2E7NA

Solution structure of the second bromodomain from human bromodomain-containing protein 3
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
GSSGSSGGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Bromodomain-containing protein 3
publication title Solution structure of the second Bromodomain from human Bromodomain-containing protein 3
rcsb
source organism Homo sapiens
total genus 28
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2e7nA00
5HJCA 2D82A 4CURA 2YEMA 4HXLA 4UYFB 5I40A 2N9GA 4NYXA 5TCMA 5IGNA 5FFWA 4UITA 5II2A 4PTBA 5A5PA 5DKDA 4O7AA 4PCIA 4NYWA 4UYFA 5L96A 4UIUA 5F5ZA 3SVGA 4NR8A 5KTUA 4CFKA 4NR6A 2D9EA 4QEWA 4IORA 4N4GA 4BJXA 4CLBA 4PY6A 4O77A 4YYJA 5HLSA 4BHWA 5I88A 4QEUA 5FE0A 5FH7A 3GG3A 5EPRA 4QC3A 5CUDA 5EV9A 5ETDA 4Z6IA 4QSSA 5HCLA 5D3LA 4MR5A 4HXPA 5ENCA 4A9FA 4A9NA 5IGKA 5D3TA 3G0JA 5LVRA 3P5OA 5FB0A 5AD2A 4N3WA 5F1LA 4YYGA 4O7FA 2L84A 4QSRA 5EU1A 2RNXA 5ACYA 5CRMA 3P1EA 4YK0A 5L8UA 4O72A 2R10A 4J0SA 4LZ2A 5H1UA 4YC9A 4N4IA 4J0RA 3I3JA 4YADA 5FH6A 5HQ5A 5CRZA 3SVHA 4NRBA 5HM0A 1ZS5A 4LYSA 3Q2EA 2R0SA 4NUEA 4UIZA 5LJ1A 5F36A 5E9VA 3HMFA 5EK9A 3P1FA 5LKXA 4XUBA 4C67A 4YH3A 4Q0OA 5E9LA 5ENIA 1WUMA 5HEMA 4QSVA 5CQTA 4MR3A 3AADA 5AMEA 5CUCA 4LZRA 4QEVA 5D24A 4QYLA 4NRAA 4BW2A 5ENHA 5A83A 5A5NA 3P1DA 3QZSA 5EWWA 3D7CA 5I7XA 3U5NA 4YYDA 3K2JA 4A9HA 4QSXA 5DY7A 4KCXA 3UVXA 5LKTA 5C7NA 5ENJA 5CQ3A 4YABA 2RNYA 4IOQA 5ENBA 4TU4A 4O7BA 4LDFA 5D26A 5F61A 5FG4A 4QSQA 4WHWA 4X2IA 3LJWA 4NQNA 2MJVB 4UYHA 5CS8A 4MEOA 3HMEA 3DWYA 5LVQA 5JWMA 2NXBA 3LQHA 4NRCA 5CQ4A 4O7CA 5EISA 5FE1A 2OUOA 2YW5A 5F3AA 3ZYUA 4QNSA 3MQMA 5FE7A 3O33A 4Z1SA 4IR5A 5E9IA 5A85A 5C8GA 5A5RA 5I7YA 4YYKA 4KV4A 4YBTA 5DYXA 2DKWA 4A9LA 2WP2A 4F3IA 3HMHA 2DVQA 4LR6A 4ZC9A 5HENA 4CUTA 5FE8A 3Q2FA 5ENGA 4YY6A 4PKLA 5F1HA 4CUQA 5DFBA 3UV2A 5L8TA 4NXJA 5E9KA 4LYWA 5C89A 2E7OA 2YYNA 4MENA 4QR3A 5FE6A 4LRGA 3QZVA 4OGIA 5EP7A 4BW1A 4HXOA 4NUCA 4TT4A 3IU5A 2R0VA 4GPJA 3O34A 4N4HA 4XUAA 2DVRA 5HRVA 4TTEA 4N4FA 3RCWA 5I83A 5F25A 5I29A 2KTBB 3LQIA 5DW2A 3UVWA 5I86A 3U5MA 3JVJA 4TYLA 4YAXA 3O35A 4YBMA 4HBYA 4QSPA 4PCEA 2YDWA 4QSUA 5LUUA 2DATA 4MR4A 3UV5A 5LKUA 5FE2A 4NR5A 5A81A 4E96A 2RFJA 5F63A 5HFRA 2I7KA 4UIXA 4WHUA 2RI7A 2F6JA 4LC2A 5CQ6A 4ZQLA 4NUDA 3ONIA 1X0JA 5ENFA 4HXNA 5FH8A 4HXSA 4YYMA 5FFVA 4HBVA 3O37A 4TT6A 5CUEA 5FE4A 5A5SA 5H1VA 2GRCA 5EI4A 5IIDA 2I8NA 3UW9A 3JVLA 5DYUA 5E73A 3MB4A 4BW3A 5FFYA 5DKCA 4CUPA 4QBMA 5E3DA 5D3SA 5AD3A 2YELA 4MEQA 4TU6A 5EPSA 5EWHA 4UIWA 5A82A 5CTLA 4YH4A 5A5OA 5E0RA 3DAIA 2WP1A 5DFDA 4CUSA 3MB3A 5CQAA 5C4QA 5HQ6A 4QYDA 4Y03A 5CFWA 5E7DA 3QZTA 4XY9A 5E9MA 5TB6A 5DBMA 4DONA 3MUKA 5EWCA 4PS5A 4QR5A 5CUGA 5EVAA 2RO1A 5E74A 4MR6A 4Z1QA 5D3JA 5F60A 3IU6A 5ENEA 2E7NA 3S91A 4A9MA 3AQAA 5KU3A 4QR4A 5C87A 5FE9A 5FG5A 5AMFA 5IGMA 4TZ8A 4A9OA 2H60A 4CUUA 2RNWA 4IR6A 5CQ5A 1JSPB 2LSPB 5D3PA 4O71A 5IGLA 5HELA 2F6NA 5L99A 4QB3A 5G4SA 5DYCA 5CQ8A 5J0DA 5K29A 5EM3A 4TQNA 4CFLA 5CZGA 2YQDA 5ETBA 3S92A 5H1TA 5D3RA 4MEPA 5II1A 5KTXA 5LJ2A 5E9YA 4Q0NA 4UYEA 4YYIA 5CPEA 5EWDA 4C66A 4XY8A 4A9IA 4UYDA 4NS5A 4HXRA 4Z6HA 4ALGA 4CL9A 5FE3A 4LZSA 3UV4A 5D7XA 5LKZA 4O70A 5JI8A 5FBXA 5F2PA 3G0LA 3SVFA 4UIVA 4A9EA 5I89A 5KHMA 5CQ7A 4BW4A 4IOOA 5EWVA 3MXFA 4LYIA 5L97A 3LQJA 4O75A 4FLPA 2E3KA 4O74A 2YEKA 5D3HA 1E6IA 5E3GA 4O7EA 5DKHA 4UYGA 5FG6A 3NXBA 5DFCA 5D25A 4NR9A 4NR7A 4TZ2A 5EICA 4ZW1A 4YY4A 5HRXA 5KTWA 4XYAA 4QY4A 4NYVA 5DLZA 5I1QA 3MULA 5DW1A 4QC1A 3U5LA 4QSTA 2L85A 4O78A 3JVKA 4OGJA 1N72A 5COIA 5L98A 4YBSA 5EPBA 4YATA 5G4RA 5A5QA 4A9JA 4WIVA 5BT5A 4QUUA 4HXMA 4HBWA 5CGPA 5DX4A 4HXKA 3U5JA 5EGUA 1WUGA 5CU8A 4KV1A 5DYAA 1JM4B 4QZSA 4RVRA 5D0CA 2DVSA 2DVVA 4YYNA 4J1PA 4OUFA 5H85A 4A9KA 5HRWA 4NQMA 4HBXA 4QUTA 2RS9B 3TLPA 5A7CA 5DLXA 2OSSA 4NR4A 4QSWA 4IR4A 5CY9A 3U5OA 5CUBA 3P1CA 4TT2A 5IG6A 1EQFA 3O36A 4AKNA 5FB1A 3UVYA 4TS8A 5BT3A 2G4AA 5EQ1A 5I80A 1F68A 5CUAA 2OO1A 3UVDA 4J3IA 3FKMX 2L5EA 5BT4A 3U5PA 3JVMA 5LJ0A 5KO4A 2R0YA 4O76A 4UIYA 5HFQA 5D3NA 4YYHA 5C85A 4IR3A 3U5KA 2DWWA 5IBNA 5F62A 5EA1A 5CP5A 5FE5A 2FSAA 5FDZA 4ALHA 3LXJA 4Z93A 5HQ7A
chains in the Genus database with same CATH superfamily
5HJCA 2D82A 4CURA 2YEMA 4HXLA 4UYFB 5I40A 2N9GA 4NYXA 5TCMA 3VKHA 5IGNA 5FFWA 4UITA 5II2A 4PTBA 5A5PA 5DKDA 4O7AA 4PCIA 4NYWA 4UYFA 5L96A 4UIUA 5F5ZA 3SVGA 4NR8A 5KTUA 4CFKA 4NR6A 2D9EA 4QEWA 4IORA 4N4GA 4BJXA 4CLBA 4PY6A 4O77A 4YYJA 5HLSA 4BHWA 5I88A 4QEUA 5FE0A 3ERRA 5FH7A 3GG3A 5EPRA 4QC3A 5CUDA 5EV9A 5ETDA 4Z6IA 4QSSA 5HCLA 5D3LA 4MR5A 4HXPA 5ENCA 4A9FA 4A9NA 5IGKA 5D3TA 3G0JA 5LVRA 3P5OA 5FB0A 5AD2A 4N3WA 5F1LA 4YYGA 4O7FA 2L84A 4QSRA 5EU1A 2RNXA 5ACYA 5CRMA 3P1EA 4YK0A 5L8UA 4O72A 2R10A 4J0SA 4LZ2A 5H1UA 4YC9A 4N4IA 4J0RA 3I3JA 4YADA 5FH6A 5HQ5A 5CRZA 3SVHA 4NRBA 5HM0A 1ZS5A 4LYSA 3Q2EA 2R0SA 4NUEA 1ZKRA 4UIZA 5LJ1A 5F36A 5E9VA 3HMFA 5EK9A 3P1FA 5LKXA 4XUBA 4C67A 4YH3A 4AKIA 4Q0OA 5E9LA 5ENIA 1WUMA 5HEMA 4QSVA 5CQTA 4MR3A 3AADA 5AMEA 5CUCA 4LZRA 4QEVA 5D24A 4QYLA 4NRAA 4BW2A 5ENHA 5A83A 5A5NA 3P1DA 3QZSA 5EWWA 3D7CA 5I7XA 3U5NA 4YYDA 3K2JA 4A9HA 4QSXA 5DY7A 4AI6A 4KCXA 3UVXA 5LKTA 5C7NA 5ENJA 5CQ3A 4YABA 2RNYA 4IOQA 5ENBA 4TU4A 4O7BA 4LDFA 5D26A 5F61A 5FG4A 4QSQA 4WHWA 4X2IA 3LJWA 4NQNA 2MJVB 4UYHA 5CS8A 4MEOA 3HMEA 3DWYA 5LVQA 5JWMA 2NXBA 3LQHA 4NRCA 5CQ4A 4O7CA 5EISA 5FE1A 2OUOA 2YW5A 5F3AA 3ZYUA 4QNSA 3MQMA 5FE7A 3O33A 4Z1SA 4IR5A 5E9IA 5A85A 5C8GA 5A5RA 5I7YA 4YYKA 4KV4A 4YBTA 5DYXA 2DKWA 4A9LA 2WP2A 4F3IA 3HMHA 2DVQA 4LR6A 4ZC9A 5HENA 4CUTA 5FE8A 3Q2FA 5ENGA 4YY6A 4PKLA 5F1HA 4CUQA 5DFBA 3D1BA 3UV2A 5L8TA 4NXJA 5E9KA 4LYWA 5C89A 2E7OA 2YYNA 4MENA 4QR3A 5FE6A 4LRGA 3QZVA 4OGIA 5EP7A 4BW1A 4HXOA 4NUCA 4TT4A 3IU5A 2R0VA 4GPJA 3O34A 4N4HA 4XUAA 2DVRA 5HRVA 4TTEA 4N4FA 3RCWA 5I83A 5F25A 5I29A 2KTBB 3LQIA 5DW2A 3UVWA 5I86A 3U5MA 3JVJA 4TYLA 4YAXA 3O35A 4YBMA 4HBYA 3D1DA 4QSPA 4PCEA 2YDWA 4QSUA 5LUUA 2DATA 4MR4A 3UV5A 5LKUA 5FE2A 4NR5A 5A81A 4E96A 2RFJA 5F63A 5HFRA 2I7KA 4UIXA 4WHUA 2RI7A 2F6JA 4LC2A 5CQ6A 4ZQLA 4NUDA 3ONIA 1X0JA 5ENFA 4HXNA 5FH8A 4HXSA 4YYMA 5FFVA 4HBVA 3O37A 4TT6A 5CUEA 5FE4A 5A5SA 5H1VA 2GRCA 5EI4A 5IIDA 2I8NA 3UW9A 3JVLA 5DYUA 5E73A 3MB4A 4BW3A 5FFYA 5DKCA 4CUPA 4QBMA 5E3DA 5D3SA 5AD3A 2YELA 4MEQA 4TU6A 5EPSA 5EWHA 4UIWA 5A82A 5CTLA 4YH4A 2EJNA 5A5OA 5E0RA 3DAIA 4AKGA 2WP1A 5DFDA 4CUSA 3MB3A 5CQAA 5C4QA 5HQ6A 4QYDA 4Y03A 5CFWA 5E7DA 3QZTA 4XY9A 5E9MA 5TB6A 5DBMA 4DONA 3MUKA 5EWCA 4PS5A 4QR5A 5CUGA 5EVAA 2RO1A 5E74A 4MR6A 4Z1QA 5D3JA 5F60A 3IU6A 5ENEA 2E7NA 3S91A 4A9MA 3AQAA 5KU3A 4QR4A 5C87A 5FE9A 5FG5A 5AMFA 5IGMA 4TZ8A 4A9OA 2H60A 4CUUA 2RNWA 4IR6A 5CQ5A 1JSPB 2LSPB 5D3PA 4O71A 5IGLA 5HELA 2F6NA 5L99A 4QB3A 5G4SA 5DYCA 5CQ8A 5J0DA 5K29A 5EM3A 4TQNA 4CFLA 5CZGA 2YQDA 5ETBA 3S92A 5H1TA 5D3RA 4MEPA 5II1A 5KTXA 5LJ2A 5E9YA 4Q0NA 4UYEA 4YYIA 5CPEA 5EWDA 4C66A 4XY8A 4A9IA 4UYDA 4NS5A 4HXRA 4Z6HA 4ALGA 4CL9A 5FE3A 4LZSA 3UV4A 5D7XA 5LKZA 4O70A 5JI8A 5FBXA 5F2PA 3G0LA 3SVFA 4UIVA 4A9EA 5I89A 5KHMA 5CQ7A 4BW4A 4IOOA 5EWVA 3MXFA 4LYIA 5L97A 3LQJA 4O75A 4FLPA 2E3KA 4O74A 2YEKA 5D3HA 1E6IA 5E3GA 4O7EA 5DKHA 4UYGA 5FG6A 3NXBA 5DFCA 5D25A 4NR9A 4NR7A 4TZ2A 5EICA 4ZW1A 4YY4A 5HRXA 5KTWA 4XYAA 4QY4A 4NYVA 5DLZA 5I1QA 3MULA 5DW1A 4AKHA 4QC1A 3U5LA 4QSTA 2L85A 4O78A 3JVKA 4OGJA 1N72A 5COIA 5L98A 4YBSA 5EPBA 4YATA 5G4RA 5A5QA 4A9JA 4WIVA 5BT5A 4QUUA 4HXMA 4HBWA 5CGPA 5DX4A 4HXKA 3U5JA 5EGUA 3VKGA 1WUGA 5CU8A 4KV1A 5DYAA 1JM4B 4QZSA 4RVRA 5D0CA 2DVSA 2DVVA 4YYNA 4J1PA 4OUFA 5H85A 4A9KA 5HRWA 4NQMA 4HBXA 4QUTA 2RS9B 3TLPA 5A7CA 5DLXA 2OSSA 4NR4A 4QSWA 4IR4A 5CY9A 3U5OA 5CUBA 3P1CA 4TT2A 5IG6A 1EQFA 3O36A 4AKNA 5FB1A 3UVYA 4TS8A 5BT3A 2G4AA 5EQ1A 5I80A 1F68A 5CUAA 2OO1A 3UVDA 4J3IA 3FKMX 2L5EA 5BT4A 3U5PA 3JVMA 5LJ0A 5KO4A 2R0YA 4O76A 4UIYA 5HFQA 5D3NA 4YYHA 5C85A 4IR3A 3U5KA 2DWWA 5IBNA 1PUOA 5EA1A 5F62A 5CP5A 5FE5A 2FSAA 5FDZA 4ALHA 3LXJA 4Z93A 5HQ7A
chains in the Genus database with same CATH topology
5HJCA 2D82A 4CURA 2YEMA 4HXLA 4UYFB 5I40A 2N9GA 4NYXA 5TCMA 5IGNA 5FFWA 4UITA 5II2A 4PTBA 5A5PA 5DKDA 4O7AA 4PCIA 4NYWA 4UYFA 5L96A 4UIUA 5F5ZA 3SVGA 4NR8A 5KTUA 4CFKA 4NR6A 2D9EA 4QEWA 4IORA 4N4GA 4BJXA 4CLBA 4PY6A 4O77A 4YYJA 5HLSA 4BHWA 5I88A 4QEUA 5FE0A 5FH7A 3GG3A 5EPRA 4QC3A 5CUDA 5EV9A 5ETDA 4Z6IA 4QSSA 5HCLA 5D3LA 4MR5A 4HXPA 5ENCA 4A9FA 4A9NA 5IGKA 5D3TA 3G0JA 5LVRA 3P5OA 5FB0A 5AD2A 4N3WA 5F1LA 4YYGA 4O7FA 2L84A 4QSRA 5EU1A 2RNXA 5ACYA 5CRMA 3P1EA 4YK0A 5L8UA 4O72A 2R10A 4J0SA 4LZ2A 5H1UA 4YC9A 4N4IA 4J0RA 3I3JA 4YADA 5FH6A 5HQ5A 5CRZA 3SVHA 4NRBA 5HM0A 1ZS5A 4LYSA 3Q2EA 2R0SA 4NUEA 4UIZA 5LJ1A 5F36A 5E9VA 3HMFA 5EK9A 3P1FA 5LKXA 4XUBA 4C67A 4YH3A 4Q0OA 5E9LA 5ENIA 1WUMA 5HEMA 4QSVA 5CQTA 4MR3A 3AADA 5AMEA 5CUCA 4LZRA 4QEVA 5D24A 4QYLA 4NRAA 4BW2A 5ENHA 5A83A 5A5NA 3P1DA 3QZSA 5EWWA 3D7CA 5I7XA 3U5NA 4YYDA 3K2JA 4A9HA 4QSXA 5DY7A 4KCXA 3UVXA 5LKTA 5C7NA 5ENJA 5CQ3A 4YABA 2RNYA 4IOQA 5ENBA 4TU4A 4O7BA 4LDFA 5D26A 5F61A 5FG4A 4QSQA 4WHWA 4X2IA 3LJWA 4NQNA 2MJVB 4UYHA 5CS8A 4MEOA 3HMEA 3DWYA 5LVQA 5JWMA 2NXBA 3LQHA 4NRCA 5CQ4A 4O7CA 5EISA 5FE1A 2OUOA 2YW5A 5F3AA 3ZYUA 4QNSA 3MQMA 5FE7A 3O33A 4Z1SA 4IR5A 5E9IA 5A85A 5C8GA 5A5RA 5I7YA 4YYKA 4KV4A 4YBTA 5DYXA 2DKWA 4A9LA 2WP2A 4F3IA 3HMHA 2DVQA 4LR6A 4ZC9A 5HENA 4CUTA 5FE8A 3Q2FA 5ENGA 4YY6A 4PKLA 5F1HA 4CUQA 5DFBA 3UV2A 5L8TA 4NXJA 5E9KA 4LYWA 5C89A 2E7OA 2YYNA 4MENA 4QR3A 5FE6A 4LRGA 3QZVA 4OGIA 5EP7A 4BW1A 4HXOA 4NUCA 4TT4A 3IU5A 2R0VA 4GPJA 3O34A 4N4HA 4XUAA 2DVRA 5HRVA 4TTEA 4N4FA 3RCWA 5I83A 5F25A 5I29A 2KTBB 3LQIA 5DW2A 3UVWA 5I86A 3U5MA 3JVJA 4TYLA 4YAXA 3O35A 4YBMA 4HBYA 4QSPA 4PCEA 2YDWA 4QSUA 5LUUA 2DATA 4MR4A 3UV5A 5LKUA 5FE2A 4NR5A 5A81A 4E96A 2RFJA 5F63A 5HFRA 2I7KA 4UIXA 4WHUA 2RI7A 2F6JA 4LC2A 5CQ6A 4ZQLA 4NUDA 3ONIA 1X0JA 5ENFA 4HXNA 5FH8A 4HXSA 4YYMA 5FFVA 4HBVA 3O37A 4TT6A 5CUEA 5FE4A 5A5SA 5H1VA 2GRCA 5EI4A 5IIDA 2I8NA 3UW9A 3JVLA 5DYUA 5E73A 3MB4A 4BW3A 5FFYA 5DKCA 4CUPA 4QBMA 5E3DA 5D3SA 5AD3A 2YELA 4MEQA 4TU6A 5EPSA 5EWHA 4UIWA 5A82A 5CTLA 4YH4A 5A5OA 5E0RA 3DAIA 2WP1A 5DFDA 4CUSA 3MB3A 5CQAA 5C4QA 5HQ6A 4QYDA 4Y03A 5CFWA 5E7DA 3QZTA 4XY9A 5E9MA 5TB6A 5DBMA 4DONA 3MUKA 5EWCA 4PS5A 4QR5A 5CUGA 5EVAA 2RO1A 5E74A 4MR6A 4Z1QA 5D3JA 5F60A 3IU6A 5ENEA 2E7NA 3S91A 4A9MA 3AQAA 5KU3A 4QR4A 5C87A 5FE9A 5FG5A 5AMFA 5IGMA 4TZ8A 4A9OA 2H60A 4CUUA 2RNWA 4IR6A 5CQ5A 1JSPB 2LSPB 5D3PA 4O71A 5IGLA 5HELA 2F6NA 5L99A 4QB3A 5G4SA 5DYCA 5CQ8A 5J0DA 5K29A 5EM3A 4TQNA 4CFLA 5CZGA 2YQDA 5ETBA 3S92A 5H1TA 5D3RA 4MEPA 5II1A 5KTXA 5LJ2A 5E9YA 4Q0NA 4UYEA 4YYIA 5CPEA 5EWDA 4C66A 4XY8A 4A9IA 4UYDA 4NS5A 4HXRA 4Z6HA 4ALGA 4CL9A 5FE3A 4LZSA 3UV4A 5D7XA 5LKZA 4O70A 5JI8A 5FBXA 5F2PA 3G0LA 3SVFA 4UIVA 4A9EA 5I89A 5KHMA 5CQ7A 4BW4A 4IOOA 5EWVA 3MXFA 4LYIA 5L97A 3LQJA 4O75A 4FLPA 2E3KA 4O74A 2YEKA 5D3HA 1E6IA 5E3GA 4O7EA 5DKHA 4UYGA 5FG6A 3NXBA 5DFCA 5D25A 4NR9A 4NR7A 4TZ2A 5EICA 4ZW1A 4YY4A 5HRXA 5KTWA 4XYAA 4QY4A 4NYVA 5DLZA 5I1QA 3MULA 5DW1A 4QC1A 3U5LA 4QSTA 2L85A 4O78A 3JVKA 4OGJA 1N72A 5COIA 5L98A 4YBSA 5EPBA 4YATA 5G4RA 5A5QA 4A9JA 4WIVA 5BT5A 4QUUA 4HXMA 4HBWA 5CGPA 5DX4A 4HXKA 3U5JA 5EGUA 1WUGA 5CU8A 4KV1A 5DYAA 1JM4B 4QZSA 4RVRA 5D0CA 2DVSA 2DVVA 4YYNA 4J1PA 4OUFA 5H85A 4A9KA 5HRWA 4NQMA 4HBXA 4QUTA 2RS9B 3TLPA 5A7CA 5DLXA 2OSSA 4NR4A 4QSWA 4IR4A 5CY9A 3U5OA 5CUBA 3P1CA 4TT2A 5IG6A 1EQFA 3O36A 4AKNA 5FB1A 3UVYA 4TS8A 5BT3A 2G4AA 5EQ1A 5I80A 1F68A 5CUAA 2OO1A 3UVDA 4J3IA 3FKMX 2L5EA 5BT4A 3U5PA 3JVMA 5LJ0A 5KO4A 2R0YA 4O76A 4UIYA 5HFQA 5D3NA 4YYHA 5C85A 4IR3A 3U5KA 2DWWA 5IBNA 5F62A 5EA1A 5CP5A 5FE5A 2FSAA 5FDZA 4ALHA 3LXJA 4Z93A 5HQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HJC A;  2D82 A;  4CUR A;  2YEM A;  4HXL A;  4UYF B;  5I40 A;  2N9G A;  4NYX A;  5TCM A;  5IGN A;  5FFW A;  4UIT A;  5II2 A;  4PTB A;  5A5P A;  5DKD A;  4O7A A;  4PCI A;  4NYW A;  4UYF A;  5L96 A;  4UIU A;  5F5Z A;  3SVG A;  4NR8 A;  5KTU A;  4CFK A;  4NR6 A;  2D9E A;  4QEW A;  4IOR A;  4N4G A;  4BJX A;  4CLB A;  4PY6 A;  4O77 A;  4YYJ A;  5HLS A;  4BHW A;  5I88 A;  4QEU A;  5FE0 A;  5FH7 A;  3GG3 A;  5EPR A;  4QC3 A;  5CUD A;  5EV9 A;  5ETD A;  4Z6I A;  4QSS A;  5HCL A;  5D3L A;  4MR5 A;  4HXP A;  5ENC A;  4A9F A;  4A9N A;  5IGK A;  5D3T A;  3G0J A;  5LVR A;  3P5O A;  5FB0 A;  5AD2 A;  4N3W A;  5F1L A;  4YYG A;  4O7F A;  2L84 A;  4QSR A;  5EU1 A;  2RNX A;  5ACY A;  5CRM A;  3P1E A;  4YK0 A;  5L8U A;  4O72 A;  2R10 A;  4J0S A;  4LZ2 A;  5H1U A;  4YC9 A;  4N4I A;  4J0R A;  3I3J A;  4YAD A;  5FH6 A;  5HQ5 A;  5CRZ A;  3SVH A;  4NRB A;  5HM0 A;  1ZS5 A;  4LYS A;  3Q2E A;  2R0S A;  4NUE A;  4UIZ A;  5LJ1 A;  5F36 A;  5E9V A;  3HMF A;  5EK9 A;  3P1F A;  5LKX A;  4XUB A;  4C67 A;  4YH3 A;  4Q0O A;  5E9L A;  5ENI A;  1WUM A;  5HEM A;  4QSV A;  5CQT A;  4MR3 A;  3AAD A;  5AME A;  5CUC A;  4LZR A;  4QEV A;  5D24 A;  4QYL A;  4NRA A;  4BW2 A;  5ENH A;  5A83 A;  5A5N A;  3P1D A;  3QZS A;  5EWW A;  3D7C A;  5I7X A;  3U5N A;  4YYD A;  3K2J A;  4A9H A;  4QSX A;  5DY7 A;  4KCX A;  3UVX A;  5LKT A;  5C7N A;  5ENJ A;  5CQ3 A;  4YAB A;  2RNY A;  4IOQ A;  5ENB A;  4TU4 A;  4O7B A;  4LDF A;  5D26 A;  5F61 A;  5FG4 A;  4QSQ A;  4WHW A;  4X2I A;  3LJW A;  4NQN A;  2MJV B;  4UYH A;  5CS8 A;  4MEO A;  3HME A;  3DWY A;  5LVQ A;  5JWM A;  2NXB A;  3LQH A;  4NRC A;  5CQ4 A;  4O7C A;  5EIS A;  5FE1 A;  2OUO A;  2YW5 A;  5F3A A;  3ZYU A;  4QNS A;  3MQM A;  5FE7 A;  3O33 A;  4Z1S A;  4IR5 A;  5E9I A;  5A85 A;  5C8G A;  5A5R A;  5I7Y A;  4YYK A;  4KV4 A;  4YBT A;  5DYX A;  2DKW A;  4A9L A;  2WP2 A;  4F3I A;  3HMH A;  2DVQ A;  4LR6 A;  4ZC9 A;  5HEN A;  4CUT A;  5FE8 A;  3Q2F A;  5ENG A;  4YY6 A;  4PKL A;  5F1H A;  4CUQ A;  5DFB A;  3UV2 A;  5L8T A;  4NXJ A;  5E9K A;  4LYW A;  5C89 A;  2E7O A;  2YYN A;  4MEN A;  4QR3 A;  5FE6 A;  4LRG A;  3QZV A;  4OGI A;  5EP7 A;  4BW1 A;  4HXO A;  4NUC A;  4TT4 A;  3IU5 A;  2R0V A;  4GPJ A;  3O34 A;  4N4H A;  4XUA A;  2DVR A;  5HRV A;  4TTE A;  4N4F A;  3RCW A;  5I83 A;  5F25 A;  5I29 A;  2KTB B;  3LQI A;  5DW2 A;  3UVW A;  5I86 A;  3U5M A;  3JVJ A;  4TYL A;  4YAX A;  3O35 A;  4YBM A;  4HBY A;  4QSP A;  4PCE A;  2YDW A;  4QSU A;  5LUU A;  2DAT A;  4MR4 A;  3UV5 A;  5LKU A;  5FE2 A;  4NR5 A;  5A81 A;  4E96 A;  2RFJ A;  5F63 A;  5HFR A;  2I7K A;  4UIX A;  4WHU A;  2RI7 A;  2F6J A;  4LC2 A;  5CQ6 A;  4ZQL A;  4NUD A;  3ONI A;  1X0J A;  5ENF A;  4HXN A;  5FH8 A;  4HXS A;  4YYM A;  5FFV A;  4HBV A;  3O37 A;  4TT6 A;  5CUE A;  5FE4 A;  5A5S A;  5H1V A;  2GRC A;  5EI4 A;  5IID A;  2I8N A;  3UW9 A;  3JVL A;  5DYU A;  5E73 A;  3MB4 A;  4BW3 A;  5FFY A;  5DKC A;  4CUP A;  4QBM A;  5E3D A;  5D3S A;  5AD3 A;  2YEL A;  4MEQ A;  4TU6 A;  5EPS A;  5EWH A;  4UIW A;  5A82 A;  5CTL A;  4YH4 A;  5A5O A;  5E0R A;  3DAI A;  2WP1 A;  5DFD A;  4CUS A;  3MB3 A;  5CQA A;  5C4Q A;  5HQ6 A;  4QYD A;  4Y03 A;  5CFW A;  5E7D A;  3QZT A;  4XY9 A;  5E9M A;  5TB6 A;  5DBM A;  4DON A;  3MUK A;  5EWC A;  4PS5 A;  4QR5 A;  5CUG A;  5EVA A;  2RO1 A;  5E74 A;  4MR6 A;  4Z1Q A;  5D3J A;  5F60 A;  3IU6 A;  5ENE A;  2E7N A;  3S91 A;  4A9M A;  3AQA A;  5KU3 A;  4QR4 A;  5C87 A;  5FE9 A;  5FG5 A;  5AMF A;  5IGM A;  4TZ8 A;  4A9O A;  2H60 A;  4CUU A;  2RNW A;  4IR6 A;  5CQ5 A;  1JSP B;  2LSP B;  5D3P A;  4O71 A;  5IGL A;  5HEL A;  2F6N A;  5L99 A;  4QB3 A;  5G4S A;  5DYC A;  5CQ8 A;  5J0D A;  5K29 A;  5EM3 A;  4TQN A;  4CFL A;  5CZG A;  2YQD A;  5ETB A;  3S92 A;  5H1T A;  5D3R A;  4MEP A;  5II1 A;  5KTX A;  5LJ2 A;  5E9Y A;  4Q0N A;  4UYE A;  4YYI A;  5CPE A;  5EWD A;  4C66 A;  4XY8 A;  4A9I A;  4UYD A;  4NS5 A;  4HXR A;  4Z6H A;  4ALG A;  4CL9 A;  5FE3 A;  4LZS A;  3UV4 A;  5D7X A;  5LKZ A;  4O70 A;  5JI8 A;  5FBX A;  5F2P A;  3G0L A;  3SVF A;  4UIV A;  4A9E A;  5I89 A;  5KHM A;  5CQ7 A;  4BW4 A;  4IOO A;  5EWV A;  3MXF A;  4LYI A;  5L97 A;  3LQJ A;  4O75 A;  4FLP A;  2E3K A;  4O74 A;  2YEK A;  5D3H A;  1E6I A;  5E3G A;  4O7E A;  5DKH A;  4UYG A;  5FG6 A;  3NXB A;  5DFC A;  5D25 A;  4NR9 A;  4NR7 A;  4TZ2 A;  5EIC A;  4ZW1 A;  4YY4 A;  5HRX A;  5KTW A;  4XYA A;  4QY4 A;  4NYV A;  5DLZ A;  5I1Q A;  3MUL A;  5DW1 A;  4QC1 A;  3U5L A;  4QST A;  2L85 A;  4O78 A;  3JVK A;  4OGJ A;  1N72 A;  5COI A;  5L98 A;  4YBS A;  5EPB A;  4YAT A;  5G4R A;  5A5Q A;  4A9J A;  4WIV A;  5BT5 A;  4QUU A;  4HXM A;  4HBW A;  5CGP A;  5DX4 A;  4HXK A;  3U5J A;  5EGU A;  1WUG A;  5CU8 A;  4KV1 A;  5DYA A;  1JM4 B;  4QZS A;  4RVR A;  5D0C A;  2DVS A;  2DVV A;  4YYN A;  4J1P A;  4OUF A;  5H85 A;  4A9K A;  5HRW A;  4NQM A;  4HBX A;  4QUT A;  2RS9 B;  3TLP A;  5A7C A;  5DLX A;  2OSS A;  4NR4 A;  4QSW A;  4IR4 A;  5CY9 A;  3U5O A;  5CUB A;  3P1C A;  4TT2 A;  5IG6 A;  1EQF A;  3O36 A;  4AKN A;  5FB1 A;  3UVY A;  4TS8 A;  5BT3 A;  2G4A A;  5EQ1 A;  5I80 A;  1F68 A;  5CUA A;  2OO1 A;  3UVD A;  4J3I A;  3FKM X;  2L5E A;  5BT4 A;  3U5P A;  3JVM A;  5LJ0 A;  5KO4 A;  2R0Y A;  4O76 A;  4UIY A;  5HFQ A;  5D3N A;  4YYH A;  5C85 A;  4IR3 A;  3U5K A;  2DWW A;  5IBN A;  5F62 A;  5EA1 A;  5CP5 A;  5FE5 A;  2FSA A;  5FDZ A;  4ALH A;  3LXJ A;  4Z93 A;  5HQ7 A; 
#chains in the Genus database with same CATH topology
 5HJC A;  2D82 A;  4CUR A;  2YEM A;  4HXL A;  4UYF B;  5I40 A;  2N9G A;  4NYX A;  5TCM A;  3VKH A;  5IGN A;  5FFW A;  4UIT A;  5II2 A;  4PTB A;  5A5P A;  5DKD A;  4O7A A;  4PCI A;  4NYW A;  4UYF A;  5L96 A;  4UIU A;  5F5Z A;  3SVG A;  4NR8 A;  5KTU A;  4CFK A;  4NR6 A;  2D9E A;  4QEW A;  4IOR A;  4N4G A;  4BJX A;  4CLB A;  4PY6 A;  4O77 A;  4YYJ A;  5HLS A;  4BHW A;  5I88 A;  4QEU A;  5FE0 A;  3ERR A;  5FH7 A;  3GG3 A;  5EPR A;  4QC3 A;  5CUD A;  5EV9 A;  5ETD A;  4Z6I A;  4QSS A;  5HCL A;  5D3L A;  4MR5 A;  4HXP A;  5ENC A;  4A9F A;  4A9N A;  5IGK A;  5D3T A;  3G0J A;  5LVR A;  3P5O A;  5FB0 A;  5AD2 A;  4N3W A;  5F1L A;  4YYG A;  4O7F A;  2L84 A;  4QSR A;  5EU1 A;  2RNX A;  5ACY A;  5CRM A;  3P1E A;  4YK0 A;  5L8U A;  4O72 A;  2R10 A;  4J0S A;  4LZ2 A;  5H1U A;  4YC9 A;  4N4I A;  4J0R A;  3I3J A;  4YAD A;  5FH6 A;  5HQ5 A;  5CRZ A;  3SVH A;  4NRB A;  5HM0 A;  1ZS5 A;  4LYS A;  3Q2E A;  2R0S A;  4NUE A;  1ZKR A;  4UIZ A;  5LJ1 A;  5F36 A;  5E9V A;  3HMF A;  5EK9 A;  3P1F A;  5LKX A;  4XUB A;  4C67 A;  4YH3 A;  4AKI A;  4Q0O A;  5E9L A;  5ENI A;  1WUM A;  5HEM A;  4QSV A;  5CQT A;  4MR3 A;  3AAD A;  5AME A;  5CUC A;  4LZR A;  4QEV A;  5D24 A;  4QYL A;  4NRA A;  4BW2 A;  5ENH A;  5A83 A;  5A5N A;  3P1D A;  3QZS A;  5EWW A;  3D7C A;  5I7X A;  3U5N A;  4YYD A;  3K2J A;  4A9H A;  4QSX A;  5DY7 A;  4AI6 A;  4KCX A;  3UVX A;  5LKT A;  5C7N A;  5ENJ A;  5CQ3 A;  4YAB A;  2RNY A;  4IOQ A;  5ENB A;  4TU4 A;  4O7B A;  4LDF A;  5D26 A;  5F61 A;  5FG4 A;  4QSQ A;  4WHW A;  4X2I A;  3LJW A;  4NQN A;  2MJV B;  4UYH A;  5CS8 A;  4MEO A;  3HME A;  3DWY A;  5LVQ A;  5JWM A;  2NXB A;  3LQH A;  4NRC A;  5CQ4 A;  4O7C A;  5EIS A;  5FE1 A;  2OUO A;  2YW5 A;  5F3A A;  3ZYU A;  4QNS A;  3MQM A;  5FE7 A;  3O33 A;  4Z1S A;  4IR5 A;  5E9I A;  5A85 A;  5C8G A;  5A5R A;  5I7Y A;  4YYK A;  4KV4 A;  4YBT A;  5DYX A;  2DKW A;  4A9L A;  2WP2 A;  4F3I A;  3HMH A;  2DVQ A;  4LR6 A;  4ZC9 A;  5HEN A;  4CUT A;  5FE8 A;  3Q2F A;  5ENG A;  4YY6 A;  4PKL A;  5F1H A;  4CUQ A;  5DFB A;  3D1B A;  3UV2 A;  5L8T A;  4NXJ A;  5E9K A;  4LYW A;  5C89 A;  2E7O A;  2YYN A;  4MEN A;  4QR3 A;  5FE6 A;  4LRG A;  3QZV A;  4OGI A;  5EP7 A;  4BW1 A;  4HXO A;  4NUC A;  4TT4 A;  3IU5 A;  2R0V A;  4GPJ A;  3O34 A;  4N4H A;  4XUA A;  2DVR A;  5HRV A;  4TTE A;  4N4F A;  3RCW A;  5I83 A;  5F25 A;  5I29 A;  2KTB B;  3LQI A;  5DW2 A;  3UVW A;  5I86 A;  3U5M A;  3JVJ A;  4TYL A;  4YAX A;  3O35 A;  4YBM A;  4HBY A;  3D1D A;  4QSP A;  4PCE A;  2YDW A;  4QSU A;  5LUU A;  2DAT A;  4MR4 A;  3UV5 A;  5LKU A;  5FE2 A;  4NR5 A;  5A81 A;  4E96 A;  2RFJ A;  5F63 A;  5HFR A;  2I7K A;  4UIX A;  4WHU A;  2RI7 A;  2F6J A;  4LC2 A;  5CQ6 A;  4ZQL A;  4NUD A;  3ONI A;  1X0J A;  5ENF A;  4HXN A;  5FH8 A;  4HXS A;  4YYM A;  5FFV A;  4HBV A;  3O37 A;  4TT6 A;  5CUE A;  5FE4 A;  5A5S A;  5H1V A;  2GRC A;  5EI4 A;  5IID A;  2I8N A;  3UW9 A;  3JVL A;  5DYU A;  5E73 A;  3MB4 A;  4BW3 A;  5FFY A;  5DKC A;  4CUP A;  4QBM A;  5E3D A;  5D3S A;  5AD3 A;  2YEL A;  4MEQ A;  4TU6 A;  5EPS A;  5EWH A;  4UIW A;  5A82 A;  5CTL A;  4YH4 A;  2EJN A;  5A5O A;  5E0R A;  3DAI A;  4AKG A;  2WP1 A;  5DFD A;  4CUS A;  3MB3 A;  5CQA A;  5C4Q A;  5HQ6 A;  4QYD A;  4Y03 A;  5CFW A;  5E7D A;  3QZT A;  4XY9 A;  5E9M A;  5TB6 A;  5DBM A;  4DON A;  3MUK A;  5EWC A;  4PS5 A;  4QR5 A;  5CUG A;  5EVA A;  2RO1 A;  5E74 A;  4MR6 A;  4Z1Q A;  5D3J A;  5F60 A;  3IU6 A;  5ENE A;  2E7N A;  3S91 A;  4A9M A;  3AQA A;  5KU3 A;  4QR4 A;  5C87 A;  5FE9 A;  5FG5 A;  5AMF A;  5IGM A;  4TZ8 A;  4A9O A;  2H60 A;  4CUU A;  2RNW A;  4IR6 A;  5CQ5 A;  1JSP B;  2LSP B;  5D3P A;  4O71 A;  5IGL A;  5HEL A;  2F6N A;  5L99 A;  4QB3 A;  5G4S A;  5DYC A;  5CQ8 A;  5J0D A;  5K29 A;  5EM3 A;  4TQN A;  4CFL A;  5CZG A;  2YQD A;  5ETB A;  3S92 A;  5H1T A;  5D3R A;  4MEP A;  5II1 A;  5KTX A;  5LJ2 A;  5E9Y A;  4Q0N A;  4UYE A;  4YYI A;  5CPE A;  5EWD A;  4C66 A;  4XY8 A;  4A9I A;  4UYD A;  4NS5 A;  4HXR A;  4Z6H A;  4ALG A;  4CL9 A;  5FE3 A;  4LZS A;  3UV4 A;  5D7X A;  5LKZ A;  4O70 A;  5JI8 A;  5FBX A;  5F2P A;  3G0L A;  3SVF A;  4UIV A;  4A9E A;  5I89 A;  5KHM A;  5CQ7 A;  4BW4 A;  4IOO A;  5EWV A;  3MXF A;  4LYI A;  5L97 A;  3LQJ A;  4O75 A;  4FLP A;  2E3K A;  4O74 A;  2YEK A;  5D3H A;  1E6I A;  5E3G A;  4O7E A;  5DKH A;  4UYG A;  5FG6 A;  3NXB A;  5DFC A;  5D25 A;  4NR9 A;  4NR7 A;  4TZ2 A;  5EIC A;  4ZW1 A;  4YY4 A;  5HRX A;  5KTW A;  4XYA A;  4QY4 A;  4NYV A;  5DLZ A;  5I1Q A;  3MUL A;  5DW1 A;  4AKH A;  4QC1 A;  3U5L A;  4QST A;  2L85 A;  4O78 A;  3JVK A;  4OGJ A;  1N72 A;  5COI A;  5L98 A;  4YBS A;  5EPB A;  4YAT A;  5G4R A;  5A5Q A;  4A9J A;  4WIV A;  5BT5 A;  4QUU A;  4HXM A;  4HBW A;  5CGP A;  5DX4 A;  4HXK A;  3U5J A;  5EGU A;  3VKG A;  1WUG A;  5CU8 A;  4KV1 A;  5DYA A;  1JM4 B;  4QZS A;  4RVR A;  5D0C A;  2DVS A;  2DVV A;  4YYN A;  4J1P A;  4OUF A;  5H85 A;  4A9K A;  5HRW A;  4NQM A;  4HBX A;  4QUT A;  2RS9 B;  3TLP A;  5A7C A;  5DLX A;  2OSS A;  4NR4 A;  4QSW A;  4IR4 A;  5CY9 A;  3U5O A;  5CUB A;  3P1C A;  4TT2 A;  5IG6 A;  1EQF A;  3O36 A;  4AKN A;  5FB1 A;  3UVY A;  4TS8 A;  5BT3 A;  2G4A A;  5EQ1 A;  5I80 A;  1F68 A;  5CUA A;  2OO1 A;  3UVD A;  4J3I A;  3FKM X;  2L5E A;  5BT4 A;  3U5P A;  3JVM A;  5LJ0 A;  5KO4 A;  2R0Y A;  4O76 A;  4UIY A;  5HFQ A;  5D3N A;  4YYH A;  5C85 A;  4IR3 A;  3U5K A;  2DWW A;  5IBN A;  1PUO A;  5EA1 A;  5F62 A;  5CP5 A;  5FE5 A;  2FSA A;  5FDZ A;  4ALH A;  3LXJ A;  4Z93 A;  5HQ7 A; 
#chains in the Genus database with same CATH homology
 5HJC A;  2D82 A;  4CUR A;  2YEM A;  4HXL A;  4UYF B;  5I40 A;  2N9G A;  4NYX A;  5TCM A;  5IGN A;  5FFW A;  4UIT A;  5II2 A;  4PTB A;  5A5P A;  5DKD A;  4O7A A;  4PCI A;  4NYW A;  4UYF A;  5L96 A;  4UIU A;  5F5Z A;  3SVG A;  4NR8 A;  5KTU A;  4CFK A;  4NR6 A;  2D9E A;  4QEW A;  4IOR A;  4N4G A;  4BJX A;  4CLB A;  4PY6 A;  4O77 A;  4YYJ A;  5HLS A;  4BHW A;  5I88 A;  4QEU A;  5FE0 A;  5FH7 A;  3GG3 A;  5EPR A;  4QC3 A;  5CUD A;  5EV9 A;  5ETD A;  4Z6I A;  4QSS A;  5HCL A;  5D3L A;  4MR5 A;  4HXP A;  5ENC A;  4A9F A;  4A9N A;  5IGK A;  5D3T A;  3G0J A;  5LVR A;  3P5O A;  5FB0 A;  5AD2 A;  4N3W A;  5F1L A;  4YYG A;  4O7F A;  2L84 A;  4QSR A;  5EU1 A;  2RNX A;  5ACY A;  5CRM A;  3P1E A;  4YK0 A;  5L8U A;  4O72 A;  2R10 A;  4J0S A;  4LZ2 A;  5H1U A;  4YC9 A;  4N4I A;  4J0R A;  3I3J A;  4YAD A;  5FH6 A;  5HQ5 A;  5CRZ A;  3SVH A;  4NRB A;  5HM0 A;  1ZS5 A;  4LYS A;  3Q2E A;  2R0S A;  4NUE A;  4UIZ A;  5LJ1 A;  5F36 A;  5E9V A;  3HMF A;  5EK9 A;  3P1F A;  5LKX A;  4XUB A;  4C67 A;  4YH3 A;  4Q0O A;  5E9L A;  5ENI A;  1WUM A;  5HEM A;  4QSV A;  5CQT A;  4MR3 A;  3AAD A;  5AME A;  5CUC A;  4LZR A;  4QEV A;  5D24 A;  4QYL A;  4NRA A;  4BW2 A;  5ENH A;  5A83 A;  5A5N A;  3P1D A;  3QZS A;  5EWW A;  3D7C A;  5I7X A;  3U5N A;  4YYD A;  3K2J A;  4A9H A;  4QSX A;  5DY7 A;  4KCX A;  3UVX A;  5LKT A;  5C7N A;  5ENJ A;  5CQ3 A;  4YAB A;  2RNY A;  4IOQ A;  5ENB A;  4TU4 A;  4O7B A;  4LDF A;  5D26 A;  5F61 A;  5FG4 A;  4QSQ A;  4WHW A;  4X2I A;  3LJW A;  4NQN A;  2MJV B;  4UYH A;  5CS8 A;  4MEO A;  3HME A;  3DWY A;  5LVQ A;  5JWM A;  2NXB A;  3LQH A;  4NRC A;  5CQ4 A;  4O7C A;  5EIS A;  5FE1 A;  2OUO A;  2YW5 A;  5F3A A;  3ZYU A;  4QNS A;  3MQM A;  5FE7 A;  3O33 A;  4Z1S A;  4IR5 A;  5E9I A;  5A85 A;  5C8G A;  5A5R A;  5I7Y A;  4YYK A;  4KV4 A;  4YBT A;  5DYX A;  2DKW A;  4A9L A;  2WP2 A;  4F3I A;  3HMH A;  2DVQ A;  4LR6 A;  4ZC9 A;  5HEN A;  4CUT A;  5FE8 A;  3Q2F A;  5ENG A;  4YY6 A;  4PKL A;  5F1H A;  4CUQ A;  5DFB A;  3UV2 A;  5L8T A;  4NXJ A;  5E9K A;  4LYW A;  5C89 A;  2E7O A;  2YYN A;  4MEN A;  4QR3 A;  5FE6 A;  4LRG A;  3QZV A;  4OGI A;  5EP7 A;  4BW1 A;  4HXO A;  4NUC A;  4TT4 A;  3IU5 A;  2R0V A;  4GPJ A;  3O34 A;  4N4H A;  4XUA A;  2DVR A;  5HRV A;  4TTE A;  4N4F A;  3RCW A;  5I83 A;  5F25 A;  5I29 A;  2KTB B;  3LQI A;  5DW2 A;  3UVW A;  5I86 A;  3U5M A;  3JVJ A;  4TYL A;  4YAX A;  3O35 A;  4YBM A;  4HBY A;  4QSP A;  4PCE A;  2YDW A;  4QSU A;  5LUU A;  2DAT A;  4MR4 A;  3UV5 A;  5LKU A;  5FE2 A;  4NR5 A;  5A81 A;  4E96 A;  2RFJ A;  5F63 A;  5HFR A;  2I7K A;  4UIX A;  4WHU A;  2RI7 A;  2F6J A;  4LC2 A;  5CQ6 A;  4ZQL A;  4NUD A;  3ONI A;  1X0J A;  5ENF A;  4HXN A;  5FH8 A;  4HXS A;  4YYM A;  5FFV A;  4HBV A;  3O37 A;  4TT6 A;  5CUE A;  5FE4 A;  5A5S A;  5H1V A;  2GRC A;  5EI4 A;  5IID A;  2I8N A;  3UW9 A;  3JVL A;  5DYU A;  5E73 A;  3MB4 A;  4BW3 A;  5FFY A;  5DKC A;  4CUP A;  4QBM A;  5E3D A;  5D3S A;  5AD3 A;  2YEL A;  4MEQ A;  4TU6 A;  5EPS A;  5EWH A;  4UIW A;  5A82 A;  5CTL A;  4YH4 A;  5A5O A;  5E0R A;  3DAI A;  2WP1 A;  5DFD A;  4CUS A;  3MB3 A;  5CQA A;  5C4Q A;  5HQ6 A;  4QYD A;  4Y03 A;  5CFW A;  5E7D A;  3QZT A;  4XY9 A;  5E9M A;  5TB6 A;  5DBM A;  4DON A;  3MUK A;  5EWC A;  4PS5 A;  4QR5 A;  5CUG A;  5EVA A;  2RO1 A;  5E74 A;  4MR6 A;  4Z1Q A;  5D3J A;  5F60 A;  3IU6 A;  5ENE A;  2E7N A;  3S91 A;  4A9M A;  3AQA A;  5KU3 A;  4QR4 A;  5C87 A;  5FE9 A;  5FG5 A;  5AMF A;  5IGM A;  4TZ8 A;  4A9O A;  2H60 A;  4CUU A;  2RNW A;  4IR6 A;  5CQ5 A;  1JSP B;  2LSP B;  5D3P A;  4O71 A;  5IGL A;  5HEL A;  2F6N A;  5L99 A;  4QB3 A;  5G4S A;  5DYC A;  5CQ8 A;  5J0D A;  5K29 A;  5EM3 A;  4TQN A;  4CFL A;  5CZG A;  2YQD A;  5ETB A;  3S92 A;  5H1T A;  5D3R A;  4MEP A;  5II1 A;  5KTX A;  5LJ2 A;  5E9Y A;  4Q0N A;  4UYE A;  4YYI A;  5CPE A;  5EWD A;  4C66 A;  4XY8 A;  4A9I A;  4UYD A;  4NS5 A;  4HXR A;  4Z6H A;  4ALG A;  4CL9 A;  5FE3 A;  4LZS A;  3UV4 A;  5D7X A;  5LKZ A;  4O70 A;  5JI8 A;  5FBX A;  5F2P A;  3G0L A;  3SVF A;  4UIV A;  4A9E A;  5I89 A;  5KHM A;  5CQ7 A;  4BW4 A;  4IOO A;  5EWV A;  3MXF A;  4LYI A;  5L97 A;  3LQJ A;  4O75 A;  4FLP A;  2E3K A;  4O74 A;  2YEK A;  5D3H A;  1E6I A;  5E3G A;  4O7E A;  5DKH A;  4UYG A;  5FG6 A;  3NXB A;  5DFC A;  5D25 A;  4NR9 A;  4NR7 A;  4TZ2 A;  5EIC A;  4ZW1 A;  4YY4 A;  5HRX A;  5KTW A;  4XYA A;  4QY4 A;  4NYV A;  5DLZ A;  5I1Q A;  3MUL A;  5DW1 A;  4QC1 A;  3U5L A;  4QST A;  2L85 A;  4O78 A;  3JVK A;  4OGJ A;  1N72 A;  5COI A;  5L98 A;  4YBS A;  5EPB A;  4YAT A;  5G4R A;  5A5Q A;  4A9J A;  4WIV A;  5BT5 A;  4QUU A;  4HXM A;  4HBW A;  5CGP A;  5DX4 A;  4HXK A;  3U5J A;  5EGU A;  1WUG A;  5CU8 A;  4KV1 A;  5DYA A;  1JM4 B;  4QZS A;  4RVR A;  5D0C A;  2DVS A;  2DVV A;  4YYN A;  4J1P A;  4OUF A;  5H85 A;  4A9K A;  5HRW A;  4NQM A;  4HBX A;  4QUT A;  2RS9 B;  3TLP A;  5A7C A;  5DLX A;  2OSS A;  4NR4 A;  4QSW A;  4IR4 A;  5CY9 A;  3U5O A;  5CUB A;  3P1C A;  4TT2 A;  5IG6 A;  1EQF A;  3O36 A;  4AKN A;  5FB1 A;  3UVY A;  4TS8 A;  5BT3 A;  2G4A A;  5EQ1 A;  5I80 A;  1F68 A;  5CUA A;  2OO1 A;  3UVD A;  4J3I A;  3FKM X;  2L5E A;  5BT4 A;  3U5P A;  3JVM A;  5LJ0 A;  5KO4 A;  2R0Y A;  4O76 A;  4UIY A;  5HFQ A;  5D3N A;  4YYH A;  5C85 A;  4IR3 A;  3U5K A;  2DWW A;  5IBN A;  5F62 A;  5EA1 A;  5CP5 A;  5FE5 A;  2FSA A;  5FDZ A;  4ALH A;  3LXJ A;  4Z93 A;  5HQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...