2D82A

Target structure-based discovery of small molecules that block human p53 and creb binding protein (cbp) association
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
GSHMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CREB-binding protein
publication title Target structure-based discovery of small molecules that block human p53 and CREB binding protein association
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 121
sequence length 121
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2d82A00
5EM3A 3DAIA 4QC3A 5FE0A 4QC1A 5E9IA 5LUUA 4QSSA 4YBMA 5F2PA 2YELA 3GG3A 2YYNA 4TS8A 2DKWA 5DYXA 5IGLA 4TZ2A 5ENEA 3S91A 5LVQA 3U5MA 5LKZA 4FLPA 5F62A 4MEPA 4NUEA 5H85A 4Q0OA 5II2A 4J1PA 4YK0A 5HQ6A 5EPRA 4XUBA 3S92A 4CUQA 4N3WA 5CQ4A 4KCXA 5F3AA 4UYFB 5DW1A 5BT5A 5L8TA 2WP1A 2R0YA 3SVFA 5FH6A 4NR8A 4QY4A 4A9EA 5CZGA 4TT4A 5ENIA 4LRGA 5FH7A 4HBYA 4MR4A 2E7NA 2I7KA 3D7CA 5FE4A 5CS8A 5DY7A 5I88A 5FFVA 4Z1SA 1WUMA 2RNYA 4NRCA 4TT2A 5K29A 4QUUA 3O33A 4O77A 3SVHA 5F61A 4WHWA 4NQMA 5ENJA 2YDWA 3P1FA 3O37A 5F5ZA 5I7YA 3HMFA 2E3KA 4O7BA 4YYNA 2N9GA 2D82A 4NR5A 5CUDA 5LJ1A 5CQTA 4O7FA 5FBXA 5F1LA 4QSTA 5CQ6A 5HFQA 5E73A 5DX4A 3P5OA 4MR6A 5DLZA 4E96A 3U5LA 5CFWA 4BJXA 4YYIA 4Z93A 2LSPB 4J0SA 3MB3A 4NS5A 4LYSA 5AD2A 4BW1A 4LC2A 4O74A 4TU4A 4A9OA 4IR4A 4UYHA 5CQ3A 4MR3A 4YATA 5C87A 4YYDA 5ETDA 4DONA 5E3GA 3AQAA 5I89A 4LYWA 4UIUA 4C66A 5AD3A 4QEUA 5ENGA 4HBXA 5L97A 5A5SA 3LQJA 5H1VA 2R0VA 3O35A 5HLSA 3MUKA 4KV1A 4QNSA 1F68A 2MJVB 5D26A 4HBWA 4BW4A 2G4AA 4WIVA 5DBMA 4F3IA 5KO4A 4PTBA 3JVJA 4IR3A 5HENA 5C89A 4O7CA 5E9VA 1JM4B 3O36A 5II1A 5CUAA 4YYJA 5HEMA 5JI8A 5I29A 5KTWA 5EWDA 5I7XA 5EQ1A 5EK9A 3IU5A 5A7CA 5FFYA 4YH4A 4XY8A 4RVRA 4Y03A 4TT6A 2F6NA 4O70A 5EU1A 5D25A 4QZSA 4N4FA 1N72A 4X2IA 4HXPA 4O71A 5E9MA 5ENCA 5L99A 1JSPB 5EVAA 5DFDA 4J3IA 4O76A 4O78A 2NXBA 3JVKA 3P1DA 5A85A 2OSSA 3UV4A 3HMHA 5FE8A 5KTXA 5TCMA 4HXKA 5J0DA 4Z6IA 3FKMX 5EWWA 4C67A 5LKTA 3UV2A 5L8UA 1WUGA 4J0RA 4YC9A 1E6IA 5FH8A 5DKCA 4UIXA 4TYLA 4HXMA 4HBVA 4PS5A 4NR7A 4QUTA 4NUCA 4GPJA 5IGKA 4HXNA 5FE3A 4QSPA 4YY4A 5EGUA 4QB3A 5F25A 5IIDA 3IU6A 5LKUA 2E7OA 5EWVA 2YW5A 5ENBA 5HFRA 3RCWA 5EPSA 2L5EA 2H60A 4PCEA 3MQMA 2L84A 5D3TA 5A5PA 5IGMA 5C4QA 5HRXA 5I83A 4CUSA 5BT3A 5A81A 3P1EA 4NR6A 5E7DA 5FE6A 4YYHA 5A83A 4A9LA 4YYGA 4NR4A 5KHMA 4O75A 5ETBA 5HELA 4QBMA 5CUCA 4LYIA 5CUBA 3I3JA 4MENA 5DKHA 5CQ8A 4NRBA 4AKNA 3QZVA 4QYDA 4UYFA 5EI4A 3LQHA 4BW2A 4QSRA 5L98A 3LQIA 3MULA 5LJ0A 5CU8A 5H1TA 4QSVA 4PKLA 4LDFA 4UIWA 4Z1QA 4HXLA 4NRAA 4BHWA 5CPEA 4A9IA 5FB1A 4ZQLA 4XUAA 3JVMA 5CP5A 3U5JA 4ZC9A 5D3RA 4TTEA 4CL9A 5DFCA 5E0RA 5HQ7A 3ONIA 4MEQA 4NUDA 3MXFA 5HCLA 5FE2A 2OO1A 2OUOA 4O7EA 3MB4A 5I80A 2DVRA 2R10A 4TQNA 4LZSA 4IR6A 5D3NA 4UYDA 5FDZA 4CUUA 4ALGA 5TB6A 3G0JA 5DYCA 5EA1A 4XYAA 4UIZA 5FG5A 4LZ2A 4Z6HA 3NXBA 3SVGA 3UVDA 2DVSA 4UYGA 3UV5A 5A82A 5ENFA 5COIA 2YQDA 4YBTA 5CRMA 5F1HA 4CURA 4A9KA 4CFLA 5C8GA 2D9EA 4QR3A 3LJWA 2RFJA 4A9JA 5A5RA 4ALHA 4YY6A 3ZYUA 4IOOA 5LJ2A 4NR9A 4QR5A 4UYEA 4CFKA 5I40A 4XY9A 5HQ5A 2F6JA 4TZ8A 3U5OA 4WHUA 4PCIA 5KTUA 4UIVA 4BW3A 5ACYA 5FE9A 2DVVA 5DKDA 4O7AA 5D3LA 5E74A 3QZTA 5DLXA 5IG6A 2RO1A 4OGJA 5C7NA 5HM0A 4MR5A 3DWYA 5HJCA 5CQ7A 4UITA 4Q0NA 5LVRA 3TLPA 5D3SA 4TU6A 4MEOA 5E9KA 4CUPA 5JWMA 4CUTA 4YAXA 1X0JA 4QYLA 3P1CA 4QEVA 5D24A 5HRVA 4UIYA 5EP7A 5BT4A 4IR5A 2RS9B 4QSQA 5HRWA 4O72A 5DYAA 4NXJA 4N4IA 1ZS5A 5CY9A 4YBSA 4NYWA 4LZRA 5CQ5A 5F60A 4YYMA 2KTBB 3O34A 4YADA 4IORA 5F63A 3Q2EA 5H1UA 5FE5A 5EWCA 3JVLA 4HXOA 4NQNA 5G4RA 5E9LA 5A5QA 4QR4A 5FE1A 3U5KA 5D0CA 5EV9A 1EQFA 2RNWA 3UVWA 3U5PA 4A9NA 5I86A 5EWHA 2WP2A 2R0SA 5CUGA 4IOQA 3Q2FA 5KU3A 5AMEA 5IBNA 4QSXA 4N4HA 4CLBA 5A5OA 4OUFA 5CUEA 4NYXA 5AMFA 5C85A 5A5NA 2RNXA 4QSUA 5FFWA 5L96A 4A9FA 3K2JA 3LXJA 5FE7A 4HXSA 5D3PA 3AADA 5LKXA 2GRCA 2YEKA 2I8NA 5E9YA 5CTLA 5EPBA 3HMEA 2DWWA 4N4GA 3UVYA 4A9HA 4PY6A 5D3JA 3U5NA 4NYVA 5DYUA 4YYKA 2L85A 4HXRA 5DW2A 5D3HA 4QEWA 5EISA 4LR6A 4KV4A 3UVXA 2DATA 5I1QA 5FB0A 3UW9A 5CQAA 3QZSA 5E3DA 5ENHA 2YEMA 2RI7A 4YH3A 5FG4A 4QSWA 5F36A 4ZW1A 4OGIA 5CGPA 5CRZA 2FSAA 2DVQA 5G4SA 3G0LA 4A9MA 5FG6A 5IGNA 5EICA 4YABA 5D7XA 5DFBA
chains in the Genus database with same CATH superfamily
5EM3A 3DAIA 4QC3A 5FE0A 4QC1A 5E9IA 5LUUA 4QSSA 4YBMA 5F2PA 2YELA 3GG3A 2YYNA 4TS8A 2DKWA 5DYXA 5IGLA 4TZ2A 5ENEA 3S91A 5LVQA 3U5MA 5LKZA 4FLPA 5F62A 4MEPA 4NUEA 5H85A 4Q0OA 5II2A 4J1PA 4YK0A 5HQ6A 5EPRA 4XUBA 3S92A 4CUQA 4N3WA 5CQ4A 4KCXA 5F3AA 4UYFB 5DW1A 5BT5A 5L8TA 2WP1A 2R0YA 3SVFA 5FH6A 4NR8A 4QY4A 4A9EA 5CZGA 4TT4A 5ENIA 4LRGA 5FH7A 4HBYA 4MR4A 2E7NA 2I7KA 3D7CA 5FE4A 5CS8A 5DY7A 5I88A 5FFVA 4Z1SA 1WUMA 2RNYA 4NRCA 4TT2A 5K29A 4QUUA 3O33A 4O77A 3SVHA 5F61A 4WHWA 4NQMA 5ENJA 2YDWA 3P1FA 3O37A 5F5ZA 5I7YA 3HMFA 2E3KA 4O7BA 4YYNA 2N9GA 2D82A 4NR5A 5CUDA 5LJ1A 5CQTA 4O7FA 5FBXA 5F1LA 4QSTA 5CQ6A 5HFQA 5E73A 5DX4A 3P5OA 4MR6A 5DLZA 4E96A 3U5LA 5CFWA 4BJXA 4YYIA 4Z93A 2LSPB 4J0SA 3MB3A 4NS5A 4LYSA 5AD2A 4BW1A 4LC2A 4O74A 4TU4A 4A9OA 4IR4A 4UYHA 5CQ3A 4MR3A 4YATA 5C87A 4YYDA 5ETDA 3D1DA 4DONA 5E3GA 3AQAA 5I89A 4LYWA 4UIUA 4C66A 5AD3A 4QEUA 5ENGA 4HBXA 5L97A 5A5SA 3LQJA 3D1BA 5H1VA 2R0VA 3O35A 5HLSA 3MUKA 4KV1A 4QNSA 1F68A 2MJVB 5D26A 4HBWA 4BW4A 2G4AA 4WIVA 5DBMA 4F3IA 5KO4A 4PTBA 3JVJA 4IR3A 5HENA 5C89A 4O7CA 5E9VA 1JM4B 3O36A 5II1A 5CUAA 4YYJA 5HEMA 5JI8A 5I29A 5KTWA 5EWDA 5I7XA 5EQ1A 5EK9A 3IU5A 5A7CA 5FFYA 4YH4A 4XY8A 4RVRA 4Y03A 4TT6A 2F6NA 4O70A 5EU1A 1PUOA 4QZSA 5D25A 4N4FA 1N72A 4X2IA 4HXPA 4O71A 5E9MA 5ENCA 5L99A 1JSPB 5EVAA 5DFDA 4J3IA 4O76A 4O78A 2NXBA 3JVKA 3P1DA 5A85A 2OSSA 3UV4A 3HMHA 5FE8A 5KTXA 5TCMA 4HXKA 5J0DA 4Z6IA 3FKMX 5EWWA 4C67A 5LKTA 3UV2A 5L8UA 1WUGA 3VKGA 4J0RA 4YC9A 1E6IA 5FH8A 4AI6A 5DKCA 4UIXA 4TYLA 4HXMA 4HBVA 4PS5A 4NR7A 4QUTA 4NUCA 4GPJA 5IGKA 4HXNA 5FE3A 4QSPA 4YY4A 5EGUA 4QB3A 3VKHA 5F25A 5IIDA 3IU6A 5LKUA 2E7OA 5EWVA 2YW5A 5ENBA 5HFRA 3RCWA 5EPSA 2L5EA 2H60A 4PCEA 3MQMA 2L84A 5D3TA 5A5PA 5IGMA 5C4QA 5HRXA 5I83A 4CUSA 5BT3A 5A81A 3P1EA 4NR6A 5E7DA 5FE6A 4YYHA 5A83A 4A9LA 4YYGA 4NR4A 5KHMA 4O75A 5ETBA 5HELA 4QBMA 5CUCA 4LYIA 5CUBA 3I3JA 4MENA 5DKHA 5CQ8A 4NRBA 4AKNA 3QZVA 4QYDA 4UYFA 5EI4A 3LQHA 4BW2A 3ERRA 4QSRA 5L98A 3LQIA 3MULA 5LJ0A 5CU8A 5H1TA 4QSVA 4PKLA 4LDFA 4UIWA 4Z1QA 4HXLA 4NRAA 4BHWA 5CPEA 4A9IA 5FB1A 4ZQLA 4XUAA 3JVMA 5CP5A 3U5JA 4ZC9A 5D3RA 4TTEA 4CL9A 5DFCA 5E0RA 5HQ7A 3ONIA 4MEQA 4NUDA 3MXFA 5HCLA 5FE2A 2OO1A 2OUOA 4O7EA 3MB4A 5I80A 2DVRA 2R10A 4TQNA 4LZSA 4IR6A 5D3NA 4UYDA 5FDZA 4CUUA 4ALGA 5TB6A 3G0JA 5DYCA 5EA1A 4XYAA 4UIZA 5FG5A 4LZ2A 4Z6HA 3NXBA 3SVGA 3UVDA 2DVSA 4UYGA 3UV5A 5A82A 5ENFA 5COIA 2YQDA 4YBTA 5CRMA 5F1HA 4CURA 4A9KA 4CFLA 5C8GA 2D9EA 4QR3A 3LJWA 2RFJA 4A9JA 5A5RA 4ALHA 4YY6A 3ZYUA 4IOOA 5LJ2A 4NR9A 4QR5A 4UYEA 4CFKA 5I40A 4XY9A 5HQ5A 2F6JA 4TZ8A 3U5OA 4WHUA 4PCIA 5KTUA 4UIVA 4BW3A 5ACYA 5FE9A 2DVVA 5DKDA 4O7AA 5D3LA 5E74A 3QZTA 5DLXA 4AKGA 5IG6A 2RO1A 4OGJA 5C7NA 5HM0A 4MR5A 3DWYA 5HJCA 5CQ7A 4UITA 4Q0NA 5LVRA 3TLPA 5D3SA 4TU6A 4MEOA 5E9KA 4CUPA 5JWMA 4CUTA 4YAXA 1X0JA 4QYLA 3P1CA 4QEVA 5D24A 5HRVA 4UIYA 5EP7A 5BT4A 4IR5A 2RS9B 4QSQA 5HRWA 4O72A 5DYAA 4NXJA 4N4IA 1ZS5A 5CY9A 4YBSA 4NYWA 4LZRA 5CQ5A 5F60A 4YYMA 2KTBB 3O34A 4YADA 4IORA 4AKHA 5F63A 3Q2EA 5H1UA 5FE5A 5EWCA 3JVLA 4HXOA 4NQNA 5G4RA 5E9LA 5A5QA 2EJNA 4QR4A 5FE1A 3U5KA 5D0CA 5EV9A 1EQFA 2RNWA 3UVWA 3U5PA 4A9NA 5I86A 5EWHA 2WP2A 2R0SA 5CUGA 4IOQA 3Q2FA 5KU3A 5AMEA 5IBNA 4QSXA 4N4HA 4CLBA 5A5OA 4OUFA 5CUEA 4NYXA 5AMFA 5C85A 5A5NA 2RNXA 4QSUA 5FFWA 5L96A 4A9FA 3K2JA 3LXJA 5FE7A 4HXSA 5D3PA 3AADA 5LKXA 2GRCA 2YEKA 2I8NA 5E9YA 5CTLA 5EPBA 3HMEA 2DWWA 4N4GA 3UVYA 4A9HA 4PY6A 5D3JA 3U5NA 4NYVA 5DYUA 4YYKA 4AKIA 1ZKRA 2L85A 4HXRA 5DW2A 5D3HA 4QEWA 5EISA 4LR6A 4KV4A 3UVXA 2DATA 5I1QA 5FB0A 3UW9A 5CQAA 3QZSA 5E3DA 5ENHA 2YEMA 2RI7A 4YH3A 5FG4A 4QSWA 5F36A 4ZW1A 4OGIA 5CGPA 5CRZA 2FSAA 2DVQA 5G4SA 3G0LA 4A9MA 5FG6A 5IGNA 5EICA 4YABA 5D7XA 5DFBA
chains in the Genus database with same CATH topology
5EM3A 3DAIA 4QC3A 5FE0A 4QC1A 5E9IA 5LUUA 4QSSA 4YBMA 5F2PA 2YELA 3GG3A 2YYNA 4TS8A 2DKWA 5DYXA 5IGLA 4TZ2A 5ENEA 3S91A 5LVQA 3U5MA 5LKZA 4FLPA 5F62A 4MEPA 4NUEA 5H85A 4Q0OA 5II2A 4J1PA 4YK0A 5HQ6A 5EPRA 4XUBA 3S92A 4CUQA 4N3WA 5CQ4A 4KCXA 5F3AA 4UYFB 5DW1A 5BT5A 5L8TA 2WP1A 2R0YA 3SVFA 5FH6A 4NR8A 4QY4A 4A9EA 5CZGA 4TT4A 5ENIA 4LRGA 5FH7A 4HBYA 4MR4A 2E7NA 2I7KA 3D7CA 5FE4A 5CS8A 5DY7A 5I88A 5FFVA 4Z1SA 1WUMA 2RNYA 4NRCA 4TT2A 5K29A 4QUUA 3O33A 4O77A 3SVHA 5F61A 4WHWA 4NQMA 5ENJA 2YDWA 3P1FA 3O37A 5F5ZA 5I7YA 3HMFA 2E3KA 4O7BA 4YYNA 2N9GA 2D82A 4NR5A 5CUDA 5LJ1A 5CQTA 4O7FA 5FBXA 5F1LA 4QSTA 5CQ6A 5HFQA 5E73A 5DX4A 3P5OA 4MR6A 5DLZA 4E96A 3U5LA 5CFWA 4BJXA 4YYIA 4Z93A 2LSPB 4J0SA 3MB3A 4NS5A 4LYSA 5AD2A 4BW1A 4LC2A 4O74A 4TU4A 4A9OA 4IR4A 4UYHA 5CQ3A 4MR3A 4YATA 5C87A 4YYDA 5ETDA 4DONA 5E3GA 3AQAA 5I89A 4LYWA 4UIUA 4C66A 5AD3A 4QEUA 5ENGA 4HBXA 5L97A 5A5SA 3LQJA 5H1VA 2R0VA 3O35A 5HLSA 3MUKA 4KV1A 4QNSA 1F68A 2MJVB 5D26A 4HBWA 4BW4A 2G4AA 4WIVA 5DBMA 4F3IA 5KO4A 4PTBA 3JVJA 4IR3A 5HENA 5C89A 4O7CA 5E9VA 1JM4B 3O36A 5II1A 5CUAA 4YYJA 5HEMA 5JI8A 5I29A 5KTWA 5EWDA 5I7XA 5EQ1A 5EK9A 3IU5A 5A7CA 5FFYA 4YH4A 4XY8A 4RVRA 4Y03A 4TT6A 2F6NA 4O70A 5EU1A 5D25A 4QZSA 4N4FA 1N72A 4X2IA 4HXPA 4O71A 5E9MA 5ENCA 5L99A 1JSPB 5EVAA 5DFDA 4J3IA 4O76A 4O78A 2NXBA 3JVKA 3P1DA 5A85A 2OSSA 3UV4A 3HMHA 5FE8A 5KTXA 5TCMA 4HXKA 5J0DA 4Z6IA 3FKMX 5EWWA 4C67A 5LKTA 3UV2A 5L8UA 1WUGA 4J0RA 4YC9A 1E6IA 5FH8A 5DKCA 4UIXA 4TYLA 4HXMA 4HBVA 4PS5A 4NR7A 4QUTA 4NUCA 4GPJA 5IGKA 4HXNA 5FE3A 4QSPA 4YY4A 5EGUA 4QB3A 5F25A 5IIDA 3IU6A 5LKUA 2E7OA 5EWVA 2YW5A 5ENBA 5HFRA 3RCWA 5EPSA 2L5EA 2H60A 4PCEA 3MQMA 2L84A 5D3TA 5A5PA 5IGMA 5C4QA 5HRXA 5I83A 4CUSA 5BT3A 5A81A 3P1EA 4NR6A 5E7DA 5FE6A 4YYHA 5A83A 4A9LA 4YYGA 4NR4A 5KHMA 4O75A 5ETBA 5HELA 4QBMA 5CUCA 4LYIA 5CUBA 3I3JA 4MENA 5DKHA 5CQ8A 4NRBA 4AKNA 3QZVA 4QYDA 4UYFA 5EI4A 3LQHA 4BW2A 4QSRA 5L98A 3LQIA 3MULA 5LJ0A 5CU8A 5H1TA 4QSVA 4PKLA 4LDFA 4UIWA 4Z1QA 4HXLA 4NRAA 4BHWA 5CPEA 4A9IA 5FB1A 4ZQLA 4XUAA 3JVMA 5CP5A 3U5JA 4ZC9A 5D3RA 4TTEA 4CL9A 5DFCA 5E0RA 5HQ7A 3ONIA 4MEQA 4NUDA 3MXFA 5HCLA 5FE2A 2OO1A 2OUOA 4O7EA 3MB4A 5I80A 2DVRA 2R10A 4TQNA 4LZSA 4IR6A 5D3NA 4UYDA 5FDZA 4CUUA 4ALGA 5TB6A 3G0JA 5DYCA 5EA1A 4XYAA 4UIZA 5FG5A 4LZ2A 4Z6HA 3NXBA 3SVGA 3UVDA 2DVSA 4UYGA 3UV5A 5A82A 5ENFA 5COIA 2YQDA 4YBTA 5CRMA 5F1HA 4CURA 4A9KA 4CFLA 5C8GA 2D9EA 4QR3A 3LJWA 2RFJA 4A9JA 5A5RA 4ALHA 4YY6A 3ZYUA 4IOOA 5LJ2A 4NR9A 4QR5A 4UYEA 4CFKA 5I40A 4XY9A 5HQ5A 2F6JA 4TZ8A 3U5OA 4WHUA 4PCIA 5KTUA 4UIVA 4BW3A 5ACYA 5FE9A 2DVVA 5DKDA 4O7AA 5D3LA 5E74A 3QZTA 5DLXA 5IG6A 2RO1A 4OGJA 5C7NA 5HM0A 4MR5A 3DWYA 5HJCA 5CQ7A 4UITA 4Q0NA 5LVRA 3TLPA 5D3SA 4TU6A 4MEOA 5E9KA 4CUPA 5JWMA 4CUTA 4YAXA 1X0JA 4QYLA 3P1CA 4QEVA 5D24A 5HRVA 4UIYA 5EP7A 5BT4A 4IR5A 2RS9B 4QSQA 5HRWA 4O72A 5DYAA 4NXJA 4N4IA 1ZS5A 5CY9A 4YBSA 4NYWA 4LZRA 5CQ5A 5F60A 4YYMA 2KTBB 3O34A 4YADA 4IORA 5F63A 3Q2EA 5H1UA 5FE5A 5EWCA 3JVLA 4HXOA 4NQNA 5G4RA 5E9LA 5A5QA 4QR4A 5FE1A 3U5KA 5D0CA 5EV9A 1EQFA 2RNWA 3UVWA 3U5PA 4A9NA 5I86A 5EWHA 2WP2A 2R0SA 5CUGA 4IOQA 3Q2FA 5KU3A 5AMEA 5IBNA 4QSXA 4N4HA 4CLBA 5A5OA 4OUFA 5CUEA 4NYXA 5AMFA 5C85A 5A5NA 2RNXA 4QSUA 5FFWA 5L96A 4A9FA 3K2JA 3LXJA 5FE7A 4HXSA 5D3PA 3AADA 5LKXA 2GRCA 2YEKA 2I8NA 5E9YA 5CTLA 5EPBA 3HMEA 2DWWA 4N4GA 3UVYA 4A9HA 4PY6A 5D3JA 3U5NA 4NYVA 5DYUA 4YYKA 2L85A 4HXRA 5DW2A 5D3HA 4QEWA 5EISA 4LR6A 4KV4A 3UVXA 2DATA 5I1QA 5FB0A 3UW9A 5CQAA 3QZSA 5E3DA 5ENHA 2YEMA 2RI7A 4YH3A 5FG4A 4QSWA 5F36A 4ZW1A 4OGIA 5CGPA 5CRZA 2FSAA 2DVQA 5G4SA 3G0LA 4A9MA 5FG6A 5IGNA 5EICA 4YABA 5D7XA 5DFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM3 A;  3DAI A;  4QC3 A;  5FE0 A;  4QC1 A;  5E9I A;  5LUU A;  4QSS A;  4YBM A;  5F2P A;  2YEL A;  3GG3 A;  2YYN A;  4TS8 A;  2DKW A;  5DYX A;  5IGL A;  4TZ2 A;  5ENE A;  3S91 A;  5LVQ A;  3U5M A;  5LKZ A;  4FLP A;  5F62 A;  4MEP A;  4NUE A;  5H85 A;  4Q0O A;  5II2 A;  4J1P A;  4YK0 A;  5HQ6 A;  5EPR A;  4XUB A;  3S92 A;  4CUQ A;  4N3W A;  5CQ4 A;  4KCX A;  5F3A A;  4UYF B;  5DW1 A;  5BT5 A;  5L8T A;  2WP1 A;  2R0Y A;  3SVF A;  5FH6 A;  4NR8 A;  4QY4 A;  4A9E A;  5CZG A;  4TT4 A;  5ENI A;  4LRG A;  5FH7 A;  4HBY A;  4MR4 A;  2E7N A;  2I7K A;  3D7C A;  5FE4 A;  5CS8 A;  5DY7 A;  5I88 A;  5FFV A;  4Z1S A;  1WUM A;  2RNY A;  4NRC A;  4TT2 A;  5K29 A;  4QUU A;  3O33 A;  4O77 A;  3SVH A;  5F61 A;  4WHW A;  4NQM A;  5ENJ A;  2YDW A;  3P1F A;  3O37 A;  5F5Z A;  5I7Y A;  3HMF A;  2E3K A;  4O7B A;  4YYN A;  2N9G A;  2D82 A;  4NR5 A;  5CUD A;  5LJ1 A;  5CQT A;  4O7F A;  5FBX A;  5F1L A;  4QST A;  5CQ6 A;  5HFQ A;  5E73 A;  5DX4 A;  3P5O A;  4MR6 A;  5DLZ A;  4E96 A;  3U5L A;  5CFW A;  4BJX A;  4YYI A;  4Z93 A;  2LSP B;  4J0S A;  3MB3 A;  4NS5 A;  4LYS A;  5AD2 A;  4BW1 A;  4LC2 A;  4O74 A;  4TU4 A;  4A9O A;  4IR4 A;  4UYH A;  5CQ3 A;  4MR3 A;  4YAT A;  5C87 A;  4YYD A;  5ETD A;  4DON A;  5E3G A;  3AQA A;  5I89 A;  4LYW A;  4UIU A;  4C66 A;  5AD3 A;  4QEU A;  5ENG A;  4HBX A;  5L97 A;  5A5S A;  3LQJ A;  5H1V A;  2R0V A;  3O35 A;  5HLS A;  3MUK A;  4KV1 A;  4QNS A;  1F68 A;  2MJV B;  5D26 A;  4HBW A;  4BW4 A;  2G4A A;  4WIV A;  5DBM A;  4F3I A;  5KO4 A;  4PTB A;  3JVJ A;  4IR3 A;  5HEN A;  5C89 A;  4O7C A;  5E9V A;  1JM4 B;  3O36 A;  5II1 A;  5CUA A;  4YYJ A;  5HEM A;  5JI8 A;  5I29 A;  5KTW A;  5EWD A;  5I7X A;  5EQ1 A;  5EK9 A;  3IU5 A;  5A7C A;  5FFY A;  4YH4 A;  4XY8 A;  4RVR A;  4Y03 A;  4TT6 A;  2F6N A;  4O70 A;  5EU1 A;  5D25 A;  4QZS A;  4N4F A;  1N72 A;  4X2I A;  4HXP A;  4O71 A;  5E9M A;  5ENC A;  5L99 A;  1JSP B;  5EVA A;  5DFD A;  4J3I A;  4O76 A;  4O78 A;  2NXB A;  3JVK A;  3P1D A;  5A85 A;  2OSS A;  3UV4 A;  3HMH A;  5FE8 A;  5KTX A;  5TCM A;  4HXK A;  5J0D A;  4Z6I A;  3FKM X;  5EWW A;  4C67 A;  5LKT A;  3UV2 A;  5L8U A;  1WUG A;  4J0R A;  4YC9 A;  1E6I A;  5FH8 A;  5DKC A;  4UIX A;  4TYL A;  4HXM A;  4HBV A;  4PS5 A;  4NR7 A;  4QUT A;  4NUC A;  4GPJ A;  5IGK A;  4HXN A;  5FE3 A;  4QSP A;  4YY4 A;  5EGU A;  4QB3 A;  5F25 A;  5IID A;  3IU6 A;  5LKU A;  2E7O A;  5EWV A;  2YW5 A;  5ENB A;  5HFR A;  3RCW A;  5EPS A;  2L5E A;  2H60 A;  4PCE A;  3MQM A;  2L84 A;  5D3T A;  5A5P A;  5IGM A;  5C4Q A;  5HRX A;  5I83 A;  4CUS A;  5BT3 A;  5A81 A;  3P1E A;  4NR6 A;  5E7D A;  5FE6 A;  4YYH A;  5A83 A;  4A9L A;  4YYG A;  4NR4 A;  5KHM A;  4O75 A;  5ETB A;  5HEL A;  4QBM A;  5CUC A;  4LYI A;  5CUB A;  3I3J A;  4MEN A;  5DKH A;  5CQ8 A;  4NRB A;  4AKN A;  3QZV A;  4QYD A;  4UYF A;  5EI4 A;  3LQH A;  4BW2 A;  4QSR A;  5L98 A;  3LQI A;  3MUL A;  5LJ0 A;  5CU8 A;  5H1T A;  4QSV A;  4PKL A;  4LDF A;  4UIW A;  4Z1Q A;  4HXL A;  4NRA A;  4BHW A;  5CPE A;  4A9I A;  5FB1 A;  4ZQL A;  4XUA A;  3JVM A;  5CP5 A;  3U5J A;  4ZC9 A;  5D3R A;  4TTE A;  4CL9 A;  5DFC A;  5E0R A;  5HQ7 A;  3ONI A;  4MEQ A;  4NUD A;  3MXF A;  5HCL A;  5FE2 A;  2OO1 A;  2OUO A;  4O7E A;  3MB4 A;  5I80 A;  2DVR A;  2R10 A;  4TQN A;  4LZS A;  4IR6 A;  5D3N A;  4UYD A;  5FDZ A;  4CUU A;  4ALG A;  5TB6 A;  3G0J A;  5DYC A;  5EA1 A;  4XYA A;  4UIZ A;  5FG5 A;  4LZ2 A;  4Z6H A;  3NXB A;  3SVG A;  3UVD A;  2DVS A;  4UYG A;  3UV5 A;  5A82 A;  5ENF A;  5COI A;  2YQD A;  4YBT A;  5CRM A;  5F1H A;  4CUR A;  4A9K A;  4CFL A;  5C8G A;  2D9E A;  4QR3 A;  3LJW A;  2RFJ A;  4A9J A;  5A5R A;  4ALH A;  4YY6 A;  3ZYU A;  4IOO A;  5LJ2 A;  4NR9 A;  4QR5 A;  4UYE A;  4CFK A;  5I40 A;  4XY9 A;  5HQ5 A;  2F6J A;  4TZ8 A;  3U5O A;  4WHU A;  4PCI A;  5KTU A;  4UIV A;  4BW3 A;  5ACY A;  5FE9 A;  2DVV A;  5DKD A;  4O7A A;  5D3L A;  5E74 A;  3QZT A;  5DLX A;  5IG6 A;  2RO1 A;  4OGJ A;  5C7N A;  5HM0 A;  4MR5 A;  3DWY A;  5HJC A;  5CQ7 A;  4UIT A;  4Q0N A;  5LVR A;  3TLP A;  5D3S A;  4TU6 A;  4MEO A;  5E9K A;  4CUP A;  5JWM A;  4CUT A;  4YAX A;  1X0J A;  4QYL A;  3P1C A;  4QEV A;  5D24 A;  5HRV A;  4UIY A;  5EP7 A;  5BT4 A;  4IR5 A;  2RS9 B;  4QSQ A;  5HRW A;  4O72 A;  5DYA A;  4NXJ A;  4N4I A;  1ZS5 A;  5CY9 A;  4YBS A;  4NYW A;  4LZR A;  5CQ5 A;  5F60 A;  4YYM A;  2KTB B;  3O34 A;  4YAD A;  4IOR A;  5F63 A;  3Q2E A;  5H1U A;  5FE5 A;  5EWC A;  3JVL A;  4HXO A;  4NQN A;  5G4R A;  5E9L A;  5A5Q A;  4QR4 A;  5FE1 A;  3U5K A;  5D0C A;  5EV9 A;  1EQF A;  2RNW A;  3UVW A;  3U5P A;  4A9N A;  5I86 A;  5EWH A;  2WP2 A;  2R0S A;  5CUG A;  4IOQ A;  3Q2F A;  5KU3 A;  5AME A;  5IBN A;  4QSX A;  4N4H A;  4CLB A;  5A5O A;  4OUF A;  5CUE A;  4NYX A;  5AMF A;  5C85 A;  5A5N A;  2RNX A;  4QSU A;  5FFW A;  5L96 A;  4A9F A;  3K2J A;  3LXJ A;  5FE7 A;  4HXS A;  5D3P A;  3AAD A;  5LKX A;  2GRC A;  2YEK A;  2I8N A;  5E9Y A;  5CTL A;  5EPB A;  3HME A;  2DWW A;  4N4G A;  3UVY A;  4A9H A;  4PY6 A;  5D3J A;  3U5N A;  4NYV A;  5DYU A;  4YYK A;  2L85 A;  4HXR A;  5DW2 A;  5D3H A;  4QEW A;  5EIS A;  4LR6 A;  4KV4 A;  3UVX A;  2DAT A;  5I1Q A;  5FB0 A;  3UW9 A;  5CQA A;  3QZS A;  5E3D A;  5ENH A;  2YEM A;  2RI7 A;  4YH3 A;  5FG4 A;  4QSW A;  5F36 A;  4ZW1 A;  4OGI A;  5CGP A;  5CRZ A;  2FSA A;  2DVQ A;  5G4S A;  3G0L A;  4A9M A;  5FG6 A;  5IGN A;  5EIC A;  4YAB A;  5D7X A;  5DFB A; 
#chains in the Genus database with same CATH topology
 5EM3 A;  3DAI A;  4QC3 A;  5FE0 A;  4QC1 A;  5E9I A;  5LUU A;  4QSS A;  4YBM A;  5F2P A;  2YEL A;  3GG3 A;  2YYN A;  4TS8 A;  2DKW A;  5DYX A;  5IGL A;  4TZ2 A;  5ENE A;  3S91 A;  5LVQ A;  3U5M A;  5LKZ A;  4FLP A;  5F62 A;  4MEP A;  4NUE A;  5H85 A;  4Q0O A;  5II2 A;  4J1P A;  4YK0 A;  5HQ6 A;  5EPR A;  4XUB A;  3S92 A;  4CUQ A;  4N3W A;  5CQ4 A;  4KCX A;  5F3A A;  4UYF B;  5DW1 A;  5BT5 A;  5L8T A;  2WP1 A;  2R0Y A;  3SVF A;  5FH6 A;  4NR8 A;  4QY4 A;  4A9E A;  5CZG A;  4TT4 A;  5ENI A;  4LRG A;  5FH7 A;  4HBY A;  4MR4 A;  2E7N A;  2I7K A;  3D7C A;  5FE4 A;  5CS8 A;  5DY7 A;  5I88 A;  5FFV A;  4Z1S A;  1WUM A;  2RNY A;  4NRC A;  4TT2 A;  5K29 A;  4QUU A;  3O33 A;  4O77 A;  3SVH A;  5F61 A;  4WHW A;  4NQM A;  5ENJ A;  2YDW A;  3P1F A;  3O37 A;  5F5Z A;  5I7Y A;  3HMF A;  2E3K A;  4O7B A;  4YYN A;  2N9G A;  2D82 A;  4NR5 A;  5CUD A;  5LJ1 A;  5CQT A;  4O7F A;  5FBX A;  5F1L A;  4QST A;  5CQ6 A;  5HFQ A;  5E73 A;  5DX4 A;  3P5O A;  4MR6 A;  5DLZ A;  4E96 A;  3U5L A;  5CFW A;  4BJX A;  4YYI A;  4Z93 A;  2LSP B;  4J0S A;  3MB3 A;  4NS5 A;  4LYS A;  5AD2 A;  4BW1 A;  4LC2 A;  4O74 A;  4TU4 A;  4A9O A;  4IR4 A;  4UYH A;  5CQ3 A;  4MR3 A;  4YAT A;  5C87 A;  4YYD A;  5ETD A;  3D1D A;  4DON A;  5E3G A;  3AQA A;  5I89 A;  4LYW A;  4UIU A;  4C66 A;  5AD3 A;  4QEU A;  5ENG A;  4HBX A;  5L97 A;  5A5S A;  3LQJ A;  3D1B A;  5H1V A;  2R0V A;  3O35 A;  5HLS A;  3MUK A;  4KV1 A;  4QNS A;  1F68 A;  2MJV B;  5D26 A;  4HBW A;  4BW4 A;  2G4A A;  4WIV A;  5DBM A;  4F3I A;  5KO4 A;  4PTB A;  3JVJ A;  4IR3 A;  5HEN A;  5C89 A;  4O7C A;  5E9V A;  1JM4 B;  3O36 A;  5II1 A;  5CUA A;  4YYJ A;  5HEM A;  5JI8 A;  5I29 A;  5KTW A;  5EWD A;  5I7X A;  5EQ1 A;  5EK9 A;  3IU5 A;  5A7C A;  5FFY A;  4YH4 A;  4XY8 A;  4RVR A;  4Y03 A;  4TT6 A;  2F6N A;  4O70 A;  5EU1 A;  1PUO A;  4QZS A;  5D25 A;  4N4F A;  1N72 A;  4X2I A;  4HXP A;  4O71 A;  5E9M A;  5ENC A;  5L99 A;  1JSP B;  5EVA A;  5DFD A;  4J3I A;  4O76 A;  4O78 A;  2NXB A;  3JVK A;  3P1D A;  5A85 A;  2OSS A;  3UV4 A;  3HMH A;  5FE8 A;  5KTX A;  5TCM A;  4HXK A;  5J0D A;  4Z6I A;  3FKM X;  5EWW A;  4C67 A;  5LKT A;  3UV2 A;  5L8U A;  1WUG A;  3VKG A;  4J0R A;  4YC9 A;  1E6I A;  5FH8 A;  4AI6 A;  5DKC A;  4UIX A;  4TYL A;  4HXM A;  4HBV A;  4PS5 A;  4NR7 A;  4QUT A;  4NUC A;  4GPJ A;  5IGK A;  4HXN A;  5FE3 A;  4QSP A;  4YY4 A;  5EGU A;  4QB3 A;  3VKH A;  5F25 A;  5IID A;  3IU6 A;  5LKU A;  2E7O A;  5EWV A;  2YW5 A;  5ENB A;  5HFR A;  3RCW A;  5EPS A;  2L5E A;  2H60 A;  4PCE A;  3MQM A;  2L84 A;  5D3T A;  5A5P A;  5IGM A;  5C4Q A;  5HRX A;  5I83 A;  4CUS A;  5BT3 A;  5A81 A;  3P1E A;  4NR6 A;  5E7D A;  5FE6 A;  4YYH A;  5A83 A;  4A9L A;  4YYG A;  4NR4 A;  5KHM A;  4O75 A;  5ETB A;  5HEL A;  4QBM A;  5CUC A;  4LYI A;  5CUB A;  3I3J A;  4MEN A;  5DKH A;  5CQ8 A;  4NRB A;  4AKN A;  3QZV A;  4QYD A;  4UYF A;  5EI4 A;  3LQH A;  4BW2 A;  3ERR A;  4QSR A;  5L98 A;  3LQI A;  3MUL A;  5LJ0 A;  5CU8 A;  5H1T A;  4QSV A;  4PKL A;  4LDF A;  4UIW A;  4Z1Q A;  4HXL A;  4NRA A;  4BHW A;  5CPE A;  4A9I A;  5FB1 A;  4ZQL A;  4XUA A;  3JVM A;  5CP5 A;  3U5J A;  4ZC9 A;  5D3R A;  4TTE A;  4CL9 A;  5DFC A;  5E0R A;  5HQ7 A;  3ONI A;  4MEQ A;  4NUD A;  3MXF A;  5HCL A;  5FE2 A;  2OO1 A;  2OUO A;  4O7E A;  3MB4 A;  5I80 A;  2DVR A;  2R10 A;  4TQN A;  4LZS A;  4IR6 A;  5D3N A;  4UYD A;  5FDZ A;  4CUU A;  4ALG A;  5TB6 A;  3G0J A;  5DYC A;  5EA1 A;  4XYA A;  4UIZ A;  5FG5 A;  4LZ2 A;  4Z6H A;  3NXB A;  3SVG A;  3UVD A;  2DVS A;  4UYG A;  3UV5 A;  5A82 A;  5ENF A;  5COI A;  2YQD A;  4YBT A;  5CRM A;  5F1H A;  4CUR A;  4A9K A;  4CFL A;  5C8G A;  2D9E A;  4QR3 A;  3LJW A;  2RFJ A;  4A9J A;  5A5R A;  4ALH A;  4YY6 A;  3ZYU A;  4IOO A;  5LJ2 A;  4NR9 A;  4QR5 A;  4UYE A;  4CFK A;  5I40 A;  4XY9 A;  5HQ5 A;  2F6J A;  4TZ8 A;  3U5O A;  4WHU A;  4PCI A;  5KTU A;  4UIV A;  4BW3 A;  5ACY A;  5FE9 A;  2DVV A;  5DKD A;  4O7A A;  5D3L A;  5E74 A;  3QZT A;  5DLX A;  4AKG A;  5IG6 A;  2RO1 A;  4OGJ A;  5C7N A;  5HM0 A;  4MR5 A;  3DWY A;  5HJC A;  5CQ7 A;  4UIT A;  4Q0N A;  5LVR A;  3TLP A;  5D3S A;  4TU6 A;  4MEO A;  5E9K A;  4CUP A;  5JWM A;  4CUT A;  4YAX A;  1X0J A;  4QYL A;  3P1C A;  4QEV A;  5D24 A;  5HRV A;  4UIY A;  5EP7 A;  5BT4 A;  4IR5 A;  2RS9 B;  4QSQ A;  5HRW A;  4O72 A;  5DYA A;  4NXJ A;  4N4I A;  1ZS5 A;  5CY9 A;  4YBS A;  4NYW A;  4LZR A;  5CQ5 A;  5F60 A;  4YYM A;  2KTB B;  3O34 A;  4YAD A;  4IOR A;  4AKH A;  5F63 A;  3Q2E A;  5H1U A;  5FE5 A;  5EWC A;  3JVL A;  4HXO A;  4NQN A;  5G4R A;  5E9L A;  5A5Q A;  2EJN A;  4QR4 A;  5FE1 A;  3U5K A;  5D0C A;  5EV9 A;  1EQF A;  2RNW A;  3UVW A;  3U5P A;  4A9N A;  5I86 A;  5EWH A;  2WP2 A;  2R0S A;  5CUG A;  4IOQ A;  3Q2F A;  5KU3 A;  5AME A;  5IBN A;  4QSX A;  4N4H A;  4CLB A;  5A5O A;  4OUF A;  5CUE A;  4NYX A;  5AMF A;  5C85 A;  5A5N A;  2RNX A;  4QSU A;  5FFW A;  5L96 A;  4A9F A;  3K2J A;  3LXJ A;  5FE7 A;  4HXS A;  5D3P A;  3AAD A;  5LKX A;  2GRC A;  2YEK A;  2I8N A;  5E9Y A;  5CTL A;  5EPB A;  3HME A;  2DWW A;  4N4G A;  3UVY A;  4A9H A;  4PY6 A;  5D3J A;  3U5N A;  4NYV A;  5DYU A;  4YYK A;  4AKI A;  1ZKR A;  2L85 A;  4HXR A;  5DW2 A;  5D3H A;  4QEW A;  5EIS A;  4LR6 A;  4KV4 A;  3UVX A;  2DAT A;  5I1Q A;  5FB0 A;  3UW9 A;  5CQA A;  3QZS A;  5E3D A;  5ENH A;  2YEM A;  2RI7 A;  4YH3 A;  5FG4 A;  4QSW A;  5F36 A;  4ZW1 A;  4OGI A;  5CGP A;  5CRZ A;  2FSA A;  2DVQ A;  5G4S A;  3G0L A;  4A9M A;  5FG6 A;  5IGN A;  5EIC A;  4YAB A;  5D7X A;  5DFB A; 
#chains in the Genus database with same CATH homology
 5EM3 A;  3DAI A;  4QC3 A;  5FE0 A;  4QC1 A;  5E9I A;  5LUU A;  4QSS A;  4YBM A;  5F2P A;  2YEL A;  3GG3 A;  2YYN A;  4TS8 A;  2DKW A;  5DYX A;  5IGL A;  4TZ2 A;  5ENE A;  3S91 A;  5LVQ A;  3U5M A;  5LKZ A;  4FLP A;  5F62 A;  4MEP A;  4NUE A;  5H85 A;  4Q0O A;  5II2 A;  4J1P A;  4YK0 A;  5HQ6 A;  5EPR A;  4XUB A;  3S92 A;  4CUQ A;  4N3W A;  5CQ4 A;  4KCX A;  5F3A A;  4UYF B;  5DW1 A;  5BT5 A;  5L8T A;  2WP1 A;  2R0Y A;  3SVF A;  5FH6 A;  4NR8 A;  4QY4 A;  4A9E A;  5CZG A;  4TT4 A;  5ENI A;  4LRG A;  5FH7 A;  4HBY A;  4MR4 A;  2E7N A;  2I7K A;  3D7C A;  5FE4 A;  5CS8 A;  5DY7 A;  5I88 A;  5FFV A;  4Z1S A;  1WUM A;  2RNY A;  4NRC A;  4TT2 A;  5K29 A;  4QUU A;  3O33 A;  4O77 A;  3SVH A;  5F61 A;  4WHW A;  4NQM A;  5ENJ A;  2YDW A;  3P1F A;  3O37 A;  5F5Z A;  5I7Y A;  3HMF A;  2E3K A;  4O7B A;  4YYN A;  2N9G A;  2D82 A;  4NR5 A;  5CUD A;  5LJ1 A;  5CQT A;  4O7F A;  5FBX A;  5F1L A;  4QST A;  5CQ6 A;  5HFQ A;  5E73 A;  5DX4 A;  3P5O A;  4MR6 A;  5DLZ A;  4E96 A;  3U5L A;  5CFW A;  4BJX A;  4YYI A;  4Z93 A;  2LSP B;  4J0S A;  3MB3 A;  4NS5 A;  4LYS A;  5AD2 A;  4BW1 A;  4LC2 A;  4O74 A;  4TU4 A;  4A9O A;  4IR4 A;  4UYH A;  5CQ3 A;  4MR3 A;  4YAT A;  5C87 A;  4YYD A;  5ETD A;  4DON A;  5E3G A;  3AQA A;  5I89 A;  4LYW A;  4UIU A;  4C66 A;  5AD3 A;  4QEU A;  5ENG A;  4HBX A;  5L97 A;  5A5S A;  3LQJ A;  5H1V A;  2R0V A;  3O35 A;  5HLS A;  3MUK A;  4KV1 A;  4QNS A;  1F68 A;  2MJV B;  5D26 A;  4HBW A;  4BW4 A;  2G4A A;  4WIV A;  5DBM A;  4F3I A;  5KO4 A;  4PTB A;  3JVJ A;  4IR3 A;  5HEN A;  5C89 A;  4O7C A;  5E9V A;  1JM4 B;  3O36 A;  5II1 A;  5CUA A;  4YYJ A;  5HEM A;  5JI8 A;  5I29 A;  5KTW A;  5EWD A;  5I7X A;  5EQ1 A;  5EK9 A;  3IU5 A;  5A7C A;  5FFY A;  4YH4 A;  4XY8 A;  4RVR A;  4Y03 A;  4TT6 A;  2F6N A;  4O70 A;  5EU1 A;  5D25 A;  4QZS A;  4N4F A;  1N72 A;  4X2I A;  4HXP A;  4O71 A;  5E9M A;  5ENC A;  5L99 A;  1JSP B;  5EVA A;  5DFD A;  4J3I A;  4O76 A;  4O78 A;  2NXB A;  3JVK A;  3P1D A;  5A85 A;  2OSS A;  3UV4 A;  3HMH A;  5FE8 A;  5KTX A;  5TCM A;  4HXK A;  5J0D A;  4Z6I A;  3FKM X;  5EWW A;  4C67 A;  5LKT A;  3UV2 A;  5L8U A;  1WUG A;  4J0R A;  4YC9 A;  1E6I A;  5FH8 A;  5DKC A;  4UIX A;  4TYL A;  4HXM A;  4HBV A;  4PS5 A;  4NR7 A;  4QUT A;  4NUC A;  4GPJ A;  5IGK A;  4HXN A;  5FE3 A;  4QSP A;  4YY4 A;  5EGU A;  4QB3 A;  5F25 A;  5IID A;  3IU6 A;  5LKU A;  2E7O A;  5EWV A;  2YW5 A;  5ENB A;  5HFR A;  3RCW A;  5EPS A;  2L5E A;  2H60 A;  4PCE A;  3MQM A;  2L84 A;  5D3T A;  5A5P A;  5IGM A;  5C4Q A;  5HRX A;  5I83 A;  4CUS A;  5BT3 A;  5A81 A;  3P1E A;  4NR6 A;  5E7D A;  5FE6 A;  4YYH A;  5A83 A;  4A9L A;  4YYG A;  4NR4 A;  5KHM A;  4O75 A;  5ETB A;  5HEL A;  4QBM A;  5CUC A;  4LYI A;  5CUB A;  3I3J A;  4MEN A;  5DKH A;  5CQ8 A;  4NRB A;  4AKN A;  3QZV A;  4QYD A;  4UYF A;  5EI4 A;  3LQH A;  4BW2 A;  4QSR A;  5L98 A;  3LQI A;  3MUL A;  5LJ0 A;  5CU8 A;  5H1T A;  4QSV A;  4PKL A;  4LDF A;  4UIW A;  4Z1Q A;  4HXL A;  4NRA A;  4BHW A;  5CPE A;  4A9I A;  5FB1 A;  4ZQL A;  4XUA A;  3JVM A;  5CP5 A;  3U5J A;  4ZC9 A;  5D3R A;  4TTE A;  4CL9 A;  5DFC A;  5E0R A;  5HQ7 A;  3ONI A;  4MEQ A;  4NUD A;  3MXF A;  5HCL A;  5FE2 A;  2OO1 A;  2OUO A;  4O7E A;  3MB4 A;  5I80 A;  2DVR A;  2R10 A;  4TQN A;  4LZS A;  4IR6 A;  5D3N A;  4UYD A;  5FDZ A;  4CUU A;  4ALG A;  5TB6 A;  3G0J A;  5DYC A;  5EA1 A;  4XYA A;  4UIZ A;  5FG5 A;  4LZ2 A;  4Z6H A;  3NXB A;  3SVG A;  3UVD A;  2DVS A;  4UYG A;  3UV5 A;  5A82 A;  5ENF A;  5COI A;  2YQD A;  4YBT A;  5CRM A;  5F1H A;  4CUR A;  4A9K A;  4CFL A;  5C8G A;  2D9E A;  4QR3 A;  3LJW A;  2RFJ A;  4A9J A;  5A5R A;  4ALH A;  4YY6 A;  3ZYU A;  4IOO A;  5LJ2 A;  4NR9 A;  4QR5 A;  4UYE A;  4CFK A;  5I40 A;  4XY9 A;  5HQ5 A;  2F6J A;  4TZ8 A;  3U5O A;  4WHU A;  4PCI A;  5KTU A;  4UIV A;  4BW3 A;  5ACY A;  5FE9 A;  2DVV A;  5DKD A;  4O7A A;  5D3L A;  5E74 A;  3QZT A;  5DLX A;  5IG6 A;  2RO1 A;  4OGJ A;  5C7N A;  5HM0 A;  4MR5 A;  3DWY A;  5HJC A;  5CQ7 A;  4UIT A;  4Q0N A;  5LVR A;  3TLP A;  5D3S A;  4TU6 A;  4MEO A;  5E9K A;  4CUP A;  5JWM A;  4CUT A;  4YAX A;  1X0J A;  4QYL A;  3P1C A;  4QEV A;  5D24 A;  5HRV A;  4UIY A;  5EP7 A;  5BT4 A;  4IR5 A;  2RS9 B;  4QSQ A;  5HRW A;  4O72 A;  5DYA A;  4NXJ A;  4N4I A;  1ZS5 A;  5CY9 A;  4YBS A;  4NYW A;  4LZR A;  5CQ5 A;  5F60 A;  4YYM A;  2KTB B;  3O34 A;  4YAD A;  4IOR A;  5F63 A;  3Q2E A;  5H1U A;  5FE5 A;  5EWC A;  3JVL A;  4HXO A;  4NQN A;  5G4R A;  5E9L A;  5A5Q A;  4QR4 A;  5FE1 A;  3U5K A;  5D0C A;  5EV9 A;  1EQF A;  2RNW A;  3UVW A;  3U5P A;  4A9N A;  5I86 A;  5EWH A;  2WP2 A;  2R0S A;  5CUG A;  4IOQ A;  3Q2F A;  5KU3 A;  5AME A;  5IBN A;  4QSX A;  4N4H A;  4CLB A;  5A5O A;  4OUF A;  5CUE A;  4NYX A;  5AMF A;  5C85 A;  5A5N A;  2RNX A;  4QSU A;  5FFW A;  5L96 A;  4A9F A;  3K2J A;  3LXJ A;  5FE7 A;  4HXS A;  5D3P A;  3AAD A;  5LKX A;  2GRC A;  2YEK A;  2I8N A;  5E9Y A;  5CTL A;  5EPB A;  3HME A;  2DWW A;  4N4G A;  3UVY A;  4A9H A;  4PY6 A;  5D3J A;  3U5N A;  4NYV A;  5DYU A;  4YYK A;  2L85 A;  4HXR A;  5DW2 A;  5D3H A;  4QEW A;  5EIS A;  4LR6 A;  4KV4 A;  3UVX A;  2DAT A;  5I1Q A;  5FB0 A;  3UW9 A;  5CQA A;  3QZS A;  5E3D A;  5ENH A;  2YEM A;  2RI7 A;  4YH3 A;  5FG4 A;  4QSW A;  5F36 A;  4ZW1 A;  4OGI A;  5CGP A;  5CRZ A;  2FSA A;  2DVQ A;  5G4S A;  3G0L A;  4A9M A;  5FG6 A;  5IGN A;  5EIC A;  4YAB A;  5D7X A;  5DFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...