3I3JA 5ACYA 5F1LA 3MUKA 5BT5A 2F6JA 5CZGA 3AQAA 4J0RA 5CTLA 4Z6IA 5LKUA 4O74A 2EJNA 3U5MA 5FH8A 5HENA 4TZ8A 5FFYA 4HXLA 4IR4A 5FE2A 2L84A 5G4SA 2WP2A 4YBSA 5HFRA 4UIUA 5ENCA 4HXPA 4A9NA 5A5OA 4NXJA 3NXBA 5A83A 5AD2A 5EISA 5CQAA 3U5NA 4NRAA 5CU8A 4YATA 4BW1A 5K29A 4N4FA 4BW4A 5EV9A 4NRCA 5FE6A 4XUAA 5E0RA 5KHMA 4ALHA 1ZS5A 1WUMA 3P1DA 4UYFA 4YYJA 2I8NA 4LC2A 2LSPB 4AKGA 5FBXA 5FE4A 5EWVA 3VKHA 4MENA 4HBYA 4TT2A 4NYVA 5CGPA 5ETBA 4OUFA 3RCWA 4QSSA 3P1CA 2H60A 4A9FA 1F68A 4CL9A 5F62A 5HRVA 3D1BA 5ENIA 5A7CA 5I83A 4KV1A 5I80A 4MEOA 4NS5A 5HQ7A 5D25A 4Z6HA 4YYGA 2R10A 5D7XA 5HLSA 5H1VA 5IGNA 5A5QA 2DKWA 4MR3A 4N4HA 2I7KA 4KCXA 4O77A 4QSPA 4CFKA 5H1UA 5LVRA 3ONIA 5JWMA 4MR6A 4O71A 5HCLA 4HXMA 5F36A 2RS9B 5COIA 2OUOA 2MJVB 5DKDA 4CFLA 3Q2EA 5D3HA 2DWWA 5C7NA 4YYIA 4O7FA 3ERRA 5FE5A 4NQNA 4GPJA 5E9LA 5IGLA 5L8UA 3UW9A 1JM4B 4QR4A 3JVLA 4YBTA 5F5ZA 4AKHA 4TS8A 5E9VA 5CUBA 4RVRA 4YYKA 2R0VA 4IR6A 2DVQA 2YELA 5CRZA 5ENEA 5FB1A 4ZC9A 5DYXA 2WP1A 5KTXA 5KTWA 5EPBA 4O7CA 5E9KA 4A9KA 4XUBA 3D1DA 4QBMA 3G0LA 4OGIA 4IR5A 2RFJA 4UIYA 5CQTA 4UIZA 5DW1A 2DVSA 5F2PA 4QB3A 2YDWA 5DX4A 5FG5A 3GG3A 4WHUA 5HQ5A 5D3NA 5AD3A 3DAIA 5D3RA 5CQ8A 5I40A 4HXNA 4NR9A 5LVQA 5A82A 5DLXA 5I1QA 4XY8A 3O36A 3AADA 4C66A 4Y03A 4LZRA 5F60A 4YBMA 5FE8A 3MULA 5LUUA 5DFDA 5HQ6A 5DLZA 5LKZA 5DYCA 4NUEA 5C4QA 4UITA 5EK9A 5FH6A 2KTBB 5DYAA 5FFWA 4IORA 5I29A 4J1PA 4A9JA 2OSSA 4NR5A 3LQIA 5DKHA 4YYDA 4NR4A 5TCMA 4UYEA 2E7OA 4LR6A 4UIXA 3U5OA 3VKGA 5ENBA 5C8GA 4LDFA 5FE7A 5IIDA 4NR8A 2DVRA 3D7CA 5EPRA 4E96A 1PUOA 4ALGA 2RNXA 4YYHA 2R0YA 4LZSA 5EI4A 4UYDA 5CQ4A 5CS8A 5CP5A 3JVKA 4A9HA 5ENGA 4NR7A 5HEMA 3U5JA 4TU6A 4O70A 3UVWA 5LJ0A 2E3KA 3P1EA 5FE3A 4CUTA 5A5PA 4TT4A 5C87A 4HBWA 2N9GA 4CUPA 4QUTA 5EPSA 4HXRA 5DFCA 4BJXA 4Q0OA 5EWHA 5EU1A 5H1TA 4PTBA 4LZ2A 4O7AA 5BT3A 4QSRA 4YH4A 3HMEA 5ENJA 3O34A 4QUUA 5CQ7A 2D82A 4O72A 5IBNA 4QR5A 5CFWA 3QZVA 5FE0A 5FH7A 5CQ6A 5E74A 4LYSA 5ENHA 4BW2A 4N4GA 4A9MA 5D0CA 3SVHA 4QR3A 4J0SA 5LJ2A 3LQJA 5E7DA 4PCIA 4QC3A 3UV4A 5J0DA 5FDZA 5CUEA 2FSAA 3U5KA 5I7YA 4YY6A 4UYHA 2GRCA 3QZTA 4LRGA 4NYWA 3P1FA 4YY4A 4QSUA 5L97A 4FLPA 5E9IA 4QNSA 4QSWA 4HXOA 2F6NA 4CUSA 2YEMA 4QYLA 4C67A 5FFVA 4QEUA 5DY7A 4HXSA 5CRMA 5CUCA 4DONA 5A5NA 5EWCA 1EQFA 5D24A 4Z1SA 4TTEA 4UIWA 5EGUA 5EQ1A 4Q0NA 4AI6A 5IGKA 4UIVA 5DW2A 4HBXA 5LJ1A 5F25A 4QEWA 4MEQA 4O7BA 2RI7A 4TZ2A 5II1A 2YYNA 5EICA 3UV5A 4O7EA 5KO4A 3HMHA 2L85A 4CUUA 5F3AA 4IOQA 4ZW1A 5DFBA 5HRWA 4A9LA 2DATA 4UYGA 4O78A 3U5LA 4UYFB 2E7NA 5FE1A 3MB4A 3U5PA 5CQ5A 5A5RA 5HM0A 5CUDA 2RNWA 4YADA 5EM3A 3MQMA 5FG6A 3IU6A 5HRXA 5D3TA 5F63A 5CQ3A 5EWWA 5BT4A 4QY4A 5I89A 4LYWA 4AKIA 5HJCA 5DYUA 4IOOA 5L96A 1X0JA 4A9EA 5E9YA 4TT6A 2NXBA 4WIVA 3O37A 4HXKA 3FKMX 3K2JA 4A9IA 3O35A 4NUCA 1WUGA 2YEKA 4J3IA 3MXFA 4WHWA 5H85A 5AMEA 5E3GA 3UVXA 4BHWA 2L5EA 5L8TA 5L99A 4YK0A 5DKCA 3SVGA 3S92A 5C85A 4MEPA 4X2IA 5IGMA 3S91A 1N72A 4F3IA 4N3WA 5F61A 4Z93A 5ETDA 5EWDA 4MR4A 5KTUA 3JVJA 3QZSA 4XYAA 5TB6A
chains in the Genus database with same CATH topology
5E73A 5E3DA 4PCEA 2YQDA 2D9EA 3IU5A 3LXJA 4MR5A 4A9OA 4AKNA 4QSQA 2R0SA 4IR3A 3O33A 5D3PA 5I86A 5D3LA 5G4RA 2DVVA 3Q2FA 4NR6A 4QSVA 5CY9A 5KU3A 3SVFA 5CUGA 5EVAA 3UV2A 4QC1A 3JVMA 3UVDA 5AMFA 4YAXA 4KV4A 4OGJA 5IG6A 5II2A 5HFQA 4TYLA 5I7XA 5D3SA 5D3JA 4CLBA 4YYMA 3LJWA 4NRBA 3MB3A 5LKXA 4N4IA 5EA1A 4YYNA 4NYXA 2RNYA 4YC9A 4YH3A 4CUQA 4PS5A 4PY6A 3DWYA 4NQMA 4BW3A 4TQNA 5CUAA 5DBMA 5FB0A 5A81A 2G4AA 3ZYUA 4ZQLA 5I88A 4QEVA 2YW5A 5EP7A 3UVYA 5LKTA 3LQHA 5E9MA 4O76A 4O75A 4YABA 4HBVA 4TU4A 3TLPA 2RO1A 5F1HA 5A85A 4QZSA 4QYDA 5JI8A 4NUDA 5CPEA 1JSPB 4LYIA 3HMFA 1E6IA 4CURA 3G0JA 4Z1QA 5FG4A 5HELA 4QSXA 5C89A 5L98A 4PKLA 5FE9A 5D26A 5A5SA 4QSTA 2OO1A 4XY9A 3P5OA 5ENFA 3I3JA 5ACYA 5F1LA 3MUKA 5BT5A 2F6JA 5CZGA 3AQAA 4J0RA 5CTLA 4Z6IA 5LKUA 4O74A 3U5MA 5FH8A 5HENA 4TZ8A 5FFYA 4HXLA 4IR4A 5FE2A 2L84A 5G4SA 2WP2A 4YBSA 5HFRA 4UIUA 5ENCA 4HXPA 4A9NA 5A5OA 4NXJA 3NXBA 5A83A 5AD2A 5EISA 5CQAA 3U5NA 4NRAA 5CU8A 4YATA 4BW1A 5K29A 4N4FA 4BW4A 5EV9A 4NRCA 5FE6A 4XUAA 5E0RA 5KHMA 4ALHA 1ZS5A 1WUMA 3P1DA 4UYFA 4YYJA 2I8NA 4LC2A 2LSPB 5FBXA 5FE4A 5EWVA 4MENA 4HBYA 4TT2A 4NYVA 5CGPA 5ETBA 4OUFA 3RCWA 4QSSA 3P1CA 2H60A 4A9FA 1F68A 4CL9A 5F62A 5HRVA 5A7CA 5ENIA 5I83A 4KV1A 5I80A 4MEOA 4NS5A 5HQ7A 5D25A 4Z6HA 4YYGA 2R10A 5D7XA 5HLSA 5H1VA 5IGNA 5A5QA 2DKWA 4MR3A 4N4HA 2I7KA 4KCXA 4O77A 4QSPA 4CFKA 5H1UA 5LVRA 3ONIA 5JWMA 4MR6A 4O71A 5HCLA 4HXMA 5F36A 2RS9B 5COIA 2OUOA 2MJVB 5DKDA 4CFLA 3Q2EA 5D3HA 2DWWA 5C7NA 4YYIA 4O7FA 5FE5A 4NQNA 4GPJA 5E9LA 5IGLA 5L8UA 3UW9A 1JM4B 4QR4A 3JVLA 4YBTA 5F5ZA 4TS8A 5E9VA 5CUBA 4RVRA 4YYKA 2R0VA 4IR6A 2DVQA 2YELA 5CRZA 5ENEA 5FB1A 4ZC9A 5DYXA 2WP1A 5KTXA 5KTWA 5EPBA 4O7CA 5E9KA 4A9KA 4XUBA 4QBMA 3G0LA 4OGIA 4IR5A 2RFJA 4UIYA 5CQTA 4UIZA 5DW1A 2DVSA 5F2PA 4QB3A 2YDWA 5DX4A 5FG5A 3GG3A 4WHUA 5HQ5A 5D3NA 5AD3A 3DAIA 5D3RA 5CQ8A 5I40A 4HXNA 4NR9A 5LVQA 5A82A 5DLXA 5I1QA 4XY8A 3O36A 3AADA 4C66A 4Y03A 4LZRA 5F60A 4YBMA 5FE8A 3MULA 5LUUA 5DFDA 5HQ6A 5DLZA 5LKZA 5DYCA 4NUEA 5C4QA 4UITA 5EK9A 5FH6A 2KTBB 5DYAA 5FFWA 4IORA 5I29A 4J1PA 4A9JA 2OSSA 4NR5A 3LQIA 5DKHA 4YYDA 4NR4A 5TCMA 4UYEA 2E7OA 4LR6A 4UIXA 3U5OA 5ENBA 5C8GA 4LDFA 5FE7A 5IIDA 4NR8A 2DVRA 3D7CA 5EPRA 4E96A 4ALGA 2RNXA 4YYHA 2R0YA 4LZSA 5EI4A 4UYDA 5CQ4A 5CS8A 5CP5A 3JVKA 4A9HA 5ENGA 4NR7A 5HEMA 3U5JA 4TU6A 4O70A 3UVWA 5LJ0A 2E3KA 3P1EA 5FE3A 4CUTA 5A5PA 4TT4A 5C87A 4HBWA 2N9GA 4CUPA 4QUTA 5EPSA 4HXRA 5DFCA 4BJXA 4Q0OA 5EWHA 5EU1A 5H1TA 4PTBA 4LZ2A 4O7AA 5BT3A 4QSRA 4YH4A 3HMEA 5ENJA 3O34A 4QUUA 5CQ7A 2D82A 4O72A 5IBNA 4QR5A 5CFWA 3QZVA 5FE0A 5FH7A 5CQ6A 5E74A 4LYSA 5ENHA 4BW2A 4N4GA 4A9MA 5D0CA 3SVHA 4QR3A 4J0SA 5LJ2A 3LQJA 5E7DA 4PCIA 4QC3A 3UV4A 5J0DA 5FDZA 5CUEA 2FSAA 3U5KA 5I7YA 4YY6A 4UYHA 2GRCA 3QZTA 4LRGA 4NYWA 3P1FA 4YY4A 4QSUA 5L97A 4FLPA 5E9IA 4QNSA 4QSWA 4HXOA 2F6NA 4CUSA 2YEMA 4QYLA 4C67A 5FFVA 4QEUA 5DY7A 4HXSA 5CRMA 5CUCA 4DONA 5A5NA 5EWCA 1EQFA 5D24A 4Z1SA 4TTEA 4UIWA 5EGUA 5EQ1A 4Q0NA 5IGKA 4UIVA 5DW2A 4HBXA 5LJ1A 5F25A 4QEWA 4MEQA 4O7BA 2RI7A 4TZ2A 5II1A 2YYNA 5EICA 3UV5A 4O7EA 5KO4A 3HMHA 2L85A 4CUUA 5F3AA 4IOQA 4ZW1A 5DFBA 5HRWA 4A9LA 2DATA 4UYGA 4O78A 3U5LA 4UYFB 2E7NA 5FE1A 3MB4A 3U5PA 5CQ5A 5A5RA 5HM0A 5CUDA 2RNWA 4YADA 5EM3A 3MQMA 5FG6A 3IU6A 5HRXA 5D3TA 5F63A 5CQ3A 5EWWA 5BT4A 4QY4A 5I89A 4LYWA 5HJCA 5DYUA 4IOOA 5L96A 1X0JA 4A9EA 5E9YA 4TT6A 2NXBA 4WIVA 3O37A 4HXKA 3FKMX 3K2JA 4A9IA 3O35A 4NUCA 1WUGA 2YEKA 4J3IA 3MXFA 4WHWA 5H85A 5AMEA 5E3GA 3UVXA 4BHWA 2L5EA 5L8TA 5L99A 4YK0A 5DKCA 3SVGA 3S92A 5C85A 4MEPA 4X2IA 5IGMA 3S91A 1N72A 4F3IA 4N3WA 5F61A 4Z93A 5ETDA 5EWDA 4MR4A 5KTUA 3JVJA 3QZSA 4XYAA 5TB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E73 A;  5E3D A;  4PCE A;  2YQD A;  2D9E A;  3IU5 A;  3LXJ A;  4MR5 A;  4A9O A;  4AKN A;  4QSQ A;  2R0S A;  4IR3 A;  3O33 A;  5D3P A;  5I86 A;  5D3L A;  5G4R A;  2DVV A;  3Q2F A;  4NR6 A;  4QSV A;  5CY9 A;  5KU3 A;  3SVF A;  5CUG A;  5EVA A;  3UV2 A;  4QC1 A;  3JVM A;  3UVD A;  5AMF A;  4YAX A;  4KV4 A;  4OGJ A;  5IG6 A;  5II2 A;  5HFQ A;  4TYL A;  5I7X A;  5D3S A;  5D3J A;  4CLB A;  4YYM A;  3LJW A;  4NRB A;  3MB3 A;  5LKX A;  4N4I A;  5EA1 A;  4YYN A;  4NYX A;  2RNY A;  4YC9 A;  4YH3 A;  4CUQ A;  4PS5 A;  4PY6 A;  3DWY A;  4NQM A;  4BW3 A;  4TQN A;  5CUA A;  5DBM A;  5FB0 A;  5A81 A;  2G4A A;  3ZYU A;  4ZQL A;  5I88 A;  4QEV A;  2YW5 A;  5EP7 A;  3UVY A;  5LKT A;  3LQH A;  5E9M A;  4O76 A;  4O75 A;  4YAB A;  4HBV A;  4TU4 A;  3TLP A;  2RO1 A;  5F1H A;  5A85 A;  4QZS A;  4QYD A;  5JI8 A;  4NUD A;  5CPE A;  1JSP B;  4LYI A;  3HMF A;  1E6I A;  4CUR A;  3G0J A;  4Z1Q A;  5FG4 A;  5HEL A;  4QSX A;  5C89 A;  5L98 A;  4PKL A;  5FE9 A;  5D26 A;  5A5S A;  4QST A;  2OO1 A;  4XY9 A;  3P5O A;  5ENF A;  3I3J A;  5ACY A;  5F1L A;  3MUK A;  5BT5 A;  2F6J A;  5CZG A;  3AQA A;  4J0R A;  5CTL A;  4Z6I A;  5LKU A;  4O74 A;  3U5M A;  5FH8 A;  5HEN A;  4TZ8 A;  5FFY A;  4HXL A;  4IR4 A;  5FE2 A;  2L84 A;  5G4S A;  2WP2 A;  4YBS A;  5HFR A;  4UIU A;  5ENC A;  4HXP A;  4A9N A;  5A5O A;  4NXJ A;  3NXB A;  5A83 A;  5AD2 A;  5EIS A;  5CQA A;  3U5N A;  4NRA A;  5CU8 A;  4YAT A;  4BW1 A;  5K29 A;  4N4F A;  4BW4 A;  5EV9 A;  4NRC A;  5FE6 A;  4XUA A;  5E0R A;  5KHM A;  4ALH A;  1ZS5 A;  1WUM A;  3P1D A;  4UYF A;  4YYJ A;  2I8N A;  4LC2 A;  2LSP B;  5FBX A;  5FE4 A;  5EWV A;  4MEN A;  4HBY A;  4TT2 A;  4NYV A;  5CGP A;  5ETB A;  4OUF A;  3RCW A;  4QSS A;  3P1C A;  2H60 A;  4A9F A;  1F68 A;  4CL9 A;  5F62 A;  5HRV A;  5A7C A;  5ENI A;  5I83 A;  4KV1 A;  5I80 A;  4MEO A;  4NS5 A;  5HQ7 A;  5D25 A;  4Z6H A;  4YYG A;  2R10 A;  5D7X A;  5HLS A;  5H1V A;  5IGN A;  5A5Q A;  2DKW A;  4MR3 A;  4N4H A;  2I7K A;  4KCX A;  4O77 A;  4QSP A;  4CFK A;  5H1U A;  5LVR A;  3ONI A;  5JWM A;  4MR6 A;  4O71 A;  5HCL A;  4HXM A;  5F36 A;  2RS9 B;  5COI A;  2OUO A;  2MJV B;  5DKD A;  4CFL A;  3Q2E A;  5D3H A;  2DWW A;  5C7N A;  4YYI A;  4O7F A;  5FE5 A;  4NQN A;  4GPJ A;  5E9L A;  5IGL A;  5L8U A;  3UW9 A;  1JM4 B;  4QR4 A;  3JVL A;  4YBT A;  5F5Z A;  4TS8 A;  5E9V A;  5CUB A;  4RVR A;  4YYK A;  2R0V A;  4IR6 A;  2DVQ A;  2YEL A;  5CRZ A;  5ENE A;  5FB1 A;  4ZC9 A;  5DYX A;  2WP1 A;  5KTX A;  5KTW A;  5EPB A;  4O7C A;  5E9K A;  4A9K A;  4XUB A;  4QBM A;  3G0L A;  4OGI A;  4IR5 A;  2RFJ A;  4UIY A;  5CQT A;  4UIZ A;  5DW1 A;  2DVS A;  5F2P A;  4QB3 A;  2YDW A;  5DX4 A;  5FG5 A;  3GG3 A;  4WHU A;  5HQ5 A;  5D3N A;  5AD3 A;  3DAI A;  5D3R A;  5CQ8 A;  5I40 A;  4HXN A;  4NR9 A;  5LVQ A;  5A82 A;  5DLX A;  5I1Q A;  4XY8 A;  3O36 A;  3AAD A;  4C66 A;  4Y03 A;  4LZR A;  5F60 A;  4YBM A;  5FE8 A;  3MUL A;  5LUU A;  5DFD A;  5HQ6 A;  5DLZ A;  5LKZ A;  5DYC A;  4NUE A;  5C4Q A;  4UIT A;  5EK9 A;  5FH6 A;  2KTB B;  5DYA A;  5FFW A;  4IOR A;  5I29 A;  4J1P A;  4A9J A;  2OSS A;  4NR5 A;  3LQI A;  5DKH A;  4YYD A;  4NR4 A;  5TCM A;  4UYE A;  2E7O A;  4LR6 A;  4UIX A;  3U5O A;  5ENB A;  5C8G A;  4LDF A;  5FE7 A;  5IID A;  4NR8 A;  2DVR A;  3D7C A;  5EPR A;  4E96 A;  4ALG A;  2RNX A;  4YYH A;  2R0Y A;  4LZS A;  5EI4 A;  4UYD A;  5CQ4 A;  5CS8 A;  5CP5 A;  3JVK A;  4A9H A;  5ENG A;  4NR7 A;  5HEM A;  3U5J A;  4TU6 A;  4O70 A;  3UVW A;  5LJ0 A;  2E3K A;  3P1E A;  5FE3 A;  4CUT A;  5A5P A;  4TT4 A;  5C87 A;  4HBW A;  2N9G A;  4CUP A;  4QUT A;  5EPS A;  4HXR A;  5DFC A;  4BJX A;  4Q0O A;  5EWH A;  5EU1 A;  5H1T A;  4PTB A;  4LZ2 A;  4O7A A;  5BT3 A;  4QSR A;  4YH4 A;  3HME A;  5ENJ A;  3O34 A;  4QUU A;  5CQ7 A;  2D82 A;  4O72 A;  5IBN A;  4QR5 A;  5CFW A;  3QZV A;  5FE0 A;  5FH7 A;  5CQ6 A;  5E74 A;  4LYS A;  5ENH A;  4BW2 A;  4N4G A;  4A9M A;  5D0C A;  3SVH A;  4QR3 A;  4J0S A;  5LJ2 A;  3LQJ A;  5E7D A;  4PCI A;  4QC3 A;  3UV4 A;  5J0D A;  5FDZ A;  5CUE A;  2FSA A;  3U5K A;  5I7Y A;  4YY6 A;  4UYH A;  2GRC A;  3QZT A;  4LRG A;  4NYW A;  3P1F A;  4YY4 A;  4QSU A;  5L97 A;  4FLP A;  5E9I A;  4QNS A;  4QSW A;  4HXO A;  2F6N A;  4CUS A;  2YEM A;  4QYL A;  4C67 A;  5FFV A;  4QEU A;  5DY7 A;  4HXS A;  5CRM A;  5CUC A;  4DON A;  5A5N A;  5EWC A;  1EQF A;  5D24 A;  4Z1S A;  4TTE A;  4UIW A;  5EGU A;  5EQ1 A;  4Q0N A;  5IGK A;  4UIV A;  5DW2 A;  4HBX A;  5LJ1 A;  5F25 A;  4QEW A;  4MEQ A;  4O7B A;  2RI7 A;  4TZ2 A;  5II1 A;  2YYN A;  5EIC A;  3UV5 A;  4O7E A;  5KO4 A;  3HMH A;  2L85 A;  4CUU A;  5F3A A;  4IOQ A;  4ZW1 A;  5DFB A;  5HRW A;  4A9L A;  2DAT A;  4UYG A;  4O78 A;  3U5L A;  4UYF B;  2E7N A;  5FE1 A;  3MB4 A;  3U5P A;  5CQ5 A;  5A5R A;  5HM0 A;  5CUD A;  2RNW A;  4YAD A;  5EM3 A;  3MQM A;  5FG6 A;  3IU6 A;  5HRX A;  5D3T A;  5F63 A;  5CQ3 A;  5EWW A;  5BT4 A;  4QY4 A;  5I89 A;  4LYW A;  5HJC A;  5DYU A;  4IOO A;  5L96 A;  1X0J A;  4A9E A;  5E9Y A;  4TT6 A;  2NXB A;  4WIV A;  3O37 A;  4HXK A;  3FKM X;  3K2J A;  4A9I A;  3O35 A;  4NUC A;  1WUG A;  2YEK A;  4J3I A;  3MXF A;  4WHW A;  5H85 A;  5AME A;  5E3G A;  3UVX A;  4BHW A;  2L5E A;  5L8T A;  5L99 A;  4YK0 A;  5DKC A;  3SVG A;  3S92 A;  5C85 A;  4MEP A;  4X2I A;  5IGM A;  3S91 A;  1N72 A;  4F3I A;  4N3W A;  5F61 A;  4Z93 A;  5ETD A;  5EWD A;  4MR4 A;  5KTU A;  3JVJ A;  3QZS A;  4XYA A;  5TB6 A; 
#chains in the Genus database with same CATH topology
 5E73 A;  5E3D A;  4PCE A;  2YQD A;  2D9E A;  3IU5 A;  3LXJ A;  4MR5 A;  4A9O A;  4AKN A;  4QSQ A;  2R0S A;  4IR3 A;  3O33 A;  5D3P A;  5I86 A;  5D3L A;  5G4R A;  2DVV A;  3Q2F A;  4NR6 A;  4QSV A;  5CY9 A;  5KU3 A;  3SVF A;  5CUG A;  5EVA A;  3UV2 A;  4QC1 A;  3JVM A;  3UVD A;  5AMF A;  4YAX A;  4KV4 A;  4OGJ A;  5IG6 A;  5II2 A;  5HFQ A;  4TYL A;  5I7X A;  5D3S A;  5D3J A;  4CLB A;  4YYM A;  3LJW A;  4NRB A;  3MB3 A;  5LKX A;  4N4I A;  5EA1 A;  4YYN A;  4NYX A;  1ZKR A;  2RNY A;  4YC9 A;  4YH3 A;  4CUQ A;  4PS5 A;  4PY6 A;  3DWY A;  4NQM A;  4BW3 A;  4TQN A;  5CUA A;  5DBM A;  5FB0 A;  5A81 A;  2G4A A;  3ZYU A;  4ZQL A;  5I88 A;  4QEV A;  2YW5 A;  5EP7 A;  3UVY A;  5LKT A;  3LQH A;  5E9M A;  4O76 A;  4O75 A;  4YAB A;  4HBV A;  4TU4 A;  3TLP A;  2RO1 A;  5F1H A;  5A85 A;  4QZS A;  4QYD A;  5JI8 A;  4NUD A;  5CPE A;  1JSP B;  4LYI A;  3HMF A;  1E6I A;  4CUR A;  3G0J A;  4Z1Q A;  5FG4 A;  5HEL A;  4QSX A;  5C89 A;  5L98 A;  4PKL A;  5FE9 A;  5D26 A;  5A5S A;  4QST A;  2OO1 A;  4XY9 A;  3P5O A;  5ENF A;  3I3J A;  5ACY A;  5F1L A;  3MUK A;  5BT5 A;  2F6J A;  5CZG A;  3AQA A;  4J0R A;  5CTL A;  4Z6I A;  5LKU A;  4O74 A;  2EJN A;  3U5M A;  5FH8 A;  5HEN A;  4TZ8 A;  5FFY A;  4HXL A;  4IR4 A;  5FE2 A;  2L84 A;  5G4S A;  2WP2 A;  4YBS A;  5HFR A;  4UIU A;  5ENC A;  4HXP A;  4A9N A;  5A5O A;  4NXJ A;  3NXB A;  5A83 A;  5AD2 A;  5EIS A;  5CQA A;  3U5N A;  4NRA A;  5CU8 A;  4YAT A;  4BW1 A;  5K29 A;  4N4F A;  4BW4 A;  5EV9 A;  4NRC A;  5FE6 A;  4XUA A;  5E0R A;  5KHM A;  4ALH A;  1ZS5 A;  1WUM A;  3P1D A;  4UYF A;  4YYJ A;  2I8N A;  4LC2 A;  2LSP B;  4AKG A;  5FBX A;  5FE4 A;  5EWV A;  3VKH A;  4MEN A;  4HBY A;  4TT2 A;  4NYV A;  5CGP A;  5ETB A;  4OUF A;  3RCW A;  4QSS A;  3P1C A;  2H60 A;  4A9F A;  1F68 A;  4CL9 A;  5F62 A;  5HRV A;  3D1B A;  5ENI A;  5A7C A;  5I83 A;  4KV1 A;  5I80 A;  4MEO A;  4NS5 A;  5HQ7 A;  5D25 A;  4Z6H A;  4YYG A;  2R10 A;  5D7X A;  5HLS A;  5H1V A;  5IGN A;  5A5Q A;  2DKW A;  4MR3 A;  4N4H A;  2I7K A;  4KCX A;  4O77 A;  4QSP A;  4CFK A;  5H1U A;  5LVR A;  3ONI A;  5JWM A;  4MR6 A;  4O71 A;  5HCL A;  4HXM A;  5F36 A;  2RS9 B;  5COI A;  2OUO A;  2MJV B;  5DKD A;  4CFL A;  3Q2E A;  5D3H A;  2DWW A;  5C7N A;  4YYI A;  4O7F A;  3ERR A;  5FE5 A;  4NQN A;  4GPJ A;  5E9L A;  5IGL A;  5L8U A;  3UW9 A;  1JM4 B;  4QR4 A;  3JVL A;  4YBT A;  5F5Z A;  4AKH A;  4TS8 A;  5E9V A;  5CUB A;  4RVR A;  4YYK A;  2R0V A;  4IR6 A;  2DVQ A;  2YEL A;  5CRZ A;  5ENE A;  5FB1 A;  4ZC9 A;  5DYX A;  2WP1 A;  5KTX A;  5KTW A;  5EPB A;  4O7C A;  5E9K A;  4A9K A;  4XUB A;  3D1D A;  4QBM A;  3G0L A;  4OGI A;  4IR5 A;  2RFJ A;  4UIY A;  5CQT A;  4UIZ A;  5DW1 A;  2DVS A;  5F2P A;  4QB3 A;  2YDW A;  5DX4 A;  5FG5 A;  3GG3 A;  4WHU A;  5HQ5 A;  5D3N A;  5AD3 A;  3DAI A;  5D3R A;  5CQ8 A;  5I40 A;  4HXN A;  4NR9 A;  5LVQ A;  5A82 A;  5DLX A;  5I1Q A;  4XY8 A;  3O36 A;  3AAD A;  4C66 A;  4Y03 A;  4LZR A;  5F60 A;  4YBM A;  5FE8 A;  3MUL A;  5LUU A;  5DFD A;  5HQ6 A;  5DLZ A;  5LKZ A;  5DYC A;  4NUE A;  5C4Q A;  4UIT A;  5EK9 A;  5FH6 A;  2KTB B;  5DYA A;  5FFW A;  4IOR A;  5I29 A;  4J1P A;  4A9J A;  2OSS A;  4NR5 A;  3LQI A;  5DKH A;  4YYD A;  4NR4 A;  5TCM A;  4UYE A;  2E7O A;  4LR6 A;  4UIX A;  3U5O A;  3VKG A;  5ENB A;  5C8G A;  4LDF A;  5FE7 A;  5IID A;  4NR8 A;  2DVR A;  3D7C A;  5EPR A;  4E96 A;  1PUO A;  4ALG A;  2RNX A;  4YYH A;  2R0Y A;  4LZS A;  5EI4 A;  4UYD A;  5CQ4 A;  5CS8 A;  5CP5 A;  3JVK A;  4A9H A;  5ENG A;  4NR7 A;  5HEM A;  3U5J A;  4TU6 A;  4O70 A;  3UVW A;  5LJ0 A;  2E3K A;  3P1E A;  5FE3 A;  4CUT A;  5A5P A;  4TT4 A;  5C87 A;  4HBW A;  2N9G A;  4CUP A;  4QUT A;  5EPS A;  4HXR A;  5DFC A;  4BJX A;  4Q0O A;  5EWH A;  5EU1 A;  5H1T A;  4PTB A;  4LZ2 A;  4O7A A;  5BT3 A;  4QSR A;  4YH4 A;  3HME A;  5ENJ A;  3O34 A;  4QUU A;  5CQ7 A;  2D82 A;  4O72 A;  5IBN A;  4QR5 A;  5CFW A;  3QZV A;  5FE0 A;  5FH7 A;  5CQ6 A;  5E74 A;  4LYS A;  5ENH A;  4BW2 A;  4N4G A;  4A9M A;  5D0C A;  3SVH A;  4QR3 A;  4J0S A;  5LJ2 A;  3LQJ A;  5E7D A;  4PCI A;  4QC3 A;  3UV4 A;  5J0D A;  5FDZ A;  5CUE A;  2FSA A;  3U5K A;  5I7Y A;  4YY6 A;  4UYH A;  2GRC A;  3QZT A;  4LRG A;  4NYW A;  3P1F A;  4YY4 A;  4QSU A;  5L97 A;  4FLP A;  5E9I A;  4QNS A;  4QSW A;  4HXO A;  2F6N A;  4CUS A;  2YEM A;  4QYL A;  4C67 A;  5FFV A;  4QEU A;  5DY7 A;  4HXS A;  5CRM A;  5CUC A;  4DON A;  5A5N A;  5EWC A;  1EQF A;  5D24 A;  4Z1S A;  4TTE A;  4UIW A;  5EGU A;  5EQ1 A;  4Q0N A;  4AI6 A;  5IGK A;  4UIV A;  5DW2 A;  4HBX A;  5LJ1 A;  5F25 A;  4QEW A;  4MEQ A;  4O7B A;  2RI7 A;  4TZ2 A;  5II1 A;  2YYN A;  5EIC A;  3UV5 A;  4O7E A;  5KO4 A;  3HMH A;  2L85 A;  4CUU A;  5F3A A;  4IOQ A;  4ZW1 A;  5DFB A;  5HRW A;  4A9L A;  2DAT A;  4UYG A;  4O78 A;  3U5L A;  4UYF B;  2E7N A;  5FE1 A;  3MB4 A;  3U5P A;  5CQ5 A;  5A5R A;  5HM0 A;  5CUD A;  2RNW A;  4YAD A;  5EM3 A;  3MQM A;  5FG6 A;  3IU6 A;  5HRX A;  5D3T A;  5F63 A;  5CQ3 A;  5EWW A;  5BT4 A;  4QY4 A;  5I89 A;  4LYW A;  4AKI A;  5HJC A;  5DYU A;  4IOO A;  5L96 A;  1X0J A;  4A9E A;  5E9Y A;  4TT6 A;  2NXB A;  4WIV A;  3O37 A;  4HXK A;  3FKM X;  3K2J A;  4A9I A;  3O35 A;  4NUC A;  1WUG A;  2YEK A;  4J3I A;  3MXF A;  4WHW A;  5H85 A;  5AME A;  5E3G A;  3UVX A;  4BHW A;  2L5E A;  5L8T A;  5L99 A;  4YK0 A;  5DKC A;  3SVG A;  3S92 A;  5C85 A;  4MEP A;  4X2I A;  5IGM A;  3S91 A;  1N72 A;  4F3I A;  4N3W A;  5F61 A;  4Z93 A;  5ETD A;  5EWD A;  4MR4 A;  5KTU A;  3JVJ A;  3QZS A;  4XYA A;  5TB6 A; 
#chains in the Genus database with same CATH homology
 5E73 A;  5E3D A;  4PCE A;  2YQD A;  2D9E A;  3IU5 A;  3LXJ A;  4MR5 A;  4A9O A;  4AKN A;  4QSQ A;  2R0S A;  4IR3 A;  3O33 A;  5D3P A;  5I86 A;  5D3L A;  5G4R A;  2DVV A;  3Q2F A;  4NR6 A;  4QSV A;  5CY9 A;  5KU3 A;  3SVF A;  5CUG A;  5EVA A;  3UV2 A;  4QC1 A;  3JVM A;  3UVD A;  5AMF A;  4YAX A;  4KV4 A;  4OGJ A;  5IG6 A;  5II2 A;  5HFQ A;  4TYL A;  5I7X A;  5D3S A;  5D3J A;  4CLB A;  4YYM A;  3LJW A;  4NRB A;  3MB3 A;  5LKX A;  4N4I A;  5EA1 A;  4YYN A;  4NYX A;  2RNY A;  4YC9 A;  4YH3 A;  4CUQ A;  4PS5 A;  4PY6 A;  3DWY A;  4NQM A;  4BW3 A;  4TQN A;  5CUA A;  5DBM A;  5FB0 A;  5A81 A;  2G4A A;  3ZYU A;  4ZQL A;  5I88 A;  4QEV A;  2YW5 A;  5EP7 A;  3UVY A;  5LKT A;  3LQH A;  5E9M A;  4O76 A;  4O75 A;  4YAB A;  4HBV A;  4TU4 A;  3TLP A;  2RO1 A;  5F1H A;  5A85 A;  4QZS A;  4QYD A;  5JI8 A;  4NUD A;  5CPE A;  1JSP B;  4LYI A;  3HMF A;  1E6I A;  4CUR A;  3G0J A;  4Z1Q A;  5FG4 A;  5HEL A;  4QSX A;  5C89 A;  5L98 A;  4PKL A;  5FE9 A;  5D26 A;  5A5S A;  4QST A;  2OO1 A;  4XY9 A;  3P5O A;  5ENF A;  3I3J A;  5ACY A;  5F1L A;  3MUK A;  5BT5 A;  2F6J A;  5CZG A;  3AQA A;  4J0R A;  5CTL A;  4Z6I A;  5LKU A;  4O74 A;  3U5M A;  5FH8 A;  5HEN A;  4TZ8 A;  5FFY A;  4HXL A;  4IR4 A;  5FE2 A;  2L84 A;  5G4S A;  2WP2 A;  4YBS A;  5HFR A;  4UIU A;  5ENC A;  4HXP A;  4A9N A;  5A5O A;  4NXJ A;  3NXB A;  5A83 A;  5AD2 A;  5EIS A;  5CQA A;  3U5N A;  4NRA A;  5CU8 A;  4YAT A;  4BW1 A;  5K29 A;  4N4F A;  4BW4 A;  5EV9 A;  4NRC A;  5FE6 A;  4XUA A;  5E0R A;  5KHM A;  4ALH A;  1ZS5 A;  1WUM A;  3P1D A;  4UYF A;  4YYJ A;  2I8N A;  4LC2 A;  2LSP B;  5FBX A;  5FE4 A;  5EWV A;  4MEN A;  4HBY A;  4TT2 A;  4NYV A;  5CGP A;  5ETB A;  4OUF A;  3RCW A;  4QSS A;  3P1C A;  2H60 A;  4A9F A;  1F68 A;  4CL9 A;  5F62 A;  5HRV A;  5A7C A;  5ENI A;  5I83 A;  4KV1 A;  5I80 A;  4MEO A;  4NS5 A;  5HQ7 A;  5D25 A;  4Z6H A;  4YYG A;  2R10 A;  5D7X A;  5HLS A;  5H1V A;  5IGN A;  5A5Q A;  2DKW A;  4MR3 A;  4N4H A;  2I7K A;  4KCX A;  4O77 A;  4QSP A;  4CFK A;  5H1U A;  5LVR A;  3ONI A;  5JWM A;  4MR6 A;  4O71 A;  5HCL A;  4HXM A;  5F36 A;  2RS9 B;  5COI A;  2OUO A;  2MJV B;  5DKD A;  4CFL A;  3Q2E A;  5D3H A;  2DWW A;  5C7N A;  4YYI A;  4O7F A;  5FE5 A;  4NQN A;  4GPJ A;  5E9L A;  5IGL A;  5L8U A;  3UW9 A;  1JM4 B;  4QR4 A;  3JVL A;  4YBT A;  5F5Z A;  4TS8 A;  5E9V A;  5CUB A;  4RVR A;  4YYK A;  2R0V A;  4IR6 A;  2DVQ A;  2YEL A;  5CRZ A;  5ENE A;  5FB1 A;  4ZC9 A;  5DYX A;  2WP1 A;  5KTX A;  5KTW A;  5EPB A;  4O7C A;  5E9K A;  4A9K A;  4XUB A;  4QBM A;  3G0L A;  4OGI A;  4IR5 A;  2RFJ A;  4UIY A;  5CQT A;  4UIZ A;  5DW1 A;  2DVS A;  5F2P A;  4QB3 A;  2YDW A;  5DX4 A;  5FG5 A;  3GG3 A;  4WHU A;  5HQ5 A;  5D3N A;  5AD3 A;  3DAI A;  5D3R A;  5CQ8 A;  5I40 A;  4HXN A;  4NR9 A;  5LVQ A;  5A82 A;  5DLX A;  5I1Q A;  4XY8 A;  3O36 A;  3AAD A;  4C66 A;  4Y03 A;  4LZR A;  5F60 A;  4YBM A;  5FE8 A;  3MUL A;  5LUU A;  5DFD A;  5HQ6 A;  5DLZ A;  5LKZ A;  5DYC A;  4NUE A;  5C4Q A;  4UIT A;  5EK9 A;  5FH6 A;  2KTB B;  5DYA A;  5FFW A;  4IOR A;  5I29 A;  4J1P A;  4A9J A;  2OSS A;  4NR5 A;  3LQI A;  5DKH A;  4YYD A;  4NR4 A;  5TCM A;  4UYE A;  2E7O A;  4LR6 A;  4UIX A;  3U5O A;  5ENB A;  5C8G A;  4LDF A;  5FE7 A;  5IID A;  4NR8 A;  2DVR A;  3D7C A;  5EPR A;  4E96 A;  4ALG A;  2RNX A;  4YYH A;  2R0Y A;  4LZS A;  5EI4 A;  4UYD A;  5CQ4 A;  5CS8 A;  5CP5 A;  3JVK A;  4A9H A;  5ENG A;  4NR7 A;  5HEM A;  3U5J A;  4TU6 A;  4O70 A;  3UVW A;  5LJ0 A;  2E3K A;  3P1E A;  5FE3 A;  4CUT A;  5A5P A;  4TT4 A;  5C87 A;  4HBW A;  2N9G A;  4CUP A;  4QUT A;  5EPS A;  4HXR A;  5DFC A;  4BJX A;  4Q0O A;  5EWH A;  5EU1 A;  5H1T A;  4PTB A;  4LZ2 A;  4O7A A;  5BT3 A;  4QSR A;  4YH4 A;  3HME A;  5ENJ A;  3O34 A;  4QUU A;  5CQ7 A;  2D82 A;  4O72 A;  5IBN A;  4QR5 A;  5CFW A;  3QZV A;  5FE0 A;  5FH7 A;  5CQ6 A;  5E74 A;  4LYS A;  5ENH A;  4BW2 A;  4N4G A;  4A9M A;  5D0C A;  3SVH A;  4QR3 A;  4J0S A;  5LJ2 A;  3LQJ A;  5E7D A;  4PCI A;  4QC3 A;  3UV4 A;  5J0D A;  5FDZ A;  5CUE A;  2FSA A;  3U5K A;  5I7Y A;  4YY6 A;  4UYH A;  2GRC A;  3QZT A;  4LRG A;  4NYW A;  3P1F A;  4YY4 A;  4QSU A;  5L97 A;  4FLP A;  5E9I A;  4QNS A;  4QSW A;  4HXO A;  2F6N A;  4CUS A;  2YEM A;  4QYL A;  4C67 A;  5FFV A;  4QEU A;  5DY7 A;  4HXS A;  5CRM A;  5CUC A;  4DON A;  5A5N A;  5EWC A;  1EQF A;  5D24 A;  4Z1S A;  4TTE A;  4UIW A;  5EGU A;  5EQ1 A;  4Q0N A;  5IGK A;  4UIV A;  5DW2 A;  4HBX A;  5LJ1 A;  5F25 A;  4QEW A;  4MEQ A;  4O7B A;  2RI7 A;  4TZ2 A;  5II1 A;  2YYN A;  5EIC A;  3UV5 A;  4O7E A;  5KO4 A;  3HMH A;  2L85 A;  4CUU A;  5F3A A;  4IOQ A;  4ZW1 A;  5DFB A;  5HRW A;  4A9L A;  2DAT A;  4UYG A;  4O78 A;  3U5L A;  4UYF B;  2E7N A;  5FE1 A;  3MB4 A;  3U5P A;  5CQ5 A;  5A5R A;  5HM0 A;  5CUD A;  2RNW A;  4YAD A;  5EM3 A;  3MQM A;  5FG6 A;  3IU6 A;  5HRX A;  5D3T A;  5F63 A;  5CQ3 A;  5EWW A;  5BT4 A;  4QY4 A;  5I89 A;  4LYW A;  5HJC A;  5DYU A;  4IOO A;  5L96 A;  1X0J A;  4A9E A;  5E9Y A;  4TT6 A;  2NXB A;  4WIV A;  3O37 A;  4HXK A;  3FKM X;  3K2J A;  4A9I A;  3O35 A;  4NUC A;  1WUG A;  2YEK A;  4J3I A;  3MXF A;  4WHW A;  5H85 A;  5AME A;  5E3G A;  3UVX A;  4BHW A;  2L5E A;  5L8T A;  5L99 A;  4YK0 A;  5DKC A;  3SVG A;  3S92 A;  5C85 A;  4MEP A;  4X2I A;  5IGM A;  3S91 A;  1N72 A;  4F3I A;  4N3W A;  5F61 A;  4Z93 A;  5ETD A;  5EWD A;  4MR4 A;  5KTU A;  3JVJ A;  3QZS A;  4XYA A;  5TB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...