3LJWA

Crystal structure of the second bromodomain of human polybromo
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
118
structure length
118
Chain Sequence
GSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHAMAKDIDLLAKNAKTYNEPGSQVFKDANSIKKIFYMKKAEIEHHEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein polybromo-1
publication title Structural insights into selective histone H3 recognition by the human Polybromo bromodomain 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 41
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3ljwA00
3HMHA 3MXFA 4NRBA 4N4FA 5F36A 5H1UA 3UVYA 5CRZA 3AADA 4O74A 4UIVA 5A82A 5E9KA 5E73A 2D82A 4NRCA 5A5OA 2WP2A 4OUFA 5CZGA 5II1A 3U5JA 4MEQA 4QSUA 2D9EA 3P1DA 5CPEA 5DKCA 5E9MA 4AKNA 3HMFA 4TTEA 5EQ1A 5FB0A 3IU6A 5D26A 3LXJA 5HRWA 5IGMA 4NS5A 5EGUA 2GRCA 5CUBA 3AQAA 5D3NA 3P1CA 4QB3A 4J0RA 4QY4A 5DBMA 5EPBA 2YELA 5I7XA 5EWHA 4QC3A 4YAXA 2I8NA 4WHWA 3QZSA 4MR5A 4HBXA 5CQ3A 2OO1A 5CUAA 5CUEA 1JSPB 5EU1A 4ALGA 4LYWA 4C67A 4ZW1A 3I3JA 5IIDA 5CUGA 3JVKA 5D3JA 1WUMA 2RO1A 4IR6A 5KTUA 4GPJA 4YYGA 4YK0A 5BT3A 5EP7A 1X0JA 5DKDA 2R0YA 4XUBA 3LJWA 2MJVB 5FE3A 4MEPA 5D7XA 4O7EA 3MB4A 2RFJA 4A9KA 5HQ7A 5DW2A 2RS9B 5FE2A 5FFVA 4PKLA 5H1VA 3D7CA 5EWDA 5I88A 1E6IA 4QC1A 5KHMA 4XY8A 5IGKA 5FE4A 4CL9A 4YH3A 4WIVA 5ETDA 4BW4A 4YBMA 4Z93A 3ZYUA 4TT6A 5F60A 4NYXA 3U5PA 3SVGA 5HCLA 4NR4A 4QR5A 2DWWA 2L84A 4WHUA 5EISA 4F3IA 4LC2A 1JM4B 5JI8A 2N9GA 3MULA 2LSPB 3ONIA 4CUPA 5H85A 5BT5A 3S91A 4NRAA 4NR5A 5HJCA 4HXRA 3U5MA 4LR6A 4LYIA 5DW1A 5A7CA 4QSSA 5LJ1A 3UVXA 2E7OA 5ENCA 5IBNA 4A9LA 3QZTA 4HXMA 5A5SA 2YEMA 4FLPA 5AMEA 2DVQA 4BHWA 5DKHA 2YEKA 4NR6A 3UW9A 4ZQLA 5D24A 4OGJA 4QYDA 4CLBA 5FE5A 5L8TA 5CP5A 5DFBA 4TT2A 5TB6A 4ZC9A 4YYDA 2YW5A 5II2A 4IORA 3JVJA 5ENIA 3P5OA 4XY9A 4YATA 4YABA 4O70A 5EPSA 4LYSA 4MEOA 5CTLA 5FB1A 5D3LA 4YC9A 4NYWA 4UIXA 4NR8A 2FSAA 5E7DA 5CQ4A 4HXPA 4O7AA 5KTWA 4QSRA 4QSXA 4QYLA 4LRGA 4YY4A 4IOOA 5ACYA 3G0LA 3K2JA 2WP1A 1N72A 4QEUA 4NYVA 4A9FA 5HM0A 4O71A 4O76A 5I80A 5EK9A 2KTBB 5IGNA 5C8GA 1F68A 5FFYA 3FKMX 4HXKA 2E7NA 5CGPA 5BT4A 5I89A 3DWYA 2RNWA 3LQIA 4A9JA 5F63A 5HENA 5FE0A 5A83A 2L5EA 5CQAA 5FH7A 3DAIA 5ENEA 5L98A 4NR9A 3O36A 5H1TA 4HXLA 5CY9A 5A85A 5C4QA 2F6NA 5D3SA 5CQ5A 5CUDA 4PCIA 5C85A 3MQMA 4NUCA 4O7FA 2YYNA 2R0SA 4NQMA 4PTBA 5ENBA 4J1PA 4O78A 4NUEA 5E9YA 5F61A 2NXBA 4J0SA 4QSPA 5JWMA 5HRXA 5LJ0A 5FFWA 4HBVA 4YYKA 3NXBA 5DLXA 4YBTA 5G4SA 5EICA 4A9IA 4LDFA 4CUSA 5LKTA 4Q0OA 5A5NA 4TS8A 4QR4A 5LKXA 5HQ5A 4QUTA 5E9LA 4Z1SA 5E9IA 4A9NA 4QSVA 4PY6A 5EWVA 4A9HA 5D25A 4TT4A 5LKZA 4IR5A 5FE9A 5KU3A 5ENFA 5LKUA 3UVDA 4TU6A 5DYUA 3MB3A 5D3RA 1WUGA 4UYGA 2YQDA 5C7NA 5HFQA 5KTXA 5CQ6A 5C89A 4QSTA 5I29A 4HBWA 5DFCA 4MR4A 4PS5A 4UIYA 5ENHA 5I1QA 3O34A 2L85A 4N3WA 5AD2A 5FH8A 4QSWA 5K29A 5A5PA 3O37A 4CUTA 4QSQA 4YY6A 3LQHA 4KV1A 2I7KA 5IG6A 5CQ7A 5E0RA 3RCWA 4HXNA 4QR3A 4Q0NA 5EWWA 1ZS5A 2H60A 4TQNA 5DFDA 4Z6HA 5G4RA 3LQJA 5CQ8A 3P1FA 4A9EA 4LZ2A 3U5LA 5L96A 4LZRA 3JVLA 4HBYA 4Y03A 3S92A 5C87A 5IGLA 5L97A 4RVRA 3O33A 2RI7A 5CUCA 5D0CA 4UYDA 5FG4A 4TYLA 5D3TA 5I7YA 5D3HA 3TLPA 4BJXA 4MENA 4CURA 5LVQA 5D3PA 5A5RA 2R0VA 3Q2FA 3UVWA 5I40A 5HFRA 5FE7A 5L99A 5LVRA 3HMEA 4YYIA 5DYAA 5A81A 5I86A 4O75A 4NUDA 4NQNA 5DLZA 5DYCA 5FE6A 5CS8A 5F1HA 2E3KA 5DYXA 5ENGA 4XUAA 4CUUA 4YADA 5COIA 4QEWA 5EA1A 5FBXA 4HXSA 5DX4A 4BW1A 4Z6IA 4X2IA 4N4GA 4QBMA 4YH4A 5LUUA 5CU8A 4E96A 5ENJA 3JVMA 4UYFB 5HQ6A 4UIZA 4O7BA 5HEMA 2DVSA 4N4HA 4O7CA 4MR3A 2YDWA 2RNYA 4UYFA 5CFWA 4ALHA 2OSSA 3QZVA 4YYNA 3SVHA 5F5ZA 4NR7A 2DATA 5J0DA 4J3IA 4CFKA 3UV5A 5HRVA 3Q2EA 4QZSA 5FG6A 2F6JA 4A9MA 3UV4A 5FH6A 4KV4A 4C66A 4CFLA 4KCXA 5CRMA 5L8UA 5E3DA 4YYMA 5AMFA 4BW2A 5CQTA 2DKWA 5E3GA 4BW3A 5F25A 3MUKA 5EVAA 5ETBA 5F1LA 5FDZA 4CUQA 4YYHA 5AD3A 3IU5A 4TZ2A 5A5QA 4A9OA 3U5OA 4QUUA 3G0JA 5F3AA 4N4IA 4NXJA 3P1EA 3SVFA 3UV2A 5EPRA 4UIWA 5FE1A 5KO4A 4UITA 5E9VA 3GG3A 4QEVA 4UYHA 4IR4A 4QNSA 4YYJA 2G4AA 4UYEA 4PCEA 4UIUA 5HELA 5EM3A 4YBSA 1EQFA 4LZSA 4TU4A 4O77A 4TZ8A 3O35A 4IOQA 5EV9A 5EWCA 5FG5A 5LJ2A 5F62A 5F2PA 3U5NA 2R10A 4Z1QA 5HLSA 4XYAA 5E74A 5FE8A 4HXOA 5EI4A 2DVVA 4OGIA 4IR3A 5TCMA 4DONA 5I83A 2OUOA 2DVRA 3U5KA 4MR6A 4O72A 5DY7A 2RNXA
chains in the Genus database with same CATH superfamily
3HMHA 3MXFA 4NRBA 4N4FA 5F36A 5H1UA 3UVYA 5CRZA 3AADA 4O74A 4UIVA 5A82A 5E9KA 5E73A 2D82A 4NRCA 5A5OA 2WP2A 4OUFA 5CZGA 5II1A 3U5JA 4MEQA 4QSUA 2D9EA 3P1DA 5CPEA 5DKCA 5E9MA 4AKNA 3HMFA 4TTEA 5EQ1A 5FB0A 3IU6A 5D26A 3LXJA 5HRWA 5IGMA 4NS5A 5EGUA 2GRCA 5CUBA 3AQAA 5D3NA 3P1CA 4QB3A 4J0RA 4QY4A 5DBMA 5EPBA 2YELA 5I7XA 5EWHA 4QC3A 4YAXA 2I8NA 4WHWA 3QZSA 4MR5A 4HBXA 5CQ3A 2OO1A 5CUAA 5CUEA 1JSPB 5EU1A 4ALGA 4LYWA 4C67A 4ZW1A 3I3JA 5IIDA 5CUGA 3JVKA 5D3JA 1WUMA 2RO1A 4IR6A 5KTUA 4GPJA 4YYGA 4YK0A 5BT3A 5EP7A 1X0JA 5DKDA 2R0YA 4XUBA 3LJWA 2MJVB 5FE3A 4MEPA 5D7XA 4O7EA 3MB4A 2RFJA 4A9KA 5HQ7A 5DW2A 2RS9B 5FE2A 5FFVA 4PKLA 5H1VA 3D7CA 5EWDA 5I88A 1E6IA 4QC1A 5KHMA 4XY8A 5IGKA 5FE4A 4CL9A 4YH3A 4WIVA 5ETDA 4BW4A 4YBMA 4Z93A 3ZYUA 4TT6A 5F60A 4NYXA 3U5PA 3SVGA 5HCLA 4NR4A 1ZKRA 4QR5A 2DWWA 2L84A 4WHUA 5EISA 4F3IA 4LC2A 1JM4B 5JI8A 2N9GA 3MULA 2LSPB 3ONIA 4CUPA 5H85A 5BT5A 3S91A 4NRAA 4NR5A 5HJCA 4HXRA 3U5MA 4LR6A 4LYIA 5DW1A 5A7CA 4QSSA 5LJ1A 3UVXA 2E7OA 5ENCA 5IBNA 4A9LA 3QZTA 4HXMA 5A5SA 2YEMA 4FLPA 5AMEA 2DVQA 4BHWA 5DKHA 4AKIA 2YEKA 4NR6A 3UW9A 3ERRA 4ZQLA 5D24A 4OGJA 4QYDA 4CLBA 5FE5A 5L8TA 5CP5A 5DFBA 4TT2A 5TB6A 4ZC9A 4YYDA 2YW5A 5II2A 4IORA 3JVJA 5ENIA 3P5OA 4XY9A 4YATA 4YABA 4O70A 5EPSA 4LYSA 4MEOA 5CTLA 5FB1A 5D3LA 4YC9A 4NYWA 4UIXA 4NR8A 2FSAA 5E7DA 5CQ4A 4HXPA 4O7AA 5KTWA 4QSRA 4QSXA 4QYLA 4LRGA 4YY4A 4IOOA 5ACYA 3G0LA 3K2JA 2WP1A 1N72A 4QEUA 4NYVA 4A9FA 5HM0A 4O71A 4O76A 5I80A 5EK9A 2KTBB 5IGNA 5C8GA 1F68A 5FFYA 3FKMX 4HXKA 2E7NA 5CGPA 5BT4A 5I89A 4AI6A 3DWYA 2RNWA 3LQIA 4A9JA 5F63A 5HENA 5FE0A 5A83A 2L5EA 5CQAA 5FH7A 3DAIA 5ENEA 5L98A 4NR9A 3O36A 5H1TA 4HXLA 5CY9A 5A85A 3D1DA 2F6NA 5C4QA 5D3SA 5CQ5A 5CUDA 4PCIA 5C85A 3MQMA 4NUCA 4O7FA 2YYNA 2R0SA 4NQMA 4PTBA 5ENBA 4J1PA 4O78A 4NUEA 5E9YA 5F61A 2NXBA 4J0SA 4QSPA 5JWMA 5HRXA 5LJ0A 5FFWA 4HBVA 4YYKA 3NXBA 5DLXA 4YBTA 5G4SA 5EICA 4A9IA 4LDFA 4CUSA 5LKTA 4Q0OA 5A5NA 4TS8A 4QR4A 5LKXA 5HQ5A 4QUTA 5E9LA 4Z1SA 5E9IA 4A9NA 4QSVA 4PY6A 5EWVA 4A9HA 5D25A 4TT4A 5LKZA 4IR5A 5FE9A 5KU3A 5ENFA 5LKUA 3UVDA 4TU6A 5DYUA 3MB3A 2EJNA 5D3RA 1WUGA 4UYGA 2YQDA 5C7NA 5HFQA 5KTXA 5CQ6A 5C89A 4QSTA 5I29A 4HBWA 5DFCA 4MR4A 4PS5A 4UIYA 5ENHA 5I1QA 3O34A 2L85A 4N3WA 5AD2A 5FH8A 4QSWA 5K29A 5A5PA 3O37A 4CUTA 4QSQA 4YY6A 3LQHA 4AKGA 4KV1A 2I7KA 5IG6A 5CQ7A 5E0RA 3RCWA 4HXNA 4QR3A 4Q0NA 5EWWA 1ZS5A 2H60A 4TQNA 5DFDA 4Z6HA 5G4RA 3LQJA 5CQ8A 3P1FA 4A9EA 3VKHA 4LZ2A 3U5LA 5L96A 4LZRA 3JVLA 4HBYA 4Y03A 3S92A 5C87A 5IGLA 5L97A 4RVRA 3O33A 2RI7A 5CUCA 5D0CA 4UYDA 5FG4A 4TYLA 5D3TA 5I7YA 5D3HA 3TLPA 4BJXA 4MENA 4CURA 5LVQA 5D3PA 5A5RA 2R0VA 3Q2FA 3UVWA 5I40A 5HFRA 5FE7A 5L99A 5LVRA 3HMEA 4YYIA 5DYAA 5A81A 5I86A 4AKHA 4O75A 4NUDA 4NQNA 5DLZA 5DYCA 5FE6A 5CS8A 5F1HA 2E3KA 5DYXA 5ENGA 4XUAA 4CUUA 4YADA 5COIA 4QEWA 5EA1A 5FBXA 4HXSA 5DX4A 4BW1A 4Z6IA 4X2IA 4N4GA 4QBMA 4YH4A 5LUUA 5CU8A 4E96A 5ENJA 3JVMA 4UYFB 5HQ6A 4UIZA 4O7BA 5HEMA 2DVSA 4N4HA 4O7CA 4MR3A 2YDWA 2RNYA 4UYFA 5CFWA 4ALHA 2OSSA 3QZVA 4YYNA 3SVHA 5F5ZA 4NR7A 3VKGA 2DATA 5J0DA 4J3IA 4CFKA 3UV5A 5HRVA 3Q2EA 4QZSA 5FG6A 2F6JA 4A9MA 3UV4A 5FH6A 4KV4A 4C66A 4CFLA 4KCXA 5CRMA 5L8UA 5E3DA 4YYMA 5AMFA 4BW2A 5CQTA 2DKWA 5E3GA 4BW3A 5F25A 3MUKA 5EVAA 5ETBA 5F1LA 5FDZA 4CUQA 4YYHA 5AD3A 3IU5A 4TZ2A 5A5QA 4A9OA 3U5OA 4QUUA 3G0JA 5F3AA 4N4IA 4NXJA 3P1EA 3SVFA 3UV2A 5EPRA 4UIWA 5FE1A 5KO4A 4UITA 5E9VA 3GG3A 4QEVA 4UYHA 4IR4A 4QNSA 1PUOA 4YYJA 2G4AA 4UYEA 4PCEA 4UIUA 5HELA 5EM3A 4YBSA 1EQFA 4LZSA 4TU4A 4O77A 4TZ8A 3O35A 4IOQA 5EV9A 5EWCA 5FG5A 5LJ2A 5F62A 5F2PA 3U5NA 2R10A 4Z1QA 5HLSA 4XYAA 5E74A 5FE8A 4HXOA 5EI4A 2DVVA 4OGIA 4IR3A 5TCMA 4DONA 5I83A 2OUOA 2DVRA 3U5KA 3D1BA 4MR6A 4O72A 5DY7A 2RNXA
chains in the Genus database with same CATH topology
3HMHA 3MXFA 4NRBA 4N4FA 5F36A 5H1UA 3UVYA 5CRZA 3AADA 4O74A 4UIVA 5A82A 5E9KA 5E73A 2D82A 4NRCA 5A5OA 2WP2A 4OUFA 5CZGA 5II1A 3U5JA 4MEQA 4QSUA 2D9EA 3P1DA 5CPEA 5DKCA 5E9MA 4AKNA 3HMFA 4TTEA 5EQ1A 5FB0A 3IU6A 5D26A 3LXJA 5HRWA 5IGMA 4NS5A 5EGUA 2GRCA 5CUBA 3AQAA 5D3NA 3P1CA 4QB3A 4J0RA 4QY4A 5DBMA 5EPBA 2YELA 5I7XA 5EWHA 4QC3A 4YAXA 2I8NA 4WHWA 3QZSA 4MR5A 4HBXA 5CQ3A 2OO1A 5CUAA 5CUEA 1JSPB 5EU1A 4ALGA 4LYWA 4C67A 4ZW1A 3I3JA 5IIDA 5CUGA 3JVKA 5D3JA 1WUMA 2RO1A 4IR6A 5KTUA 4GPJA 4YYGA 4YK0A 5BT3A 5EP7A 1X0JA 5DKDA 2R0YA 4XUBA 3LJWA 2MJVB 5FE3A 4MEPA 5D7XA 4O7EA 3MB4A 2RFJA 4A9KA 5HQ7A 5DW2A 2RS9B 5FE2A 5FFVA 4PKLA 5H1VA 3D7CA 5EWDA 5I88A 1E6IA 4QC1A 5KHMA 4XY8A 5IGKA 5FE4A 4CL9A 4YH3A 4WIVA 5ETDA 4BW4A 4YBMA 4Z93A 3ZYUA 4TT6A 5F60A 4NYXA 3U5PA 3SVGA 5HCLA 4NR4A 4QR5A 2DWWA 2L84A 4WHUA 5EISA 4F3IA 4LC2A 1JM4B 5JI8A 2N9GA 3MULA 2LSPB 3ONIA 4CUPA 5H85A 5BT5A 3S91A 4NRAA 4NR5A 5HJCA 4HXRA 3U5MA 4LR6A 4LYIA 5DW1A 5A7CA 4QSSA 5LJ1A 3UVXA 2E7OA 5ENCA 5IBNA 4A9LA 3QZTA 4HXMA 5A5SA 2YEMA 4FLPA 5AMEA 2DVQA 4BHWA 5DKHA 2YEKA 4NR6A 3UW9A 4ZQLA 5D24A 4OGJA 4QYDA 4CLBA 5FE5A 5L8TA 5CP5A 5DFBA 4TT2A 5TB6A 4ZC9A 4YYDA 2YW5A 5II2A 4IORA 3JVJA 5ENIA 3P5OA 4XY9A 4YATA 4YABA 4O70A 5EPSA 4LYSA 4MEOA 5CTLA 5FB1A 5D3LA 4YC9A 4NYWA 4UIXA 4NR8A 2FSAA 5E7DA 5CQ4A 4HXPA 4O7AA 5KTWA 4QSRA 4QSXA 4QYLA 4LRGA 4YY4A 4IOOA 5ACYA 3G0LA 3K2JA 2WP1A 1N72A 4QEUA 4NYVA 4A9FA 5HM0A 4O71A 4O76A 5I80A 5EK9A 2KTBB 5IGNA 5C8GA 1F68A 5FFYA 3FKMX 4HXKA 2E7NA 5CGPA 5BT4A 5I89A 3DWYA 2RNWA 3LQIA 4A9JA 5F63A 5HENA 5FE0A 5A83A 2L5EA 5CQAA 5FH7A 3DAIA 5ENEA 5L98A 4NR9A 3O36A 5H1TA 4HXLA 5CY9A 5A85A 5C4QA 2F6NA 5D3SA 5CQ5A 5CUDA 4PCIA 5C85A 3MQMA 4NUCA 4O7FA 2YYNA 2R0SA 4NQMA 4PTBA 5ENBA 4J1PA 4O78A 4NUEA 5E9YA 5F61A 2NXBA 4J0SA 4QSPA 5JWMA 5HRXA 5LJ0A 5FFWA 4HBVA 4YYKA 3NXBA 5DLXA 4YBTA 5G4SA 5EICA 4A9IA 4LDFA 4CUSA 5LKTA 4Q0OA 5A5NA 4TS8A 4QR4A 5LKXA 5HQ5A 4QUTA 5E9LA 4Z1SA 5E9IA 4A9NA 4QSVA 4PY6A 5EWVA 4A9HA 5D25A 4TT4A 5LKZA 4IR5A 5FE9A 5KU3A 5ENFA 5LKUA 3UVDA 4TU6A 5DYUA 3MB3A 5D3RA 1WUGA 4UYGA 2YQDA 5C7NA 5HFQA 5KTXA 5CQ6A 5C89A 4QSTA 5I29A 4HBWA 5DFCA 4MR4A 4PS5A 4UIYA 5ENHA 5I1QA 3O34A 2L85A 4N3WA 5AD2A 5FH8A 4QSWA 5K29A 5A5PA 3O37A 4CUTA 4QSQA 4YY6A 3LQHA 4KV1A 2I7KA 5IG6A 5CQ7A 5E0RA 3RCWA 4HXNA 4QR3A 4Q0NA 5EWWA 1ZS5A 2H60A 4TQNA 5DFDA 4Z6HA 5G4RA 3LQJA 5CQ8A 3P1FA 4A9EA 4LZ2A 3U5LA 5L96A 4LZRA 3JVLA 4HBYA 4Y03A 3S92A 5C87A 5IGLA 5L97A 4RVRA 3O33A 2RI7A 5CUCA 5D0CA 4UYDA 5FG4A 4TYLA 5D3TA 5I7YA 5D3HA 3TLPA 4BJXA 4MENA 4CURA 5LVQA 5D3PA 5A5RA 2R0VA 3Q2FA 3UVWA 5I40A 5HFRA 5FE7A 5L99A 5LVRA 3HMEA 4YYIA 5DYAA 5A81A 5I86A 4O75A 4NUDA 4NQNA 5DLZA 5DYCA 5FE6A 5CS8A 5F1HA 2E3KA 5DYXA 5ENGA 4XUAA 4CUUA 4YADA 5COIA 4QEWA 5EA1A 5FBXA 4HXSA 5DX4A 4BW1A 4Z6IA 4X2IA 4N4GA 4QBMA 4YH4A 5LUUA 5CU8A 4E96A 5ENJA 3JVMA 4UYFB 5HQ6A 4UIZA 4O7BA 5HEMA 2DVSA 4N4HA 4O7CA 4MR3A 2YDWA 2RNYA 4UYFA 5CFWA 4ALHA 2OSSA 3QZVA 4YYNA 3SVHA 5F5ZA 4NR7A 2DATA 5J0DA 4J3IA 4CFKA 3UV5A 5HRVA 3Q2EA 4QZSA 5FG6A 2F6JA 4A9MA 3UV4A 5FH6A 4KV4A 4C66A 4CFLA 4KCXA 5CRMA 5L8UA 5E3DA 4YYMA 5AMFA 4BW2A 5CQTA 2DKWA 5E3GA 4BW3A 5F25A 3MUKA 5EVAA 5ETBA 5F1LA 5FDZA 4CUQA 4YYHA 5AD3A 3IU5A 4TZ2A 5A5QA 4A9OA 3U5OA 4QUUA 3G0JA 5F3AA 4N4IA 4NXJA 3P1EA 3SVFA 3UV2A 5EPRA 4UIWA 5FE1A 5KO4A 4UITA 5E9VA 3GG3A 4QEVA 4UYHA 4IR4A 4QNSA 4YYJA 2G4AA 4UYEA 4PCEA 4UIUA 5HELA 5EM3A 4YBSA 1EQFA 4LZSA 4TU4A 4O77A 4TZ8A 3O35A 4IOQA 5EV9A 5EWCA 5FG5A 5LJ2A 5F62A 5F2PA 3U5NA 2R10A 4Z1QA 5HLSA 4XYAA 5E74A 5FE8A 4HXOA 5EI4A 2DVVA 4OGIA 4IR3A 5TCMA 4DONA 5I83A 2OUOA 2DVRA 3U5KA 4MR6A 4O72A 5DY7A 2RNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HMH A;  3MXF A;  4NRB A;  4N4F A;  5F36 A;  5H1U A;  3UVY A;  5CRZ A;  3AAD A;  4O74 A;  4UIV A;  5A82 A;  5E9K A;  5E73 A;  2D82 A;  4NRC A;  5A5O A;  2WP2 A;  4OUF A;  5CZG A;  5II1 A;  3U5J A;  4MEQ A;  4QSU A;  2D9E A;  3P1D A;  5CPE A;  5DKC A;  5E9M A;  4AKN A;  3HMF A;  4TTE A;  5EQ1 A;  5FB0 A;  3IU6 A;  5D26 A;  3LXJ A;  5HRW A;  5IGM A;  4NS5 A;  5EGU A;  2GRC A;  5CUB A;  3AQA A;  5D3N A;  3P1C A;  4QB3 A;  4J0R A;  4QY4 A;  5DBM A;  5EPB A;  2YEL A;  5I7X A;  5EWH A;  4QC3 A;  4YAX A;  2I8N A;  4WHW A;  3QZS A;  4MR5 A;  4HBX A;  5CQ3 A;  2OO1 A;  5CUA A;  5CUE A;  1JSP B;  5EU1 A;  4ALG A;  4LYW A;  4C67 A;  4ZW1 A;  3I3J A;  5IID A;  5CUG A;  3JVK A;  5D3J A;  1WUM A;  2RO1 A;  4IR6 A;  5KTU A;  4GPJ A;  4YYG A;  4YK0 A;  5BT3 A;  5EP7 A;  1X0J A;  5DKD A;  2R0Y A;  4XUB A;  3LJW A;  2MJV B;  5FE3 A;  4MEP A;  5D7X A;  4O7E A;  3MB4 A;  2RFJ A;  4A9K A;  5HQ7 A;  5DW2 A;  2RS9 B;  5FE2 A;  5FFV A;  4PKL A;  5H1V A;  3D7C A;  5EWD A;  5I88 A;  1E6I A;  4QC1 A;  5KHM A;  4XY8 A;  5IGK A;  5FE4 A;  4CL9 A;  4YH3 A;  4WIV A;  5ETD A;  4BW4 A;  4YBM A;  4Z93 A;  3ZYU A;  4TT6 A;  5F60 A;  4NYX A;  3U5P A;  3SVG A;  5HCL A;  4NR4 A;  4QR5 A;  2DWW A;  2L84 A;  4WHU A;  5EIS A;  4F3I A;  4LC2 A;  1JM4 B;  5JI8 A;  2N9G A;  3MUL A;  2LSP B;  3ONI A;  4CUP A;  5H85 A;  5BT5 A;  3S91 A;  4NRA A;  4NR5 A;  5HJC A;  4HXR A;  3U5M A;  4LR6 A;  4LYI A;  5DW1 A;  5A7C A;  4QSS A;  5LJ1 A;  3UVX A;  2E7O A;  5ENC A;  5IBN A;  4A9L A;  3QZT A;  4HXM A;  5A5S A;  2YEM A;  4FLP A;  5AME A;  2DVQ A;  4BHW A;  5DKH A;  2YEK A;  4NR6 A;  3UW9 A;  4ZQL A;  5D24 A;  4OGJ A;  4QYD A;  4CLB A;  5FE5 A;  5L8T A;  5CP5 A;  5DFB A;  4TT2 A;  5TB6 A;  4ZC9 A;  4YYD A;  2YW5 A;  5II2 A;  4IOR A;  3JVJ A;  5ENI A;  3P5O A;  4XY9 A;  4YAT A;  4YAB A;  4O70 A;  5EPS A;  4LYS A;  4MEO A;  5CTL A;  5FB1 A;  5D3L A;  4YC9 A;  4NYW A;  4UIX A;  4NR8 A;  2FSA A;  5E7D A;  5CQ4 A;  4HXP A;  4O7A A;  5KTW A;  4QSR A;  4QSX A;  4QYL A;  4LRG A;  4YY4 A;  4IOO A;  5ACY A;  3G0L A;  3K2J A;  2WP1 A;  1N72 A;  4QEU A;  4NYV A;  4A9F A;  5HM0 A;  4O71 A;  4O76 A;  5I80 A;  5EK9 A;  2KTB B;  5IGN A;  5C8G A;  1F68 A;  5FFY A;  3FKM X;  4HXK A;  2E7N A;  5CGP A;  5BT4 A;  5I89 A;  3DWY A;  2RNW A;  3LQI A;  4A9J A;  5F63 A;  5HEN A;  5FE0 A;  5A83 A;  2L5E A;  5CQA A;  5FH7 A;  3DAI A;  5ENE A;  5L98 A;  4NR9 A;  3O36 A;  5H1T A;  4HXL A;  5CY9 A;  5A85 A;  5C4Q A;  2F6N A;  5D3S A;  5CQ5 A;  5CUD A;  4PCI A;  5C85 A;  3MQM A;  4NUC A;  4O7F A;  2YYN A;  2R0S A;  4NQM A;  4PTB A;  5ENB A;  4J1P A;  4O78 A;  4NUE A;  5E9Y A;  5F61 A;  2NXB A;  4J0S A;  4QSP A;  5JWM A;  5HRX A;  5LJ0 A;  5FFW A;  4HBV A;  4YYK A;  3NXB A;  5DLX A;  4YBT A;  5G4S A;  5EIC A;  4A9I A;  4LDF A;  4CUS A;  5LKT A;  4Q0O A;  5A5N A;  4TS8 A;  4QR4 A;  5LKX A;  5HQ5 A;  4QUT A;  5E9L A;  4Z1S A;  5E9I A;  4A9N A;  4QSV A;  4PY6 A;  5EWV A;  4A9H A;  5D25 A;  4TT4 A;  5LKZ A;  4IR5 A;  5FE9 A;  5KU3 A;  5ENF A;  5LKU A;  3UVD A;  4TU6 A;  5DYU A;  3MB3 A;  5D3R A;  1WUG A;  4UYG A;  2YQD A;  5C7N A;  5HFQ A;  5KTX A;  5CQ6 A;  5C89 A;  4QST A;  5I29 A;  4HBW A;  5DFC A;  4MR4 A;  4PS5 A;  4UIY A;  5ENH A;  5I1Q A;  3O34 A;  2L85 A;  4N3W A;  5AD2 A;  5FH8 A;  4QSW A;  5K29 A;  5A5P A;  3O37 A;  4CUT A;  4QSQ A;  4YY6 A;  3LQH A;  4KV1 A;  2I7K A;  5IG6 A;  5CQ7 A;  5E0R A;  3RCW A;  4HXN A;  4QR3 A;  4Q0N A;  5EWW A;  1ZS5 A;  2H60 A;  4TQN A;  5DFD A;  4Z6H A;  5G4R A;  3LQJ A;  5CQ8 A;  3P1F A;  4A9E A;  4LZ2 A;  3U5L A;  5L96 A;  4LZR A;  3JVL A;  4HBY A;  4Y03 A;  3S92 A;  5C87 A;  5IGL A;  5L97 A;  4RVR A;  3O33 A;  2RI7 A;  5CUC A;  5D0C A;  4UYD A;  5FG4 A;  4TYL A;  5D3T A;  5I7Y A;  5D3H A;  3TLP A;  4BJX A;  4MEN A;  4CUR A;  5LVQ A;  5D3P A;  5A5R A;  2R0V A;  3Q2F A;  3UVW A;  5I40 A;  5HFR A;  5FE7 A;  5L99 A;  5LVR A;  3HME A;  4YYI A;  5DYA A;  5A81 A;  5I86 A;  4O75 A;  4NUD A;  4NQN A;  5DLZ A;  5DYC A;  5FE6 A;  5CS8 A;  5F1H A;  2E3K A;  5DYX A;  5ENG A;  4XUA A;  4CUU A;  4YAD A;  5COI A;  4QEW A;  5EA1 A;  5FBX A;  4HXS A;  5DX4 A;  4BW1 A;  4Z6I A;  4X2I A;  4N4G A;  4QBM A;  4YH4 A;  5LUU A;  5CU8 A;  4E96 A;  5ENJ A;  3JVM A;  4UYF B;  5HQ6 A;  4UIZ A;  4O7B A;  5HEM A;  2DVS A;  4N4H A;  4O7C A;  4MR3 A;  2YDW A;  2RNY A;  4UYF A;  5CFW A;  4ALH A;  2OSS A;  3QZV A;  4YYN A;  3SVH A;  5F5Z A;  4NR7 A;  2DAT A;  5J0D A;  4J3I A;  4CFK A;  3UV5 A;  5HRV A;  3Q2E A;  4QZS A;  5FG6 A;  2F6J A;  4A9M A;  3UV4 A;  5FH6 A;  4KV4 A;  4C66 A;  4CFL A;  4KCX A;  5CRM A;  5L8U A;  5E3D A;  4YYM A;  5AMF A;  4BW2 A;  5CQT A;  2DKW A;  5E3G A;  4BW3 A;  5F25 A;  3MUK A;  5EVA A;  5ETB A;  5F1L A;  5FDZ A;  4CUQ A;  4YYH A;  5AD3 A;  3IU5 A;  4TZ2 A;  5A5Q A;  4A9O A;  3U5O A;  4QUU A;  3G0J A;  5F3A A;  4N4I A;  4NXJ A;  3P1E A;  3SVF A;  3UV2 A;  5EPR A;  4UIW A;  5FE1 A;  5KO4 A;  4UIT A;  5E9V A;  3GG3 A;  4QEV A;  4UYH A;  4IR4 A;  4QNS A;  4YYJ A;  2G4A A;  4UYE A;  4PCE A;  4UIU A;  5HEL A;  5EM3 A;  4YBS A;  1EQF A;  4LZS A;  4TU4 A;  4O77 A;  4TZ8 A;  3O35 A;  4IOQ A;  5EV9 A;  5EWC A;  5FG5 A;  5LJ2 A;  5F62 A;  5F2P A;  3U5N A;  2R10 A;  4Z1Q A;  5HLS A;  4XYA A;  5E74 A;  5FE8 A;  4HXO A;  5EI4 A;  2DVV A;  4OGI A;  4IR3 A;  5TCM A;  4DON A;  5I83 A;  2OUO A;  2DVR A;  3U5K A;  4MR6 A;  4O72 A;  5DY7 A;  2RNX A; 
#chains in the Genus database with same CATH topology
 3HMH A;  3MXF A;  4NRB A;  4N4F A;  5F36 A;  5H1U A;  3UVY A;  5CRZ A;  3AAD A;  4O74 A;  4UIV A;  5A82 A;  5E9K A;  5E73 A;  2D82 A;  4NRC A;  5A5O A;  2WP2 A;  4OUF A;  5CZG A;  5II1 A;  3U5J A;  4MEQ A;  4QSU A;  2D9E A;  3P1D A;  5CPE A;  5DKC A;  5E9M A;  4AKN A;  3HMF A;  4TTE A;  5EQ1 A;  5FB0 A;  3IU6 A;  5D26 A;  3LXJ A;  5HRW A;  5IGM A;  4NS5 A;  5EGU A;  2GRC A;  5CUB A;  3AQA A;  5D3N A;  3P1C A;  4QB3 A;  4J0R A;  4QY4 A;  5DBM A;  5EPB A;  2YEL A;  5I7X A;  5EWH A;  4QC3 A;  4YAX A;  2I8N A;  4WHW A;  3QZS A;  4MR5 A;  4HBX A;  5CQ3 A;  2OO1 A;  5CUA A;  5CUE A;  1JSP B;  5EU1 A;  4ALG A;  4LYW A;  4C67 A;  4ZW1 A;  3I3J A;  5IID A;  5CUG A;  3JVK A;  5D3J A;  1WUM A;  2RO1 A;  4IR6 A;  5KTU A;  4GPJ A;  4YYG A;  4YK0 A;  5BT3 A;  5EP7 A;  1X0J A;  5DKD A;  2R0Y A;  4XUB A;  3LJW A;  2MJV B;  5FE3 A;  4MEP A;  5D7X A;  4O7E A;  3MB4 A;  2RFJ A;  4A9K A;  5HQ7 A;  5DW2 A;  2RS9 B;  5FE2 A;  5FFV A;  4PKL A;  5H1V A;  3D7C A;  5EWD A;  5I88 A;  1E6I A;  4QC1 A;  5KHM A;  4XY8 A;  5IGK A;  5FE4 A;  4CL9 A;  4YH3 A;  4WIV A;  5ETD A;  4BW4 A;  4YBM A;  4Z93 A;  3ZYU A;  4TT6 A;  5F60 A;  4NYX A;  3U5P A;  3SVG A;  5HCL A;  4NR4 A;  1ZKR A;  4QR5 A;  2DWW A;  2L84 A;  4WHU A;  5EIS A;  4F3I A;  4LC2 A;  1JM4 B;  5JI8 A;  2N9G A;  3MUL A;  2LSP B;  3ONI A;  4CUP A;  5H85 A;  5BT5 A;  3S91 A;  4NRA A;  4NR5 A;  5HJC A;  4HXR A;  3U5M A;  4LR6 A;  4LYI A;  5DW1 A;  5A7C A;  4QSS A;  5LJ1 A;  3UVX A;  2E7O A;  5ENC A;  5IBN A;  4A9L A;  3QZT A;  4HXM A;  5A5S A;  2YEM A;  4FLP A;  5AME A;  2DVQ A;  4BHW A;  5DKH A;  4AKI A;  2YEK A;  4NR6 A;  3UW9 A;  3ERR A;  4ZQL A;  5D24 A;  4OGJ A;  4QYD A;  4CLB A;  5FE5 A;  5L8T A;  5CP5 A;  5DFB A;  4TT2 A;  5TB6 A;  4ZC9 A;  4YYD A;  2YW5 A;  5II2 A;  4IOR A;  3JVJ A;  5ENI A;  3P5O A;  4XY9 A;  4YAT A;  4YAB A;  4O70 A;  5EPS A;  4LYS A;  4MEO A;  5CTL A;  5FB1 A;  5D3L A;  4YC9 A;  4NYW A;  4UIX A;  4NR8 A;  2FSA A;  5E7D A;  5CQ4 A;  4HXP A;  4O7A A;  5KTW A;  4QSR A;  4QSX A;  4QYL A;  4LRG A;  4YY4 A;  4IOO A;  5ACY A;  3G0L A;  3K2J A;  2WP1 A;  1N72 A;  4QEU A;  4NYV A;  4A9F A;  5HM0 A;  4O71 A;  4O76 A;  5I80 A;  5EK9 A;  2KTB B;  5IGN A;  5C8G A;  1F68 A;  5FFY A;  3FKM X;  4HXK A;  2E7N A;  5CGP A;  5BT4 A;  5I89 A;  4AI6 A;  3DWY A;  2RNW A;  3LQI A;  4A9J A;  5F63 A;  5HEN A;  5FE0 A;  5A83 A;  2L5E A;  5CQA A;  5FH7 A;  3DAI A;  5ENE A;  5L98 A;  4NR9 A;  3O36 A;  5H1T A;  4HXL A;  5CY9 A;  5A85 A;  3D1D A;  2F6N A;  5C4Q A;  5D3S A;  5CQ5 A;  5CUD A;  4PCI A;  5C85 A;  3MQM A;  4NUC A;  4O7F A;  2YYN A;  2R0S A;  4NQM A;  4PTB A;  5ENB A;  4J1P A;  4O78 A;  4NUE A;  5E9Y A;  5F61 A;  2NXB A;  4J0S A;  4QSP A;  5JWM A;  5HRX A;  5LJ0 A;  5FFW A;  4HBV A;  4YYK A;  3NXB A;  5DLX A;  4YBT A;  5G4S A;  5EIC A;  4A9I A;  4LDF A;  4CUS A;  5LKT A;  4Q0O A;  5A5N A;  4TS8 A;  4QR4 A;  5LKX A;  5HQ5 A;  4QUT A;  5E9L A;  4Z1S A;  5E9I A;  4A9N A;  4QSV A;  4PY6 A;  5EWV A;  4A9H A;  5D25 A;  4TT4 A;  5LKZ A;  4IR5 A;  5FE9 A;  5KU3 A;  5ENF A;  5LKU A;  3UVD A;  4TU6 A;  5DYU A;  3MB3 A;  2EJN A;  5D3R A;  1WUG A;  4UYG A;  2YQD A;  5C7N A;  5HFQ A;  5KTX A;  5CQ6 A;  5C89 A;  4QST A;  5I29 A;  4HBW A;  5DFC A;  4MR4 A;  4PS5 A;  4UIY A;  5ENH A;  5I1Q A;  3O34 A;  2L85 A;  4N3W A;  5AD2 A;  5FH8 A;  4QSW A;  5K29 A;  5A5P A;  3O37 A;  4CUT A;  4QSQ A;  4YY6 A;  3LQH A;  4AKG A;  4KV1 A;  2I7K A;  5IG6 A;  5CQ7 A;  5E0R A;  3RCW A;  4HXN A;  4QR3 A;  4Q0N A;  5EWW A;  1ZS5 A;  2H60 A;  4TQN A;  5DFD A;  4Z6H A;  5G4R A;  3LQJ A;  5CQ8 A;  3P1F A;  4A9E A;  3VKH A;  4LZ2 A;  3U5L A;  5L96 A;  4LZR A;  3JVL A;  4HBY A;  4Y03 A;  3S92 A;  5C87 A;  5IGL A;  5L97 A;  4RVR A;  3O33 A;  2RI7 A;  5CUC A;  5D0C A;  4UYD A;  5FG4 A;  4TYL A;  5D3T A;  5I7Y A;  5D3H A;  3TLP A;  4BJX A;  4MEN A;  4CUR A;  5LVQ A;  5D3P A;  5A5R A;  2R0V A;  3Q2F A;  3UVW A;  5I40 A;  5HFR A;  5FE7 A;  5L99 A;  5LVR A;  3HME A;  4YYI A;  5DYA A;  5A81 A;  5I86 A;  4AKH A;  4O75 A;  4NUD A;  4NQN A;  5DLZ A;  5DYC A;  5FE6 A;  5CS8 A;  5F1H A;  2E3K A;  5DYX A;  5ENG A;  4XUA A;  4CUU A;  4YAD A;  5COI A;  4QEW A;  5EA1 A;  5FBX A;  4HXS A;  5DX4 A;  4BW1 A;  4Z6I A;  4X2I A;  4N4G A;  4QBM A;  4YH4 A;  5LUU A;  5CU8 A;  4E96 A;  5ENJ A;  3JVM A;  4UYF B;  5HQ6 A;  4UIZ A;  4O7B A;  5HEM A;  2DVS A;  4N4H A;  4O7C A;  4MR3 A;  2YDW A;  2RNY A;  4UYF A;  5CFW A;  4ALH A;  2OSS A;  3QZV A;  4YYN A;  3SVH A;  5F5Z A;  4NR7 A;  3VKG A;  2DAT A;  5J0D A;  4J3I A;  4CFK A;  3UV5 A;  5HRV A;  3Q2E A;  4QZS A;  5FG6 A;  2F6J A;  4A9M A;  3UV4 A;  5FH6 A;  4KV4 A;  4C66 A;  4CFL A;  4KCX A;  5CRM A;  5L8U A;  5E3D A;  4YYM A;  5AMF A;  4BW2 A;  5CQT A;  2DKW A;  5E3G A;  4BW3 A;  5F25 A;  3MUK A;  5EVA A;  5ETB A;  5F1L A;  5FDZ A;  4CUQ A;  4YYH A;  5AD3 A;  3IU5 A;  4TZ2 A;  5A5Q A;  4A9O A;  3U5O A;  4QUU A;  3G0J A;  5F3A A;  4N4I A;  4NXJ A;  3P1E A;  3SVF A;  3UV2 A;  5EPR A;  4UIW A;  5FE1 A;  5KO4 A;  4UIT A;  5E9V A;  3GG3 A;  4QEV A;  4UYH A;  4IR4 A;  4QNS A;  1PUO A;  4YYJ A;  2G4A A;  4UYE A;  4PCE A;  4UIU A;  5HEL A;  5EM3 A;  4YBS A;  1EQF A;  4LZS A;  4TU4 A;  4O77 A;  4TZ8 A;  3O35 A;  4IOQ A;  5EV9 A;  5EWC A;  5FG5 A;  5LJ2 A;  5F62 A;  5F2P A;  3U5N A;  2R10 A;  4Z1Q A;  5HLS A;  4XYA A;  5E74 A;  5FE8 A;  4HXO A;  5EI4 A;  2DVV A;  4OGI A;  4IR3 A;  5TCM A;  4DON A;  5I83 A;  2OUO A;  2DVR A;  3U5K A;  3D1B A;  4MR6 A;  4O72 A;  5DY7 A;  2RNX A; 
#chains in the Genus database with same CATH homology
 3HMH A;  3MXF A;  4NRB A;  4N4F A;  5F36 A;  5H1U A;  3UVY A;  5CRZ A;  3AAD A;  4O74 A;  4UIV A;  5A82 A;  5E9K A;  5E73 A;  2D82 A;  4NRC A;  5A5O A;  2WP2 A;  4OUF A;  5CZG A;  5II1 A;  3U5J A;  4MEQ A;  4QSU A;  2D9E A;  3P1D A;  5CPE A;  5DKC A;  5E9M A;  4AKN A;  3HMF A;  4TTE A;  5EQ1 A;  5FB0 A;  3IU6 A;  5D26 A;  3LXJ A;  5HRW A;  5IGM A;  4NS5 A;  5EGU A;  2GRC A;  5CUB A;  3AQA A;  5D3N A;  3P1C A;  4QB3 A;  4J0R A;  4QY4 A;  5DBM A;  5EPB A;  2YEL A;  5I7X A;  5EWH A;  4QC3 A;  4YAX A;  2I8N A;  4WHW A;  3QZS A;  4MR5 A;  4HBX A;  5CQ3 A;  2OO1 A;  5CUA A;  5CUE A;  1JSP B;  5EU1 A;  4ALG A;  4LYW A;  4C67 A;  4ZW1 A;  3I3J A;  5IID A;  5CUG A;  3JVK A;  5D3J A;  1WUM A;  2RO1 A;  4IR6 A;  5KTU A;  4GPJ A;  4YYG A;  4YK0 A;  5BT3 A;  5EP7 A;  1X0J A;  5DKD A;  2R0Y A;  4XUB A;  3LJW A;  2MJV B;  5FE3 A;  4MEP A;  5D7X A;  4O7E A;  3MB4 A;  2RFJ A;  4A9K A;  5HQ7 A;  5DW2 A;  2RS9 B;  5FE2 A;  5FFV A;  4PKL A;  5H1V A;  3D7C A;  5EWD A;  5I88 A;  1E6I A;  4QC1 A;  5KHM A;  4XY8 A;  5IGK A;  5FE4 A;  4CL9 A;  4YH3 A;  4WIV A;  5ETD A;  4BW4 A;  4YBM A;  4Z93 A;  3ZYU A;  4TT6 A;  5F60 A;  4NYX A;  3U5P A;  3SVG A;  5HCL A;  4NR4 A;  4QR5 A;  2DWW A;  2L84 A;  4WHU A;  5EIS A;  4F3I A;  4LC2 A;  1JM4 B;  5JI8 A;  2N9G A;  3MUL A;  2LSP B;  3ONI A;  4CUP A;  5H85 A;  5BT5 A;  3S91 A;  4NRA A;  4NR5 A;  5HJC A;  4HXR A;  3U5M A;  4LR6 A;  4LYI A;  5DW1 A;  5A7C A;  4QSS A;  5LJ1 A;  3UVX A;  2E7O A;  5ENC A;  5IBN A;  4A9L A;  3QZT A;  4HXM A;  5A5S A;  2YEM A;  4FLP A;  5AME A;  2DVQ A;  4BHW A;  5DKH A;  2YEK A;  4NR6 A;  3UW9 A;  4ZQL A;  5D24 A;  4OGJ A;  4QYD A;  4CLB A;  5FE5 A;  5L8T A;  5CP5 A;  5DFB A;  4TT2 A;  5TB6 A;  4ZC9 A;  4YYD A;  2YW5 A;  5II2 A;  4IOR A;  3JVJ A;  5ENI A;  3P5O A;  4XY9 A;  4YAT A;  4YAB A;  4O70 A;  5EPS A;  4LYS A;  4MEO A;  5CTL A;  5FB1 A;  5D3L A;  4YC9 A;  4NYW A;  4UIX A;  4NR8 A;  2FSA A;  5E7D A;  5CQ4 A;  4HXP A;  4O7A A;  5KTW A;  4QSR A;  4QSX A;  4QYL A;  4LRG A;  4YY4 A;  4IOO A;  5ACY A;  3G0L A;  3K2J A;  2WP1 A;  1N72 A;  4QEU A;  4NYV A;  4A9F A;  5HM0 A;  4O71 A;  4O76 A;  5I80 A;  5EK9 A;  2KTB B;  5IGN A;  5C8G A;  1F68 A;  5FFY A;  3FKM X;  4HXK A;  2E7N A;  5CGP A;  5BT4 A;  5I89 A;  3DWY A;  2RNW A;  3LQI A;  4A9J A;  5F63 A;  5HEN A;  5FE0 A;  5A83 A;  2L5E A;  5CQA A;  5FH7 A;  3DAI A;  5ENE A;  5L98 A;  4NR9 A;  3O36 A;  5H1T A;  4HXL A;  5CY9 A;  5A85 A;  5C4Q A;  2F6N A;  5D3S A;  5CQ5 A;  5CUD A;  4PCI A;  5C85 A;  3MQM A;  4NUC A;  4O7F A;  2YYN A;  2R0S A;  4NQM A;  4PTB A;  5ENB A;  4J1P A;  4O78 A;  4NUE A;  5E9Y A;  5F61 A;  2NXB A;  4J0S A;  4QSP A;  5JWM A;  5HRX A;  5LJ0 A;  5FFW A;  4HBV A;  4YYK A;  3NXB A;  5DLX A;  4YBT A;  5G4S A;  5EIC A;  4A9I A;  4LDF A;  4CUS A;  5LKT A;  4Q0O A;  5A5N A;  4TS8 A;  4QR4 A;  5LKX A;  5HQ5 A;  4QUT A;  5E9L A;  4Z1S A;  5E9I A;  4A9N A;  4QSV A;  4PY6 A;  5EWV A;  4A9H A;  5D25 A;  4TT4 A;  5LKZ A;  4IR5 A;  5FE9 A;  5KU3 A;  5ENF A;  5LKU A;  3UVD A;  4TU6 A;  5DYU A;  3MB3 A;  5D3R A;  1WUG A;  4UYG A;  2YQD A;  5C7N A;  5HFQ A;  5KTX A;  5CQ6 A;  5C89 A;  4QST A;  5I29 A;  4HBW A;  5DFC A;  4MR4 A;  4PS5 A;  4UIY A;  5ENH A;  5I1Q A;  3O34 A;  2L85 A;  4N3W A;  5AD2 A;  5FH8 A;  4QSW A;  5K29 A;  5A5P A;  3O37 A;  4CUT A;  4QSQ A;  4YY6 A;  3LQH A;  4KV1 A;  2I7K A;  5IG6 A;  5CQ7 A;  5E0R A;  3RCW A;  4HXN A;  4QR3 A;  4Q0N A;  5EWW A;  1ZS5 A;  2H60 A;  4TQN A;  5DFD A;  4Z6H A;  5G4R A;  3LQJ A;  5CQ8 A;  3P1F A;  4A9E A;  4LZ2 A;  3U5L A;  5L96 A;  4LZR A;  3JVL A;  4HBY A;  4Y03 A;  3S92 A;  5C87 A;  5IGL A;  5L97 A;  4RVR A;  3O33 A;  2RI7 A;  5CUC A;  5D0C A;  4UYD A;  5FG4 A;  4TYL A;  5D3T A;  5I7Y A;  5D3H A;  3TLP A;  4BJX A;  4MEN A;  4CUR A;  5LVQ A;  5D3P A;  5A5R A;  2R0V A;  3Q2F A;  3UVW A;  5I40 A;  5HFR A;  5FE7 A;  5L99 A;  5LVR A;  3HME A;  4YYI A;  5DYA A;  5A81 A;  5I86 A;  4O75 A;  4NUD A;  4NQN A;  5DLZ A;  5DYC A;  5FE6 A;  5CS8 A;  5F1H A;  2E3K A;  5DYX A;  5ENG A;  4XUA A;  4CUU A;  4YAD A;  5COI A;  4QEW A;  5EA1 A;  5FBX A;  4HXS A;  5DX4 A;  4BW1 A;  4Z6I A;  4X2I A;  4N4G A;  4QBM A;  4YH4 A;  5LUU A;  5CU8 A;  4E96 A;  5ENJ A;  3JVM A;  4UYF B;  5HQ6 A;  4UIZ A;  4O7B A;  5HEM A;  2DVS A;  4N4H A;  4O7C A;  4MR3 A;  2YDW A;  2RNY A;  4UYF A;  5CFW A;  4ALH A;  2OSS A;  3QZV A;  4YYN A;  3SVH A;  5F5Z A;  4NR7 A;  2DAT A;  5J0D A;  4J3I A;  4CFK A;  3UV5 A;  5HRV A;  3Q2E A;  4QZS A;  5FG6 A;  2F6J A;  4A9M A;  3UV4 A;  5FH6 A;  4KV4 A;  4C66 A;  4CFL A;  4KCX A;  5CRM A;  5L8U A;  5E3D A;  4YYM A;  5AMF A;  4BW2 A;  5CQT A;  2DKW A;  5E3G A;  4BW3 A;  5F25 A;  3MUK A;  5EVA A;  5ETB A;  5F1L A;  5FDZ A;  4CUQ A;  4YYH A;  5AD3 A;  3IU5 A;  4TZ2 A;  5A5Q A;  4A9O A;  3U5O A;  4QUU A;  3G0J A;  5F3A A;  4N4I A;  4NXJ A;  3P1E A;  3SVF A;  3UV2 A;  5EPR A;  4UIW A;  5FE1 A;  5KO4 A;  4UIT A;  5E9V A;  3GG3 A;  4QEV A;  4UYH A;  4IR4 A;  4QNS A;  4YYJ A;  2G4A A;  4UYE A;  4PCE A;  4UIU A;  5HEL A;  5EM3 A;  4YBS A;  1EQF A;  4LZS A;  4TU4 A;  4O77 A;  4TZ8 A;  3O35 A;  4IOQ A;  5EV9 A;  5EWC A;  5FG5 A;  5LJ2 A;  5F62 A;  5F2P A;  3U5N A;  2R10 A;  4Z1Q A;  5HLS A;  4XYA A;  5E74 A;  5FE8 A;  4HXO A;  5EI4 A;  2DVV A;  4OGI A;  4IR3 A;  5TCM A;  4DON A;  5I83 A;  2OUO A;  2DVR A;  3U5K A;  4MR6 A;  4O72 A;  5DY7 A;  2RNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...