3LJWA

Crystal structure of the second bromodomain of human polybromo
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
118
structure length
118
Chain Sequence
GSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHAMAKDIDLLAKNAKTYNEPGSQVFKDANSIKKIFYMKKAEIEHHEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Structural insights into selective histone H3 recognition by the human Polybromo bromodomain 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3ljwA00
5FH7A 2D9EA 3P1DA 4UIWA 4IR4A 2R10A 4LZ2A 5EWHA 5A81A 2R0SA 5I29A 5FB1A 2DATA 5ENHA 4WHWA 2GRCA 5CUCA 4CUSA 5DLXA 3SVHA 2YDWA 5DBMA 5ENIA 4CURA 4A9IA 2DWWA 5L98A 4TYLA 5L97A 4NUCA 4ZW1A 4MEPA 4PTBA 2RFJA 2L5EA 3K2JA 4PCIA 4QSWA 4NXJA 5DYXA 2DVVA 2YYNA 4F3IA 5HRWA 5D24A 5ENBA 4PCEA 5CFWA 4MEOA 4QBMA 4QYLA 4YY4A 4QR5A 5DKCA 5BT4A 4YK0A 5KO4A 4HBVA 4HXMA 4HXPA 5CQ8A 5D3SA 4TU4A 4Y03A 5F61A 4O7AA 5D3RA 4MENA 5LKUA 2OO1A 5KU3A 2RS9B 2KTBB 3UVYA 5AMFA 4CUPA 5KTUA 5I40A 5HQ7A 3P1EA 5HQ5A 4O7FA 5HRVA 5KTXA 4XUAA 5CQAA 5L8TA 5COIA 3U5PA 2WP2A 4UYDA 4BW1A 5EPBA 5E0RA 1ZS5A 5D3TA 2E7NA 4CUTA 5II2A 4YBSA 5F3AA 5CZGA 5FFVA 4N4GA 3U5MA 5E9LA 4YC9A 5E3DA 3UVXA 3O36A 2N9GA 4KV4A 5DYUA 4XY9A 5FDZA 3DAIA 4OGJA 4J1PA 4A9FA 3ZYUA 4QUUA 4J3IA 5E9MA 3TLPA 4YABA 3ONIA 4IOQA 4LYIA 5EWVA 2RNWA 4FLPA 4QSVA 4IR6A 3UW9A 2I7KA 3U5JA 5HELA 5C89A 4TT6A 4N4HA 4TT2A 4HXOA 3HMEA 5FFYA 4O7BA 4YADA 5HRXA 4QNSA 5L8UA 4TU6A 5CQTA 4CUQA 5FE6A 4O7CA 4O7EA 4OUFA 4HXLA 4TZ8A 5KTWA 4UYHA 4BHWA 5F63A 5ENEA 4NYVA 4HXSA 3Q2EA 3JVJA 5F36A 3LJWA 3D7CA 5IGMA 5EQ1A 2NXBA 4QSQA 4YYJA 5ENGA 5A7CA 4MR4A 5CS8A 3O34A 4BW4A 1N72A 3FKMX 4UIVA 2R0YA 4CUUA 5FG6A 5F1LA 3QZTA 5FH6A 5FE9A 4NQMA 4MR6A 4ZC9A 5FE1A 5HFQA 1E6IA 4YYHA 5FE4A 1X0JA 5IGLA 5G4RA 4C66A 3LQHA 5A5RA 5CQ5A 5EI4A 2YEKA 5EISA 4HBXA 5LKZA 3LQJA 5EU1A 4QZSA 4LYSA 4CFLA 3G0JA 4BJXA 3MXFA 4C67A 3RCWA 5FG5A 5HM0A 2DVSA 4J0RA 4UIZA 5HFRA 5CUDA 5CP5A 2DKWA 4UIUA 2RNYA 5HLSA 4TS8A 5TCMA 5ENCA 3U5OA 5CQ6A 3QZVA 5IIDA 5E73A 4N4FA 5L99A 3P1FA 5A5NA 3UV2A 2MJVB 4E96A 4TQNA 4YAXA 4LR6A 3NXBA 2YELA 4YYKA 2YQDA 5EM3A 4NUEA 4AKNA 5D25A 2I8NA 5CU8A 3QZSA 3IU6A 4HBWA 4PKLA 5E9KA 5E9VA 4NR7A 4A9KA 4YYGA 5I80A 1JM4B 4PY6A 5E3GA 4O72A 4QEVA 4O70A 5I88A 5EICA 4Z1SA 4XYAA 5LVRA 4YY6A 5BT5A 5D7XA 5D3NA 5K29A 5DFDA 4YH4A 4NQNA 3I3JA 5A5PA 3MULA 3P5OA 4OGIA 5FBXA 5AD2A 5ACYA 4IR3A 2H60A 4UYEA 3P1CA 2R0VA 4BW3A 5LJ2A 5II1A 5FE8A 4A9EA 4NR8A 4QSTA 2F6NA 4TTEA 5E9YA 3GG3A 5FB0A 5DX4A 2D82A 5HJCA 3LXJA 5DW1A 4QYDA 5CUBA 3MB3A 5DFCA 4Z6IA 3Q2FA 4YH3A 3U5NA 5DY7A 5A82A 4YYDA 2YEMA 5A5QA 5ETBA 4XUBA 5EK9A 3UVDA 5CY9A 4MR5A 5C7NA 5FE2A 4IORA 4NS5A 5LKXA 5JWMA 3MUKA 5D3HA 4YBTA 5E74A 5EWCA 5EWDA 3U5LA 4IR5A 5FE7A 5KHMA 4LZSA 3O37A 5EP7A 3UV4A 4HXKA 3S92A 4TZ2A 4WHUA 4Q0NA 5D26A 3DWYA 4QSRA 5H1VA 5F60A 3S91A 3O33A 4RVRA 4QR3A 5CQ4A 5CUGA 4QR4A 5LJ0A 4YBMA 5A85A 3SVGA 2RNXA 2E7OA 4IOOA 2YW5A 5F25A 4YYIA 4PS5A 4A9LA 2DVQA 5CUEA 5JI8A 4X2IA 4N3WA 4NR9A 5LUUA 4WIVA 1WUMA 4O77A 4QY4A 5D3JA 5LVQA 5CRMA 5IGNA 4QSSA 4O78A 5DFBA 4J0SA 5CQ3A 5E7DA 4CFKA 4CLBA 2RO1A 5BT3A 4NR4A 5E9IA 5AD3A 4KV1A 5CUAA 4QEUA 5A5SA 5CRZA 5F62A 4LC2A 4LDFA 4MR3A 4QB3A 4HBYA 2L85A 4Q0OA 3JVKA 4QEWA 5CTLA 5I7XA 4Z93A 3AADA 5EA1A 4NR5A 3UVWA 2L84A 4CL9A 4LRGA 3LQIA 4HXRA 5DW2A 4QSXA 5C4QA 1F68A 5ENJA 4YYNA 4NYWA 5F2PA 5H85A 4Z6HA 4DONA 5HCLA 5EVAA 5D0CA 4UITA 2LSPB 5I83A 5C8GA 3G0LA 5LKTA 4A9OA 4NYXA 4BW2A 5D3LA 4MEQA 4QC1A 5L96A 5I7YA 5FH8A 4YATA 4UIXA 2DVRA 5FE3A 1WUGA 5A83A 4UYFB 4A9JA 4YYMA 5CGPA 5CQ7A 3UV5A 4NUDA 5HENA 5C87A 4TT4A 3HMFA 4ALHA 4GPJA 5I89A 2F6JA 5C85A 5LJ1A 5EV9A 1EQFA 5ENFA 4O76A 2OUOA 4A9NA 4QSPA 3SVFA 5H1TA 4LZRA 4ALGA 5F5ZA 3U5KA 2E3KA 5EPRA 5DYAA 4A9HA 2RI7A 5IBNA 4N4IA 5IG6A 5FG4A 3JVMA 4NRBA 2FSAA 4UYFA 3AQAA 4NRCA 5EGUA 5G4SA 4ZQLA 5IGKA 5FE5A 3JVLA 4Z1QA 4KCXA 4QSUA 5DLZA 5A5OA 3MQMA 4UYGA 4HXNA 4A9MA 5H1UA 5I86A 5EPSA 5DYCA 5DKDA 3HMHA 5J0DA 3O35A 5FFWA 5FE0A 5DKHA 2G4AA 2WP1A 4NR6A 5F1HA 5TB6A 4QUTA 4O74A 4QC3A 4XY8A 5HEMA 1JSPB 4LYWA 5EWWA 4O75A 5HQ6A 2OSSA 5ETDA 3IU5A 5D3PA 4NRAA 5I1QA 4O71A 5AMEA 5CPEA 3MB4A 4UIYA
chains in the Genus database with same CATH superfamily
5FH7A 2D9EA 3P1DA 4UIWA 4IR4A 2R10A 4LZ2A 5EWHA 5A81A 2R0SA 5I29A 5FB1A 2DATA 5ENHA 4WHWA 2GRCA 5CUCA 4CUSA 5DLXA 3SVHA 2YDWA 5DBMA 5ENIA 4CURA 4A9IA 2DWWA 5L98A 4TYLA 5L97A 4NUCA 4ZW1A 4MEPA 4PTBA 2RFJA 2L5EA 3K2JA 4PCIA 4QSWA 4NXJA 5DYXA 2DVVA 2YYNA 4F3IA 5HRWA 5D24A 5ENBA 4PCEA 5CFWA 4MEOA 4QBMA 4QYLA 4YY4A 4QR5A 5DKCA 5BT4A 4YK0A 5KO4A 4HBVA 4HXMA 4HXPA 5CQ8A 5D3SA 4TU4A 4Y03A 5F61A 4O7AA 5D3RA 4MENA 5LKUA 2OO1A 5KU3A 2RS9B 2KTBB 3UVYA 5AMFA 4CUPA 5KTUA 5I40A 5HQ7A 3P1EA 5HQ5A 4O7FA 5HRVA 5KTXA 4XUAA 5CQAA 5L8TA 5COIA 3U5PA 2WP2A 4UYDA 4BW1A 5EPBA 5E0RA 1ZS5A 5D3TA 2E7NA 4CUTA 5II2A 4YBSA 5F3AA 5CZGA 5FFVA 4N4GA 3U5MA 5E9LA 4YC9A 5E3DA 3UVXA 3O36A 2N9GA 4KV4A 5DYUA 4XY9A 5FDZA 3DAIA 4OGJA 4J1PA 4A9FA 3ZYUA 4QUUA 4J3IA 5E9MA 3TLPA 4YABA 3ONIA 4IOQA 4LYIA 5EWVA 2RNWA 4FLPA 4QSVA 4IR6A 3UW9A 2I7KA 3U5JA 5HELA 5C89A 4TT6A 4N4HA 4TT2A 4HXOA 3HMEA 5FFYA 4O7BA 4YADA 5HRXA 4QNSA 5L8UA 4TU6A 5CQTA 4CUQA 5FE6A 4O7CA 4O7EA 4OUFA 4HXLA 4TZ8A 5KTWA 4UYHA 4BHWA 5F63A 5ENEA 4NYVA 4HXSA 3Q2EA 3JVJA 5F36A 3LJWA 3D7CA 5IGMA 5EQ1A 2NXBA 4QSQA 4YYJA 5ENGA 5A7CA 4MR4A 5CS8A 3O34A 4BW4A 1N72A 3FKMX 4UIVA 2R0YA 4CUUA 5FG6A 5F1LA 3QZTA 5FH6A 5FE9A 4NQMA 4MR6A 4ZC9A 5FE1A 5HFQA 1E6IA 4YYHA 5FE4A 1X0JA 5IGLA 5G4RA 4C66A 3LQHA 5A5RA 5CQ5A 5EI4A 2YEKA 5EISA 4HBXA 5LKZA 3LQJA 5EU1A 4QZSA 4LYSA 4CFLA 3G0JA 4BJXA 3MXFA 4C67A 3RCWA 5FG5A 5HM0A 2DVSA 4J0RA 4UIZA 5HFRA 5CUDA 5CP5A 2DKWA 4UIUA 2RNYA 5HLSA 4TS8A 5TCMA 5ENCA 3U5OA 5CQ6A 3QZVA 5IIDA 5E73A 4N4FA 5L99A 3P1FA 5A5NA 3UV2A 2MJVB 4AKIA 4E96A 4TQNA 4YAXA 4LR6A 3NXBA 2YELA 4YYKA 2YQDA 5EM3A 4NUEA 4AKNA 5D25A 2I8NA 5CU8A 3QZSA 3IU6A 4HBWA 4PKLA 5E9KA 5E9VA 4NR7A 4A9KA 4YYGA 5I80A 1JM4B 4PY6A 5E3GA 4O72A 4QEVA 4O70A 5I88A 5EICA 4Z1SA 2EJNA 4XYAA 5LVRA 4YY6A 5BT5A 5D7XA 5D3NA 5K29A 5DFDA 4YH4A 4NQNA 3I3JA 5A5PA 3MULA 3P5OA 4OGIA 5FBXA 5AD2A 5ACYA 4IR3A 2H60A 4UYEA 3P1CA 2R0VA 4BW3A 5LJ2A 5II1A 5FE8A 4A9EA 4NR8A 4QSTA 2F6NA 4TTEA 5E9YA 3GG3A 3VKGA 5FB0A 5DX4A 2D82A 5HJCA 3LXJA 5DW1A 4QYDA 5CUBA 3MB3A 5DFCA 4Z6IA 3Q2FA 4YH3A 3U5NA 5DY7A 5A82A 4YYDA 2YEMA 5A5QA 5ETBA 4XUBA 5EK9A 3UVDA 5CY9A 4MR5A 5C7NA 5FE2A 4IORA 4NS5A 5LKXA 5JWMA 3MUKA 5D3HA 4YBTA 5E74A 5EWCA 5EWDA 3U5LA 4IR5A 5FE7A 5KHMA 4LZSA 3O37A 5EP7A 3UV4A 4HXKA 3S92A 4TZ2A 4WHUA 4Q0NA 5D26A 3DWYA 4QSRA 5H1VA 5F60A 3S91A 3O33A 4RVRA 4QR3A 5CQ4A 5CUGA 4QR4A 5LJ0A 4YBMA 5A85A 3SVGA 4AI6A 2RNXA 2E7OA 4IOOA 2YW5A 5F25A 4YYIA 4PS5A 4A9LA 2DVQA 5CUEA 5JI8A 4X2IA 4N3WA 4NR9A 5LUUA 4WIVA 1WUMA 4O77A 4QY4A 5D3JA 5LVQA 5CRMA 5IGNA 4QSSA 4O78A 5DFBA 4J0SA 5CQ3A 5E7DA 4CFKA 4CLBA 2RO1A 5BT3A 4NR4A 5E9IA 5AD3A 4AKHA 4KV1A 5CUAA 4QEUA 5A5SA 5CRZA 5F62A 4LC2A 4LDFA 4MR3A 4QB3A 4HBYA 2L85A 4Q0OA 3JVKA 4QEWA 5CTLA 5I7XA 4Z93A 3D1DA 3AADA 5EA1A 4NR5A 3D1BA 3UVWA 2L84A 4CL9A 4LRGA 3LQIA 4HXRA 5DW2A 4QSXA 5C4QA 1F68A 5ENJA 4YYNA 4NYWA 5F2PA 4AKGA 5H85A 4Z6HA 4DONA 5HCLA 5EVAA 5D0CA 4UITA 2LSPB 5I83A 5C8GA 3G0LA 5LKTA 4A9OA 4NYXA 1PUOA 5D3LA 4BW2A 4MEQA 4QC1A 5L96A 5I7YA 5FH8A 4YATA 4UIXA 2DVRA 3ERRA 5FE3A 1WUGA 5A83A 4UYFB 4A9JA 4YYMA 5CGPA 5CQ7A 3UV5A 4NUDA 5HENA 5C87A 4TT4A 3HMFA 4ALHA 4GPJA 5I89A 2F6JA 5C85A 5LJ1A 5EV9A 1EQFA 5ENFA 4O76A 2OUOA 4A9NA 4QSPA 3SVFA 5H1TA 4LZRA 4ALGA 5F5ZA 3U5KA 2E3KA 5EPRA 5DYAA 4A9HA 2RI7A 5IBNA 4N4IA 5IG6A 5FG4A 3JVMA 4NRBA 2FSAA 4UYFA 3AQAA 4NRCA 5EGUA 5G4SA 4ZQLA 5IGKA 5FE5A 3JVLA 4Z1QA 4KCXA 4QSUA 5DLZA 5A5OA 3MQMA 4UYGA 4HXNA 4A9MA 3VKHA 5H1UA 5I86A 5EPSA 5DYCA 5DKDA 1ZKRA 3HMHA 5J0DA 3O35A 5FFWA 5FE0A 5DKHA 2G4AA 2WP1A 4NR6A 5F1HA 5TB6A 4QUTA 4O74A 4QC3A 4XY8A 5HEMA 1JSPB 4LYWA 5EWWA 4O75A 5HQ6A 2OSSA 5ETDA 3IU5A 5D3PA 4NRAA 5I1QA 4O71A 5AMEA 5CPEA 3MB4A 4UIYA
chains in the Genus database with same CATH topology
5FH7A 2D9EA 3P1DA 4UIWA 4IR4A 2R10A 4LZ2A 5EWHA 5A81A 2R0SA 5I29A 5FB1A 2DATA 5ENHA 4WHWA 2GRCA 5CUCA 4CUSA 5DLXA 3SVHA 2YDWA 5DBMA 5ENIA 4CURA 4A9IA 2DWWA 5L98A 4TYLA 5L97A 4NUCA 4ZW1A 4MEPA 4PTBA 2RFJA 2L5EA 3K2JA 4PCIA 4QSWA 4NXJA 5DYXA 2DVVA 2YYNA 4F3IA 5HRWA 5D24A 5ENBA 4PCEA 5CFWA 4MEOA 4QBMA 4QYLA 4YY4A 4QR5A 5DKCA 5BT4A 4YK0A 5KO4A 4HBVA 4HXMA 4HXPA 5CQ8A 5D3SA 4TU4A 4Y03A 5F61A 4O7AA 5D3RA 4MENA 5LKUA 2OO1A 5KU3A 2RS9B 2KTBB 3UVYA 5AMFA 4CUPA 5KTUA 5I40A 5HQ7A 3P1EA 5HQ5A 4O7FA 5HRVA 5KTXA 4XUAA 5CQAA 5L8TA 5COIA 3U5PA 2WP2A 4UYDA 4BW1A 5EPBA 5E0RA 1ZS5A 5D3TA 2E7NA 4CUTA 5II2A 4YBSA 5F3AA 5CZGA 5FFVA 4N4GA 3U5MA 5E9LA 4YC9A 5E3DA 3UVXA 3O36A 2N9GA 4KV4A 5DYUA 4XY9A 5FDZA 3DAIA 4OGJA 4J1PA 4A9FA 3ZYUA 4QUUA 4J3IA 5E9MA 3TLPA 4YABA 3ONIA 4IOQA 4LYIA 5EWVA 2RNWA 4FLPA 4QSVA 4IR6A 3UW9A 2I7KA 3U5JA 5HELA 5C89A 4TT6A 4N4HA 4TT2A 4HXOA 3HMEA 5FFYA 4O7BA 4YADA 5HRXA 4QNSA 5L8UA 4TU6A 5CQTA 4CUQA 5FE6A 4O7CA 4O7EA 4OUFA 4HXLA 4TZ8A 5KTWA 4UYHA 4BHWA 5F63A 5ENEA 4NYVA 4HXSA 3Q2EA 3JVJA 5F36A 3LJWA 3D7CA 5IGMA 5EQ1A 2NXBA 4QSQA 4YYJA 5ENGA 5A7CA 4MR4A 5CS8A 3O34A 4BW4A 1N72A 3FKMX 4UIVA 2R0YA 4CUUA 5FG6A 5F1LA 3QZTA 5FH6A 5FE9A 4NQMA 4MR6A 4ZC9A 5FE1A 5HFQA 1E6IA 4YYHA 5FE4A 1X0JA 5IGLA 5G4RA 4C66A 3LQHA 5A5RA 5CQ5A 5EI4A 2YEKA 5EISA 4HBXA 5LKZA 3LQJA 5EU1A 4QZSA 4LYSA 4CFLA 3G0JA 4BJXA 3MXFA 4C67A 3RCWA 5FG5A 5HM0A 2DVSA 4J0RA 4UIZA 5HFRA 5CUDA 5CP5A 2DKWA 4UIUA 2RNYA 5HLSA 4TS8A 5TCMA 5ENCA 3U5OA 5CQ6A 3QZVA 5IIDA 5E73A 4N4FA 5L99A 3P1FA 5A5NA 3UV2A 2MJVB 4E96A 4TQNA 4YAXA 4LR6A 3NXBA 2YELA 4YYKA 2YQDA 5EM3A 4NUEA 4AKNA 5D25A 2I8NA 5CU8A 3QZSA 3IU6A 4HBWA 4PKLA 5E9KA 5E9VA 4NR7A 4A9KA 4YYGA 5I80A 1JM4B 4PY6A 5E3GA 4O72A 4QEVA 4O70A 5I88A 5EICA 4Z1SA 4XYAA 5LVRA 4YY6A 5BT5A 5D7XA 5D3NA 5K29A 5DFDA 4YH4A 4NQNA 3I3JA 5A5PA 3MULA 3P5OA 4OGIA 5FBXA 5AD2A 5ACYA 4IR3A 2H60A 4UYEA 3P1CA 2R0VA 4BW3A 5LJ2A 5II1A 5FE8A 4A9EA 4NR8A 4QSTA 2F6NA 4TTEA 5E9YA 3GG3A 5FB0A 5DX4A 2D82A 5HJCA 3LXJA 5DW1A 4QYDA 5CUBA 3MB3A 5DFCA 4Z6IA 3Q2FA 4YH3A 3U5NA 5DY7A 5A82A 4YYDA 2YEMA 5A5QA 5ETBA 4XUBA 5EK9A 3UVDA 5CY9A 4MR5A 5C7NA 5FE2A 4IORA 4NS5A 5LKXA 5JWMA 3MUKA 5D3HA 4YBTA 5E74A 5EWCA 5EWDA 3U5LA 4IR5A 5FE7A 5KHMA 4LZSA 3O37A 5EP7A 3UV4A 4HXKA 3S92A 4TZ2A 4WHUA 4Q0NA 5D26A 3DWYA 4QSRA 5H1VA 5F60A 3S91A 3O33A 4RVRA 4QR3A 5CQ4A 5CUGA 4QR4A 5LJ0A 4YBMA 5A85A 3SVGA 2RNXA 2E7OA 4IOOA 2YW5A 5F25A 4YYIA 4PS5A 4A9LA 2DVQA 5CUEA 5JI8A 4X2IA 4N3WA 4NR9A 5LUUA 4WIVA 1WUMA 4O77A 4QY4A 5D3JA 5LVQA 5CRMA 5IGNA 4QSSA 4O78A 5DFBA 4J0SA 5CQ3A 5E7DA 4CFKA 4CLBA 2RO1A 5BT3A 4NR4A 5E9IA 5AD3A 4KV1A 5CUAA 4QEUA 5A5SA 5CRZA 5F62A 4LC2A 4LDFA 4MR3A 4QB3A 4HBYA 2L85A 4Q0OA 3JVKA 4QEWA 5CTLA 5I7XA 4Z93A 3AADA 5EA1A 4NR5A 3UVWA 2L84A 4CL9A 4LRGA 3LQIA 4HXRA 5DW2A 4QSXA 5C4QA 1F68A 5ENJA 4YYNA 4NYWA 5F2PA 5H85A 4Z6HA 4DONA 5HCLA 5EVAA 5D0CA 4UITA 2LSPB 5I83A 5C8GA 3G0LA 5LKTA 4A9OA 4NYXA 4BW2A 5D3LA 4MEQA 4QC1A 5L96A 5I7YA 5FH8A 4YATA 4UIXA 2DVRA 5FE3A 1WUGA 5A83A 4UYFB 4A9JA 4YYMA 5CGPA 5CQ7A 3UV5A 4NUDA 5HENA 5C87A 4TT4A 3HMFA 4ALHA 4GPJA 5I89A 2F6JA 5C85A 5LJ1A 5EV9A 1EQFA 5ENFA 4O76A 2OUOA 4A9NA 4QSPA 3SVFA 5H1TA 4LZRA 4ALGA 5F5ZA 3U5KA 2E3KA 5EPRA 5DYAA 4A9HA 2RI7A 5IBNA 4N4IA 5IG6A 5FG4A 3JVMA 4NRBA 2FSAA 4UYFA 3AQAA 4NRCA 5EGUA 5G4SA 4ZQLA 5IGKA 5FE5A 3JVLA 4Z1QA 4KCXA 4QSUA 5DLZA 5A5OA 3MQMA 4UYGA 4HXNA 4A9MA 5H1UA 5I86A 5EPSA 5DYCA 5DKDA 3HMHA 5J0DA 3O35A 5FFWA 5FE0A 5DKHA 2G4AA 2WP1A 4NR6A 5F1HA 5TB6A 4QUTA 4O74A 4QC3A 4XY8A 5HEMA 1JSPB 4LYWA 5EWWA 4O75A 5HQ6A 2OSSA 5ETDA 3IU5A 5D3PA 4NRAA 5I1QA 4O71A 5AMEA 5CPEA 3MB4A 4UIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FH7 A;  2D9E A;  3P1D A;  4UIW A;  4IR4 A;  2R10 A;  4LZ2 A;  5EWH A;  5A81 A;  2R0S A;  5I29 A;  5FB1 A;  2DAT A;  5ENH A;  4WHW A;  2GRC A;  5CUC A;  4CUS A;  5DLX A;  3SVH A;  2YDW A;  5DBM A;  5ENI A;  4CUR A;  4A9I A;  2DWW A;  5L98 A;  4TYL A;  5L97 A;  4NUC A;  4ZW1 A;  4MEP A;  4PTB A;  2RFJ A;  2L5E A;  3K2J A;  4PCI A;  4QSW A;  4NXJ A;  5DYX A;  2DVV A;  2YYN A;  4F3I A;  5HRW A;  5D24 A;  5ENB A;  4PCE A;  5CFW A;  4MEO A;  4QBM A;  4QYL A;  4YY4 A;  4QR5 A;  5DKC A;  5BT4 A;  4YK0 A;  5KO4 A;  4HBV A;  4HXM A;  4HXP A;  5CQ8 A;  5D3S A;  4TU4 A;  4Y03 A;  5F61 A;  4O7A A;  5D3R A;  4MEN A;  5LKU A;  2OO1 A;  5KU3 A;  2RS9 B;  2KTB B;  3UVY A;  5AMF A;  4CUP A;  5KTU A;  5I40 A;  5HQ7 A;  3P1E A;  5HQ5 A;  4O7F A;  5HRV A;  5KTX A;  4XUA A;  5CQA A;  5L8T A;  5COI A;  3U5P A;  2WP2 A;  4UYD A;  4BW1 A;  5EPB A;  5E0R A;  1ZS5 A;  5D3T A;  2E7N A;  4CUT A;  5II2 A;  4YBS A;  5F3A A;  5CZG A;  5FFV A;  4N4G A;  3U5M A;  5E9L A;  4YC9 A;  5E3D A;  3UVX A;  3O36 A;  2N9G A;  4KV4 A;  5DYU A;  4XY9 A;  5FDZ A;  3DAI A;  4OGJ A;  4J1P A;  4A9F A;  3ZYU A;  4QUU A;  4J3I A;  5E9M A;  3TLP A;  4YAB A;  3ONI A;  4IOQ A;  4LYI A;  5EWV A;  2RNW A;  4FLP A;  4QSV A;  4IR6 A;  3UW9 A;  2I7K A;  3U5J A;  5HEL A;  5C89 A;  4TT6 A;  4N4H A;  4TT2 A;  4HXO A;  3HME A;  5FFY A;  4O7B A;  4YAD A;  5HRX A;  4QNS A;  5L8U A;  4TU6 A;  5CQT A;  4CUQ A;  5FE6 A;  4O7C A;  4O7E A;  4OUF A;  4HXL A;  4TZ8 A;  5KTW A;  4UYH A;  4BHW A;  5F63 A;  5ENE A;  4NYV A;  4HXS A;  3Q2E A;  3JVJ A;  5F36 A;  3LJW A;  3D7C A;  5IGM A;  5EQ1 A;  2NXB A;  4QSQ A;  4YYJ A;  5ENG A;  5A7C A;  4MR4 A;  5CS8 A;  3O34 A;  4BW4 A;  1N72 A;  3FKM X;  4UIV A;  2R0Y A;  4CUU A;  5FG6 A;  5F1L A;  3QZT A;  5FH6 A;  5FE9 A;  4NQM A;  4MR6 A;  4ZC9 A;  5FE1 A;  5HFQ A;  1E6I A;  4YYH A;  5FE4 A;  1X0J A;  5IGL A;  5G4R A;  4C66 A;  3LQH A;  5A5R A;  5CQ5 A;  5EI4 A;  2YEK A;  5EIS A;  4HBX A;  5LKZ A;  3LQJ A;  5EU1 A;  4QZS A;  4LYS A;  4CFL A;  3G0J A;  4BJX A;  3MXF A;  4C67 A;  3RCW A;  5FG5 A;  5HM0 A;  2DVS A;  4J0R A;  4UIZ A;  5HFR A;  5CUD A;  5CP5 A;  2DKW A;  4UIU A;  2RNY A;  5HLS A;  4TS8 A;  5TCM A;  5ENC A;  3U5O A;  5CQ6 A;  3QZV A;  5IID A;  5E73 A;  4N4F A;  5L99 A;  3P1F A;  5A5N A;  3UV2 A;  2MJV B;  4E96 A;  4TQN A;  4YAX A;  4LR6 A;  3NXB A;  2YEL A;  4YYK A;  2YQD A;  5EM3 A;  4NUE A;  4AKN A;  5D25 A;  2I8N A;  5CU8 A;  3QZS A;  3IU6 A;  4HBW A;  4PKL A;  5E9K A;  5E9V A;  4NR7 A;  4A9K A;  4YYG A;  5I80 A;  1JM4 B;  4PY6 A;  5E3G A;  4O72 A;  4QEV A;  4O70 A;  5I88 A;  5EIC A;  4Z1S A;  4XYA A;  5LVR A;  4YY6 A;  5BT5 A;  5D7X A;  5D3N A;  5K29 A;  5DFD A;  4YH4 A;  4NQN A;  3I3J A;  5A5P A;  3MUL A;  3P5O A;  4OGI A;  5FBX A;  5AD2 A;  5ACY A;  4IR3 A;  2H60 A;  4UYE A;  3P1C A;  2R0V A;  4BW3 A;  5LJ2 A;  5II1 A;  5FE8 A;  4A9E A;  4NR8 A;  4QST A;  2F6N A;  4TTE A;  5E9Y A;  3GG3 A;  5FB0 A;  5DX4 A;  2D82 A;  5HJC A;  3LXJ A;  5DW1 A;  4QYD A;  5CUB A;  3MB3 A;  5DFC A;  4Z6I A;  3Q2F A;  4YH3 A;  3U5N A;  5DY7 A;  5A82 A;  4YYD A;  2YEM A;  5A5Q A;  5ETB A;  4XUB A;  5EK9 A;  3UVD A;  5CY9 A;  4MR5 A;  5C7N A;  5FE2 A;  4IOR A;  4NS5 A;  5LKX A;  5JWM A;  3MUK A;  5D3H A;  4YBT A;  5E74 A;  5EWC A;  5EWD A;  3U5L A;  4IR5 A;  5FE7 A;  5KHM A;  4LZS A;  3O37 A;  5EP7 A;  3UV4 A;  4HXK A;  3S92 A;  4TZ2 A;  4WHU A;  4Q0N A;  5D26 A;  3DWY A;  4QSR A;  5H1V A;  5F60 A;  3S91 A;  3O33 A;  4RVR A;  4QR3 A;  5CQ4 A;  5CUG A;  4QR4 A;  5LJ0 A;  4YBM A;  5A85 A;  3SVG A;  2RNX A;  2E7O A;  4IOO A;  2YW5 A;  5F25 A;  4YYI A;  4PS5 A;  4A9L A;  2DVQ A;  5CUE A;  5JI8 A;  4X2I A;  4N3W A;  4NR9 A;  5LUU A;  4WIV A;  1WUM A;  4O77 A;  4QY4 A;  5D3J A;  5LVQ A;  5CRM A;  5IGN A;  4QSS A;  4O78 A;  5DFB A;  4J0S A;  5CQ3 A;  5E7D A;  4CFK A;  4CLB A;  2RO1 A;  5BT3 A;  4NR4 A;  5E9I A;  5AD3 A;  4KV1 A;  5CUA A;  4QEU A;  5A5S A;  5CRZ A;  5F62 A;  4LC2 A;  4LDF A;  4MR3 A;  4QB3 A;  4HBY A;  2L85 A;  4Q0O A;  3JVK A;  4QEW A;  5CTL A;  5I7X A;  4Z93 A;  3AAD A;  5EA1 A;  4NR5 A;  3UVW A;  2L84 A;  4CL9 A;  4LRG A;  3LQI A;  4HXR A;  5DW2 A;  4QSX A;  5C4Q A;  1F68 A;  5ENJ A;  4YYN A;  4NYW A;  5F2P A;  5H85 A;  4Z6H A;  4DON A;  5HCL A;  5EVA A;  5D0C A;  4UIT A;  2LSP B;  5I83 A;  5C8G A;  3G0L A;  5LKT A;  4A9O A;  4NYX A;  4BW2 A;  5D3L A;  4MEQ A;  4QC1 A;  5L96 A;  5I7Y A;  5FH8 A;  4YAT A;  4UIX A;  2DVR A;  5FE3 A;  1WUG A;  5A83 A;  4UYF B;  4A9J A;  4YYM A;  5CGP A;  5CQ7 A;  3UV5 A;  4NUD A;  5HEN A;  5C87 A;  4TT4 A;  3HMF A;  4ALH A;  4GPJ A;  5I89 A;  2F6J A;  5C85 A;  5LJ1 A;  5EV9 A;  1EQF A;  5ENF A;  4O76 A;  2OUO A;  4A9N A;  4QSP A;  3SVF A;  5H1T A;  4LZR A;  4ALG A;  5F5Z A;  3U5K A;  2E3K A;  5EPR A;  5DYA A;  4A9H A;  2RI7 A;  5IBN A;  4N4I A;  5IG6 A;  5FG4 A;  3JVM A;  4NRB A;  2FSA A;  4UYF A;  3AQA A;  4NRC A;  5EGU A;  5G4S A;  4ZQL A;  5IGK A;  5FE5 A;  3JVL A;  4Z1Q A;  4KCX A;  4QSU A;  5DLZ A;  5A5O A;  3MQM A;  4UYG A;  4HXN A;  4A9M A;  5H1U A;  5I86 A;  5EPS A;  5DYC A;  5DKD A;  3HMH A;  5J0D A;  3O35 A;  5FFW A;  5FE0 A;  5DKH A;  2G4A A;  2WP1 A;  4NR6 A;  5F1H A;  5TB6 A;  4QUT A;  4O74 A;  4QC3 A;  4XY8 A;  5HEM A;  1JSP B;  4LYW A;  5EWW A;  4O75 A;  5HQ6 A;  2OSS A;  5ETD A;  3IU5 A;  5D3P A;  4NRA A;  5I1Q A;  4O71 A;  5AME A;  5CPE A;  3MB4 A;  4UIY A; 
#chains in the Genus database with same CATH topology
 5FH7 A;  2D9E A;  3P1D A;  4UIW A;  4IR4 A;  2R10 A;  4LZ2 A;  5EWH A;  5A81 A;  2R0S A;  5I29 A;  5FB1 A;  2DAT A;  5ENH A;  4WHW A;  2GRC A;  5CUC A;  4CUS A;  5DLX A;  3SVH A;  2YDW A;  5DBM A;  5ENI A;  4CUR A;  4A9I A;  2DWW A;  5L98 A;  4TYL A;  5L97 A;  4NUC A;  4ZW1 A;  4MEP A;  4PTB A;  2RFJ A;  2L5E A;  3K2J A;  4PCI A;  4QSW A;  4NXJ A;  5DYX A;  2DVV A;  2YYN A;  4F3I A;  5HRW A;  5D24 A;  5ENB A;  4PCE A;  5CFW A;  4MEO A;  4QBM A;  4QYL A;  4YY4 A;  4QR5 A;  5DKC A;  5BT4 A;  4YK0 A;  5KO4 A;  4HBV A;  4HXM A;  4HXP A;  5CQ8 A;  5D3S A;  4TU4 A;  4Y03 A;  5F61 A;  4O7A A;  5D3R A;  4MEN A;  5LKU A;  2OO1 A;  5KU3 A;  2RS9 B;  2KTB B;  3UVY A;  5AMF A;  4CUP A;  5KTU A;  5I40 A;  5HQ7 A;  3P1E A;  5HQ5 A;  4O7F A;  5HRV A;  5KTX A;  4XUA A;  5CQA A;  5L8T A;  5COI A;  3U5P A;  2WP2 A;  4UYD A;  4BW1 A;  5EPB A;  5E0R A;  1ZS5 A;  5D3T A;  2E7N A;  4CUT A;  5II2 A;  4YBS A;  5F3A A;  5CZG A;  5FFV A;  4N4G A;  3U5M A;  5E9L A;  4YC9 A;  5E3D A;  3UVX A;  3O36 A;  2N9G A;  4KV4 A;  5DYU A;  4XY9 A;  5FDZ A;  3DAI A;  4OGJ A;  4J1P A;  4A9F A;  3ZYU A;  4QUU A;  4J3I A;  5E9M A;  3TLP A;  4YAB A;  3ONI A;  4IOQ A;  4LYI A;  5EWV A;  2RNW A;  4FLP A;  4QSV A;  4IR6 A;  3UW9 A;  2I7K A;  3U5J A;  5HEL A;  5C89 A;  4TT6 A;  4N4H A;  4TT2 A;  4HXO A;  3HME A;  5FFY A;  4O7B A;  4YAD A;  5HRX A;  4QNS A;  5L8U A;  4TU6 A;  5CQT A;  4CUQ A;  5FE6 A;  4O7C A;  4O7E A;  4OUF A;  4HXL A;  4TZ8 A;  5KTW A;  4UYH A;  4BHW A;  5F63 A;  5ENE A;  4NYV A;  4HXS A;  3Q2E A;  3JVJ A;  5F36 A;  3LJW A;  3D7C A;  5IGM A;  5EQ1 A;  2NXB A;  4QSQ A;  4YYJ A;  5ENG A;  5A7C A;  4MR4 A;  5CS8 A;  3O34 A;  4BW4 A;  1N72 A;  3FKM X;  4UIV A;  2R0Y A;  4CUU A;  5FG6 A;  5F1L A;  3QZT A;  5FH6 A;  5FE9 A;  4NQM A;  4MR6 A;  4ZC9 A;  5FE1 A;  5HFQ A;  1E6I A;  4YYH A;  5FE4 A;  1X0J A;  5IGL A;  5G4R A;  4C66 A;  3LQH A;  5A5R A;  5CQ5 A;  5EI4 A;  2YEK A;  5EIS A;  4HBX A;  5LKZ A;  3LQJ A;  5EU1 A;  4QZS A;  4LYS A;  4CFL A;  3G0J A;  4BJX A;  3MXF A;  4C67 A;  3RCW A;  5FG5 A;  5HM0 A;  2DVS A;  4J0R A;  4UIZ A;  5HFR A;  5CUD A;  5CP5 A;  2DKW A;  4UIU A;  2RNY A;  5HLS A;  4TS8 A;  5TCM A;  5ENC A;  3U5O A;  5CQ6 A;  3QZV A;  5IID A;  5E73 A;  4N4F A;  5L99 A;  3P1F A;  5A5N A;  3UV2 A;  2MJV B;  4AKI A;  4E96 A;  4TQN A;  4YAX A;  4LR6 A;  3NXB A;  2YEL A;  4YYK A;  2YQD A;  5EM3 A;  4NUE A;  4AKN A;  5D25 A;  2I8N A;  5CU8 A;  3QZS A;  3IU6 A;  4HBW A;  4PKL A;  5E9K A;  5E9V A;  4NR7 A;  4A9K A;  4YYG A;  5I80 A;  1JM4 B;  4PY6 A;  5E3G A;  4O72 A;  4QEV A;  4O70 A;  5I88 A;  5EIC A;  4Z1S A;  2EJN A;  4XYA A;  5LVR A;  4YY6 A;  5BT5 A;  5D7X A;  5D3N A;  5K29 A;  5DFD A;  4YH4 A;  4NQN A;  3I3J A;  5A5P A;  3MUL A;  3P5O A;  4OGI A;  5FBX A;  5AD2 A;  5ACY A;  4IR3 A;  2H60 A;  4UYE A;  3P1C A;  2R0V A;  4BW3 A;  5LJ2 A;  5II1 A;  5FE8 A;  4A9E A;  4NR8 A;  4QST A;  2F6N A;  4TTE A;  5E9Y A;  3GG3 A;  3VKG A;  5FB0 A;  5DX4 A;  2D82 A;  5HJC A;  3LXJ A;  5DW1 A;  4QYD A;  5CUB A;  3MB3 A;  5DFC A;  4Z6I A;  3Q2F A;  4YH3 A;  3U5N A;  5DY7 A;  5A82 A;  4YYD A;  2YEM A;  5A5Q A;  5ETB A;  4XUB A;  5EK9 A;  3UVD A;  5CY9 A;  4MR5 A;  5C7N A;  5FE2 A;  4IOR A;  4NS5 A;  5LKX A;  5JWM A;  3MUK A;  5D3H A;  4YBT A;  5E74 A;  5EWC A;  5EWD A;  3U5L A;  4IR5 A;  5FE7 A;  5KHM A;  4LZS A;  3O37 A;  5EP7 A;  3UV4 A;  4HXK A;  3S92 A;  4TZ2 A;  4WHU A;  4Q0N A;  5D26 A;  3DWY A;  4QSR A;  5H1V A;  5F60 A;  3S91 A;  3O33 A;  4RVR A;  4QR3 A;  5CQ4 A;  5CUG A;  4QR4 A;  5LJ0 A;  4YBM A;  5A85 A;  3SVG A;  4AI6 A;  2RNX A;  2E7O A;  4IOO A;  2YW5 A;  5F25 A;  4YYI A;  4PS5 A;  4A9L A;  2DVQ A;  5CUE A;  5JI8 A;  4X2I A;  4N3W A;  4NR9 A;  5LUU A;  4WIV A;  1WUM A;  4O77 A;  4QY4 A;  5D3J A;  5LVQ A;  5CRM A;  5IGN A;  4QSS A;  4O78 A;  5DFB A;  4J0S A;  5CQ3 A;  5E7D A;  4CFK A;  4CLB A;  2RO1 A;  5BT3 A;  4NR4 A;  5E9I A;  5AD3 A;  4AKH A;  4KV1 A;  5CUA A;  4QEU A;  5A5S A;  5CRZ A;  5F62 A;  4LC2 A;  4LDF A;  4MR3 A;  4QB3 A;  4HBY A;  2L85 A;  4Q0O A;  3JVK A;  4QEW A;  5CTL A;  5I7X A;  4Z93 A;  3D1D A;  3AAD A;  5EA1 A;  4NR5 A;  3D1B A;  3UVW A;  2L84 A;  4CL9 A;  4LRG A;  3LQI A;  4HXR A;  5DW2 A;  4QSX A;  5C4Q A;  1F68 A;  5ENJ A;  4YYN A;  4NYW A;  5F2P A;  4AKG A;  5H85 A;  4Z6H A;  4DON A;  5HCL A;  5EVA A;  5D0C A;  4UIT A;  2LSP B;  5I83 A;  5C8G A;  3G0L A;  5LKT A;  4A9O A;  4NYX A;  1PUO A;  5D3L A;  4BW2 A;  4MEQ A;  4QC1 A;  5L96 A;  5I7Y A;  5FH8 A;  4YAT A;  4UIX A;  2DVR A;  3ERR A;  5FE3 A;  1WUG A;  5A83 A;  4UYF B;  4A9J A;  4YYM A;  5CGP A;  5CQ7 A;  3UV5 A;  4NUD A;  5HEN A;  5C87 A;  4TT4 A;  3HMF A;  4ALH A;  4GPJ A;  5I89 A;  2F6J A;  5C85 A;  5LJ1 A;  5EV9 A;  1EQF A;  5ENF A;  4O76 A;  2OUO A;  4A9N A;  4QSP A;  3SVF A;  5H1T A;  4LZR A;  4ALG A;  5F5Z A;  3U5K A;  2E3K A;  5EPR A;  5DYA A;  4A9H A;  2RI7 A;  5IBN A;  4N4I A;  5IG6 A;  5FG4 A;  3JVM A;  4NRB A;  2FSA A;  4UYF A;  3AQA A;  4NRC A;  5EGU A;  5G4S A;  4ZQL A;  5IGK A;  5FE5 A;  3JVL A;  4Z1Q A;  4KCX A;  4QSU A;  5DLZ A;  5A5O A;  3MQM A;  4UYG A;  4HXN A;  4A9M A;  3VKH A;  5H1U A;  5I86 A;  5EPS A;  5DYC A;  5DKD A;  1ZKR A;  3HMH A;  5J0D A;  3O35 A;  5FFW A;  5FE0 A;  5DKH A;  2G4A A;  2WP1 A;  4NR6 A;  5F1H A;  5TB6 A;  4QUT A;  4O74 A;  4QC3 A;  4XY8 A;  5HEM A;  1JSP B;  4LYW A;  5EWW A;  4O75 A;  5HQ6 A;  2OSS A;  5ETD A;  3IU5 A;  5D3P A;  4NRA A;  5I1Q A;  4O71 A;  5AME A;  5CPE A;  3MB4 A;  4UIY A; 
#chains in the Genus database with same CATH homology
 5FH7 A;  2D9E A;  3P1D A;  4UIW A;  4IR4 A;  2R10 A;  4LZ2 A;  5EWH A;  5A81 A;  2R0S A;  5I29 A;  5FB1 A;  2DAT A;  5ENH A;  4WHW A;  2GRC A;  5CUC A;  4CUS A;  5DLX A;  3SVH A;  2YDW A;  5DBM A;  5ENI A;  4CUR A;  4A9I A;  2DWW A;  5L98 A;  4TYL A;  5L97 A;  4NUC A;  4ZW1 A;  4MEP A;  4PTB A;  2RFJ A;  2L5E A;  3K2J A;  4PCI A;  4QSW A;  4NXJ A;  5DYX A;  2DVV A;  2YYN A;  4F3I A;  5HRW A;  5D24 A;  5ENB A;  4PCE A;  5CFW A;  4MEO A;  4QBM A;  4QYL A;  4YY4 A;  4QR5 A;  5DKC A;  5BT4 A;  4YK0 A;  5KO4 A;  4HBV A;  4HXM A;  4HXP A;  5CQ8 A;  5D3S A;  4TU4 A;  4Y03 A;  5F61 A;  4O7A A;  5D3R A;  4MEN A;  5LKU A;  2OO1 A;  5KU3 A;  2RS9 B;  2KTB B;  3UVY A;  5AMF A;  4CUP A;  5KTU A;  5I40 A;  5HQ7 A;  3P1E A;  5HQ5 A;  4O7F A;  5HRV A;  5KTX A;  4XUA A;  5CQA A;  5L8T A;  5COI A;  3U5P A;  2WP2 A;  4UYD A;  4BW1 A;  5EPB A;  5E0R A;  1ZS5 A;  5D3T A;  2E7N A;  4CUT A;  5II2 A;  4YBS A;  5F3A A;  5CZG A;  5FFV A;  4N4G A;  3U5M A;  5E9L A;  4YC9 A;  5E3D A;  3UVX A;  3O36 A;  2N9G A;  4KV4 A;  5DYU A;  4XY9 A;  5FDZ A;  3DAI A;  4OGJ A;  4J1P A;  4A9F A;  3ZYU A;  4QUU A;  4J3I A;  5E9M A;  3TLP A;  4YAB A;  3ONI A;  4IOQ A;  4LYI A;  5EWV A;  2RNW A;  4FLP A;  4QSV A;  4IR6 A;  3UW9 A;  2I7K A;  3U5J A;  5HEL A;  5C89 A;  4TT6 A;  4N4H A;  4TT2 A;  4HXO A;  3HME A;  5FFY A;  4O7B A;  4YAD A;  5HRX A;  4QNS A;  5L8U A;  4TU6 A;  5CQT A;  4CUQ A;  5FE6 A;  4O7C A;  4O7E A;  4OUF A;  4HXL A;  4TZ8 A;  5KTW A;  4UYH A;  4BHW A;  5F63 A;  5ENE A;  4NYV A;  4HXS A;  3Q2E A;  3JVJ A;  5F36 A;  3LJW A;  3D7C A;  5IGM A;  5EQ1 A;  2NXB A;  4QSQ A;  4YYJ A;  5ENG A;  5A7C A;  4MR4 A;  5CS8 A;  3O34 A;  4BW4 A;  1N72 A;  3FKM X;  4UIV A;  2R0Y A;  4CUU A;  5FG6 A;  5F1L A;  3QZT A;  5FH6 A;  5FE9 A;  4NQM A;  4MR6 A;  4ZC9 A;  5FE1 A;  5HFQ A;  1E6I A;  4YYH A;  5FE4 A;  1X0J A;  5IGL A;  5G4R A;  4C66 A;  3LQH A;  5A5R A;  5CQ5 A;  5EI4 A;  2YEK A;  5EIS A;  4HBX A;  5LKZ A;  3LQJ A;  5EU1 A;  4QZS A;  4LYS A;  4CFL A;  3G0J A;  4BJX A;  3MXF A;  4C67 A;  3RCW A;  5FG5 A;  5HM0 A;  2DVS A;  4J0R A;  4UIZ A;  5HFR A;  5CUD A;  5CP5 A;  2DKW A;  4UIU A;  2RNY A;  5HLS A;  4TS8 A;  5TCM A;  5ENC A;  3U5O A;  5CQ6 A;  3QZV A;  5IID A;  5E73 A;  4N4F A;  5L99 A;  3P1F A;  5A5N A;  3UV2 A;  2MJV B;  4E96 A;  4TQN A;  4YAX A;  4LR6 A;  3NXB A;  2YEL A;  4YYK A;  2YQD A;  5EM3 A;  4NUE A;  4AKN A;  5D25 A;  2I8N A;  5CU8 A;  3QZS A;  3IU6 A;  4HBW A;  4PKL A;  5E9K A;  5E9V A;  4NR7 A;  4A9K A;  4YYG A;  5I80 A;  1JM4 B;  4PY6 A;  5E3G A;  4O72 A;  4QEV A;  4O70 A;  5I88 A;  5EIC A;  4Z1S A;  4XYA A;  5LVR A;  4YY6 A;  5BT5 A;  5D7X A;  5D3N A;  5K29 A;  5DFD A;  4YH4 A;  4NQN A;  3I3J A;  5A5P A;  3MUL A;  3P5O A;  4OGI A;  5FBX A;  5AD2 A;  5ACY A;  4IR3 A;  2H60 A;  4UYE A;  3P1C A;  2R0V A;  4BW3 A;  5LJ2 A;  5II1 A;  5FE8 A;  4A9E A;  4NR8 A;  4QST A;  2F6N A;  4TTE A;  5E9Y A;  3GG3 A;  5FB0 A;  5DX4 A;  2D82 A;  5HJC A;  3LXJ A;  5DW1 A;  4QYD A;  5CUB A;  3MB3 A;  5DFC A;  4Z6I A;  3Q2F A;  4YH3 A;  3U5N A;  5DY7 A;  5A82 A;  4YYD A;  2YEM A;  5A5Q A;  5ETB A;  4XUB A;  5EK9 A;  3UVD A;  5CY9 A;  4MR5 A;  5C7N A;  5FE2 A;  4IOR A;  4NS5 A;  5LKX A;  5JWM A;  3MUK A;  5D3H A;  4YBT A;  5E74 A;  5EWC A;  5EWD A;  3U5L A;  4IR5 A;  5FE7 A;  5KHM A;  4LZS A;  3O37 A;  5EP7 A;  3UV4 A;  4HXK A;  3S92 A;  4TZ2 A;  4WHU A;  4Q0N A;  5D26 A;  3DWY A;  4QSR A;  5H1V A;  5F60 A;  3S91 A;  3O33 A;  4RVR A;  4QR3 A;  5CQ4 A;  5CUG A;  4QR4 A;  5LJ0 A;  4YBM A;  5A85 A;  3SVG A;  2RNX A;  2E7O A;  4IOO A;  2YW5 A;  5F25 A;  4YYI A;  4PS5 A;  4A9L A;  2DVQ A;  5CUE A;  5JI8 A;  4X2I A;  4N3W A;  4NR9 A;  5LUU A;  4WIV A;  1WUM A;  4O77 A;  4QY4 A;  5D3J A;  5LVQ A;  5CRM A;  5IGN A;  4QSS A;  4O78 A;  5DFB A;  4J0S A;  5CQ3 A;  5E7D A;  4CFK A;  4CLB A;  2RO1 A;  5BT3 A;  4NR4 A;  5E9I A;  5AD3 A;  4KV1 A;  5CUA A;  4QEU A;  5A5S A;  5CRZ A;  5F62 A;  4LC2 A;  4LDF A;  4MR3 A;  4QB3 A;  4HBY A;  2L85 A;  4Q0O A;  3JVK A;  4QEW A;  5CTL A;  5I7X A;  4Z93 A;  3AAD A;  5EA1 A;  4NR5 A;  3UVW A;  2L84 A;  4CL9 A;  4LRG A;  3LQI A;  4HXR A;  5DW2 A;  4QSX A;  5C4Q A;  1F68 A;  5ENJ A;  4YYN A;  4NYW A;  5F2P A;  5H85 A;  4Z6H A;  4DON A;  5HCL A;  5EVA A;  5D0C A;  4UIT A;  2LSP B;  5I83 A;  5C8G A;  3G0L A;  5LKT A;  4A9O A;  4NYX A;  4BW2 A;  5D3L A;  4MEQ A;  4QC1 A;  5L96 A;  5I7Y A;  5FH8 A;  4YAT A;  4UIX A;  2DVR A;  5FE3 A;  1WUG A;  5A83 A;  4UYF B;  4A9J A;  4YYM A;  5CGP A;  5CQ7 A;  3UV5 A;  4NUD A;  5HEN A;  5C87 A;  4TT4 A;  3HMF A;  4ALH A;  4GPJ A;  5I89 A;  2F6J A;  5C85 A;  5LJ1 A;  5EV9 A;  1EQF A;  5ENF A;  4O76 A;  2OUO A;  4A9N A;  4QSP A;  3SVF A;  5H1T A;  4LZR A;  4ALG A;  5F5Z A;  3U5K A;  2E3K A;  5EPR A;  5DYA A;  4A9H A;  2RI7 A;  5IBN A;  4N4I A;  5IG6 A;  5FG4 A;  3JVM A;  4NRB A;  2FSA A;  4UYF A;  3AQA A;  4NRC A;  5EGU A;  5G4S A;  4ZQL A;  5IGK A;  5FE5 A;  3JVL A;  4Z1Q A;  4KCX A;  4QSU A;  5DLZ A;  5A5O A;  3MQM A;  4UYG A;  4HXN A;  4A9M A;  5H1U A;  5I86 A;  5EPS A;  5DYC A;  5DKD A;  3HMH A;  5J0D A;  3O35 A;  5FFW A;  5FE0 A;  5DKH A;  2G4A A;  2WP1 A;  4NR6 A;  5F1H A;  5TB6 A;  4QUT A;  4O74 A;  4QC3 A;  4XY8 A;  5HEM A;  1JSP B;  4LYW A;  5EWW A;  4O75 A;  5HQ6 A;  2OSS A;  5ETD A;  3IU5 A;  5D3P A;  4NRA A;  5I1Q A;  4O71 A;  5AME A;  5CPE A;  3MB4 A;  4UIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...