4NYWA

Crystal structure of the bromodomain of human crebbp in complex with a dihydroquinoxalinone ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
116
structure length
116
Chain Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Crystal Structure of the Bromodomain of human CREBBP in complex with a dihydroquinoxalinone ligand
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 41
structure length 116
sequence length 116
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4nywA00
2E3KA 2DATA 5D26A 4O74A 5DW1A 4BW4A 4ZW1A 4HXKA 4O75A 5DLZA 3SVFA 4NS5A 4HXMA 4PY6A 5FFWA 4QSVA 4LC2A 5EU1A 5A5SA 3JVKA 4UIXA 3AADA 2RNYA 4C67A 5FE1A 5EISA 5AD2A 4UYHA 4NR4A 4LZ2A 5FB0A 3Q2FA 5C4QA 4HBYA 4XYAA 2RNWA 4J0SA 5BT4A 5ETDA 4MR4A 5FE6A 5D0CA 3K2JA 5C85A 5J0DA 4YBTA 5EP7A 3RCWA 5DYUA 5FE9A 4O7AA 5FE5A 4Z93A 3I3JA 5HEMA 3SVHA 1WUGA 2RI7A 4IR4A 4UYFB 5CQAA 5EVAA 5FE2A 4TTEA 4LZSA 5F61A 1JSPB 5A82A 5F2PA 4NUEA 4UITA 5FG5A 2DVQA 3S92A 5L97A 3Q2EA 3O34A 3IU5A 4QSXA 5CUEA 5ENEA 5D25A 5L8TA 4QR3A 4NR9A 4LYWA 5EI4A 3U5KA 2RO1A 5I80A 4HXNA 2F6JA 5ENIA 5K29A 4MENA 5CTLA 2OO1A 4HXOA 3LQHA 4TS8A 5HELA 5EPSA 4CL9A 4HBXA 5CQ3A 4KV4A 5EWHA 4A9FA 5KU3A 4CFLA 5II1A 5E9KA 5A83A 3UW9A 4CUSA 5LJ0A 4UYFA 4IR3A 4TZ2A 2DWWA 4O76A 3U5JA 5HQ6A 5CUGA 3FKMX 4O72A 5FE8A 4TT6A 5ENFA 2D9EA 3P1EA 4KV1A 5CS8A 3JVJA 5FH6A 5FDZA 3JVMA 5H85A 5KHMA 5CUBA 4E96A 1F68A 4A9EA 4IOQA 4RVRA 5C8GA 5FG6A 4Y03A 3U5PA 5D24A 5CQTA 3IU6A 5DYCA 4BHWA 5LKXA 5EM3A 5H1TA 5KO4A 5CQ8A 3UV4A 3DAIA 4WHWA 4CUUA 5EWDA 2OUOA 5DLXA 4YY4A 4O77A 5DY7A 5BT5A 2L85A 3O33A 4A9MA 2RNXA 5IBNA 4QR4A 5E9YA 4YYJA 2NXBA 5EPBA 4UYDA 5EV9A 4PCIA 4TT2A 5G4RA 3UVWA 3JVLA 3NXBA 5ENHA 5KTWA 5H1VA 4OGIA 5HJCA 4QY4A 1N72A 5EGUA 3GG3A 4QSRA 2YDWA 5DYXA 4A9HA 5D7XA 4A9LA 4BJXA 5HQ7A 4HXRA 5II2A 4FLPA 5IGNA 5LKZA 5CQ4A 4NR5A 4YYMA 4IR5A 3UVXA 4LYIA 4XUAA 2YYNA 4NYVA 4QEUA 5ETBA 5DKHA 4NRBA 2L84A 4YK0A 4QSWA 4UIVA 2D82A 5I7XA 5D3SA 5DKCA 5HCLA 5EA1A 5I83A 3UV5A 5F3AA 5HRXA 4ZC9A 3UVDA 5E0RA 4TU6A 5E74A 3MB4A 4A9IA 4BW2A 3QZSA 3P1DA 5HM0A 2E7OA 5AD3A 5HFQA 4XUBA 1JM4B 5COIA 5IGKA 4MR5A 5CRZA 5LVRA 4HBWA 5G4SA 2MJVB 3HMEA 4YY6A 4YBMA 5LJ2A 5E9MA 3LJWA 5IG6A 5I86A 5CZGA 4UIWA 5DFCA 5C7NA 4C66A 5A5OA 4QUUA 5ENGA 5F1HA 2RS9B 4TT4A 5I29A 5CQ6A 5CUCA 5JWMA 4QUTA 5FH7A 5L99A 5LUUA 4O7FA 5C87A 2YW5A 4A9NA 3DWYA 4J0RA 3G0JA 5L8UA 4YATA 5FFYA 5CFWA 2DVRA 5AMFA 5LVQA 5F1LA 2YEKA 5CUAA 4N4GA 5KTUA 4HXLA 5FB1A 3U5LA 4O7BA 4ALHA 4Z6IA 4QC1A 3MB3A 2YEMA 4QSSA 5DBMA 5I1QA 4QB3A 4YAXA 5A5NA 4N4FA 4QNSA 4YYDA 5DYAA 5E9VA 5D3RA 4CURA 4NUDA 5E7DA 4KCXA 5CGPA 5HRVA 4NR7A 4TZ8A 5ENJA 4Z1QA 1WUMA 4AKNA 5CY9A 3O37A 5E3DA 4MR3A 5E73A 5H1UA 4Q0OA 1X0JA 4IR6A 4CUTA 5JI8A 4O7CA 4PCEA 5E3GA 5HQ5A 5EICA 3TLPA 3ZYUA 2R0YA 2KTBB 4CUQA 5EWCA 5FE3A 4MR6A 2DVVA 5CPEA 5HLSA 3G0LA 5EPRA 5A5RA 5L98A 4TQNA 5C89A 4QSPA 5L96A 3AQAA 4BW1A 4QYDA 2DVSA 4J1PA 4QBMA 3LQIA 5CP5A 5EWVA 4QC3A 5A5QA 4A9JA 5EK9A 4QSUA 1EQFA 5LJ1A 3S91A 4UYGA 4HXSA 5EQ1A 4QSTA 4UIYA 4O7EA 4A9OA 5FE0A 4OGJA 5IIDA 3QZVA 5A81A 4NR8A 5DFBA 5ENBA 3P5OA 4NYWA 5TB6A 5ENCA 4YADA 4J3IA 5I88A 5HFRA 5F25A 5I7YA 5D3TA 4LR6A 4GPJA 4X2IA 4LYSA 5FH8A 4O71A 3MXFA 4YH3A 4NYXA 3SVGA 5DFDA 4N3WA 5AMEA 2F6NA 4O70A 3MUKA 4UIUA 2L5EA 5DW2A 2WP1A 5F5ZA 3MQMA 4NQMA 1ZS5A 4YBSA 4QSQA 2N9GA 4TYLA 5HRWA 4NQNA 4TU4A 4UIZA 4DONA 3U5OA 5F36A 5E9LA 4PS5A 2I7KA 4QZSA 2E7NA 5E9IA 4OUFA 5FG4A 4O78A 4F3IA 4QEWA 4NXJA 4UYEA 4IORA 3HMHA 4NRAA 4YYNA 4YYKA 3UV2A 2YELA 5FBXA 5CUDA 4PKLA 4QEVA 4N4IA 5HENA 4QR5A 1E6IA 5IGLA 4YABA 4MEQA 5FE7A 5KTXA 4ZQLA 4NR6A 4NUCA 4HXPA 5FE4A 4A9KA 5LKTA 3U5NA 5ACYA 2R10A 5CQ5A 2RFJA 4MEOA 4Z1SA 5EWWA 2H60A 3MULA 3P1FA 4CLBA 4N4HA 4BW3A 2FSAA 2YQDA 5D3PA 4YC9A 5F60A 3U5MA 4IOOA 4HBVA 4YYHA 4CUPA 3QZTA 4Z6HA 3P1CA 2R0VA 4WHUA 5I40A 5D3HA 2R0SA 2OSSA 2I8NA 2G4AA 5D3NA 5A5PA 5BT3A 5F62A 4YYGA 5IGMA 4CFKA 4LZRA 4WIVA 3D7CA 5CU8A 4XY8A 4LDFA 4ALGA 5F63A 3O36A 4YH4A 4XY9A 2GRCA 4LRGA 5DKDA 3LQJA 4Q0NA 3O35A 5DX4A 3LXJA 5TCMA 4QYLA 2LSPB 5A7CA 5LKUA 5D3LA 2WP2A 4NRCA 5CRMA 5CQ7A 3HMFA 3ONIA 4MEPA 3UVYA 4PTBA 2DKWA 5D3JA 5I89A 5A85A 5FFVA 4YYIA
chains in the Genus database with same CATH superfamily
2E3KA 2DATA 5D26A 4O74A 4AI6A 5DW1A 4BW4A 4ZW1A 4HXKA 4O75A 5DLZA 3SVFA 4NS5A 4HXMA 4PY6A 5FFWA 4QSVA 4LC2A 5EU1A 5A5SA 3JVKA 4UIXA 3AADA 2RNYA 4C67A 5FE1A 5EISA 5AD2A 4UYHA 4NR4A 4LZ2A 5FB0A 3Q2FA 5C4QA 4HBYA 4XYAA 2RNWA 4J0SA 5BT4A 5ETDA 4MR4A 5FE6A 5D0CA 3K2JA 5C85A 5J0DA 4YBTA 5EP7A 3RCWA 5DYUA 5FE9A 4O7AA 5FE5A 4Z93A 3I3JA 5HEMA 3SVHA 1WUGA 2RI7A 4IR4A 4UYFB 5CQAA 5EVAA 5FE2A 4TTEA 4LZSA 5F61A 1JSPB 5A82A 5F2PA 4NUEA 4UITA 5FG5A 2DVQA 3S92A 5L97A 3Q2EA 3O34A 3IU5A 4QSXA 5CUEA 5ENEA 5D25A 5L8TA 4QR3A 4NR9A 4LYWA 5EI4A 3U5KA 2RO1A 5I80A 4HXNA 2F6JA 5ENIA 5K29A 4MENA 5CTLA 2OO1A 4HXOA 3LQHA 4TS8A 5HELA 5EPSA 4CL9A 4HBXA 5CQ3A 4KV4A 5EWHA 4A9FA 5KU3A 4CFLA 5II1A 5E9KA 5A83A 3UW9A 4CUSA 5LJ0A 1ZKRA 4UYFA 4IR3A 4TZ2A 2DWWA 4O76A 3U5JA 5HQ6A 5CUGA 3FKMX 4O72A 5FE8A 4TT6A 5ENFA 2D9EA 3P1EA 4KV1A 5CS8A 3JVJA 4AKHA 5FH6A 5FDZA 3JVMA 5H85A 5KHMA 5CUBA 4E96A 1F68A 4A9EA 4IOQA 4RVRA 5C8GA 5FG6A 4Y03A 3U5PA 5D24A 5CQTA 3IU6A 5DYCA 4BHWA 5LKXA 5EM3A 5H1TA 5KO4A 5CQ8A 3UV4A 3DAIA 4WHWA 4CUUA 5EWDA 2OUOA 5DLXA 4YY4A 4O77A 5DY7A 5BT5A 2L85A 3O33A 4A9MA 2RNXA 5IBNA 4QR4A 5E9YA 4YYJA 2NXBA 5EPBA 4UYDA 3VKHA 5EV9A 4PCIA 4TT2A 5G4RA 3UVWA 3JVLA 4AKGA 3NXBA 5ENHA 5KTWA 3VKGA 5H1VA 4OGIA 5HJCA 4QY4A 1N72A 5EGUA 3D1DA 3GG3A 4QSRA 2YDWA 5DYXA 4A9HA 5D7XA 4A9LA 4BJXA 5HQ7A 4HXRA 5II2A 4FLPA 5IGNA 5LKZA 5CQ4A 4NR5A 4YYMA 4IR5A 3UVXA 4LYIA 4XUAA 2YYNA 4NYVA 4QEUA 5ETBA 5DKHA 4NRBA 2L84A 3ERRA 4YK0A 4QSWA 4UIVA 2D82A 5I7XA 5D3SA 5DKCA 5HCLA 5EA1A 5I83A 3UV5A 5F3AA 5HRXA 4ZC9A 3UVDA 5E0RA 4TU6A 5E74A 3MB4A 4A9IA 4BW2A 3QZSA 3P1DA 5HM0A 2E7OA 5AD3A 5HFQA 4XUBA 1JM4B 5COIA 5IGKA 4MR5A 5CRZA 5LVRA 4HBWA 5G4SA 2MJVB 3HMEA 4YY6A 4YBMA 5LJ2A 5E9MA 3LJWA 5IG6A 5I86A 5CZGA 4UIWA 5DFCA 5C7NA 4C66A 5A5OA 4QUUA 5ENGA 5F1HA 2RS9B 4TT4A 5I29A 5CQ6A 5CUCA 5JWMA 4QUTA 5FH7A 5L99A 5LUUA 4O7FA 5C87A 2YW5A 4A9NA 3DWYA 4J0RA 3G0JA 5L8UA 4YATA 5FFYA 5CFWA 2DVRA 5AMFA 5LVQA 5F1LA 2YEKA 5CUAA 4N4GA 5KTUA 4HXLA 5FB1A 3U5LA 4O7BA 4ALHA 4Z6IA 4QC1A 3MB3A 2YEMA 4QSSA 5DBMA 2EJNA 5I1QA 4QB3A 4YAXA 5A5NA 4N4FA 4QNSA 4YYDA 5DYAA 5E9VA 5D3RA 4CURA 4NUDA 5E7DA 4KCXA 5CGPA 5HRVA 4NR7A 4TZ8A 5ENJA 4Z1QA 1WUMA 4AKNA 5CY9A 3O37A 5E3DA 4MR3A 5E73A 5H1UA 4Q0OA 1X0JA 4IR6A 4CUTA 5JI8A 4O7CA 4PCEA 5E3GA 5HQ5A 5EICA 3TLPA 3ZYUA 2R0YA 2KTBB 4CUQA 5EWCA 5FE3A 4MR6A 2DVVA 5CPEA 5HLSA 3G0LA 5EPRA 5A5RA 5L98A 4TQNA 5C89A 4QSPA 5L96A 3AQAA 4BW1A 4QYDA 2DVSA 4J1PA 4QBMA 3LQIA 5CP5A 5EWVA 4QC3A 5A5QA 4A9JA 5EK9A 4QSUA 1PUOA 1EQFA 5LJ1A 3S91A 3D1BA 4UYGA 4HXSA 5EQ1A 4QSTA 4UIYA 4O7EA 4A9OA 5FE0A 4OGJA 5IIDA 3QZVA 5A81A 4NR8A 5DFBA 5ENBA 3P5OA 4NYWA 5TB6A 5ENCA 4YADA 4J3IA 5I88A 5HFRA 5F25A 5I7YA 5D3TA 4LR6A 4GPJA 4X2IA 4LYSA 5FH8A 4O71A 3MXFA 4YH3A 4NYXA 4AKIA 3SVGA 5DFDA 4N3WA 5AMEA 2F6NA 4O70A 3MUKA 4UIUA 2L5EA 5DW2A 2WP1A 5F5ZA 3MQMA 4NQMA 1ZS5A 4YBSA 4QSQA 2N9GA 4TYLA 5HRWA 4NQNA 4TU4A 4UIZA 4DONA 3U5OA 5F36A 5E9LA 4PS5A 2I7KA 4QZSA 2E7NA 5E9IA 4OUFA 5FG4A 4O78A 4F3IA 4QEWA 4NXJA 4UYEA 4IORA 3HMHA 4NRAA 4YYNA 4YYKA 3UV2A 2YELA 5FBXA 5CUDA 4PKLA 4QEVA 4N4IA 5HENA 4QR5A 1E6IA 5IGLA 4YABA 4MEQA 5FE7A 5KTXA 4ZQLA 4NR6A 4NUCA 4HXPA 5FE4A 4A9KA 5LKTA 3U5NA 5ACYA 2R10A 5CQ5A 2RFJA 4MEOA 4Z1SA 5EWWA 2H60A 3MULA 3P1FA 4CLBA 4N4HA 4BW3A 2FSAA 2YQDA 5D3PA 4YC9A 5F60A 3U5MA 4IOOA 4HBVA 4YYHA 4CUPA 3QZTA 4Z6HA 3P1CA 2R0VA 4WHUA 5I40A 5D3HA 2R0SA 2OSSA 2I8NA 2G4AA 5D3NA 5A5PA 5BT3A 5F62A 4YYGA 5IGMA 4CFKA 4LZRA 4WIVA 3D7CA 5CU8A 4XY8A 4LDFA 4ALGA 5F63A 3O36A 4YH4A 4XY9A 2GRCA 4LRGA 5DKDA 3LQJA 4Q0NA 3O35A 5DX4A 3LXJA 5TCMA 4QYLA 2LSPB 5A7CA 5LKUA 5D3LA 2WP2A 4NRCA 5CRMA 5CQ7A 3HMFA 3ONIA 4MEPA 3UVYA 4PTBA 2DKWA 5D3JA 5I89A 5A85A 5FFVA 4YYIA
chains in the Genus database with same CATH topology
2E3KA 2DATA 5D26A 4O74A 5DW1A 4BW4A 4ZW1A 4HXKA 4O75A 5DLZA 3SVFA 4NS5A 4HXMA 4PY6A 5FFWA 4QSVA 4LC2A 5EU1A 5A5SA 3JVKA 4UIXA 3AADA 2RNYA 4C67A 5FE1A 5EISA 5AD2A 4UYHA 4NR4A 4LZ2A 5FB0A 3Q2FA 5C4QA 4HBYA 4XYAA 2RNWA 4J0SA 5BT4A 5ETDA 4MR4A 5FE6A 5D0CA 3K2JA 5C85A 5J0DA 4YBTA 5EP7A 3RCWA 5DYUA 5FE9A 4O7AA 5FE5A 4Z93A 3I3JA 5HEMA 3SVHA 1WUGA 2RI7A 4IR4A 4UYFB 5CQAA 5EVAA 5FE2A 4TTEA 4LZSA 5F61A 1JSPB 5A82A 5F2PA 4NUEA 4UITA 5FG5A 2DVQA 3S92A 5L97A 3Q2EA 3O34A 3IU5A 4QSXA 5CUEA 5ENEA 5D25A 5L8TA 4QR3A 4NR9A 4LYWA 5EI4A 3U5KA 2RO1A 5I80A 4HXNA 2F6JA 5ENIA 5K29A 4MENA 5CTLA 2OO1A 4HXOA 3LQHA 4TS8A 5HELA 5EPSA 4CL9A 4HBXA 5CQ3A 4KV4A 5EWHA 4A9FA 5KU3A 4CFLA 5II1A 5E9KA 5A83A 3UW9A 4CUSA 5LJ0A 4UYFA 4IR3A 4TZ2A 2DWWA 4O76A 3U5JA 5HQ6A 5CUGA 3FKMX 4O72A 5FE8A 4TT6A 5ENFA 2D9EA 3P1EA 4KV1A 5CS8A 3JVJA 5FH6A 5FDZA 3JVMA 5H85A 5KHMA 5CUBA 4E96A 1F68A 4A9EA 4IOQA 4RVRA 5C8GA 5FG6A 4Y03A 3U5PA 5D24A 5CQTA 3IU6A 5DYCA 4BHWA 5LKXA 5EM3A 5H1TA 5KO4A 5CQ8A 3UV4A 3DAIA 4WHWA 4CUUA 5EWDA 2OUOA 5DLXA 4YY4A 4O77A 5DY7A 5BT5A 2L85A 3O33A 4A9MA 2RNXA 5IBNA 4QR4A 5E9YA 4YYJA 2NXBA 5EPBA 4UYDA 5EV9A 4PCIA 4TT2A 5G4RA 3UVWA 3JVLA 3NXBA 5ENHA 5KTWA 5H1VA 4OGIA 5HJCA 4QY4A 1N72A 5EGUA 3GG3A 4QSRA 2YDWA 5DYXA 4A9HA 5D7XA 4A9LA 4BJXA 5HQ7A 4HXRA 5II2A 4FLPA 5IGNA 5LKZA 5CQ4A 4NR5A 4YYMA 4IR5A 3UVXA 4LYIA 4XUAA 2YYNA 4NYVA 4QEUA 5ETBA 5DKHA 4NRBA 2L84A 4YK0A 4QSWA 4UIVA 2D82A 5I7XA 5D3SA 5DKCA 5HCLA 5EA1A 5I83A 3UV5A 5F3AA 5HRXA 4ZC9A 3UVDA 5E0RA 4TU6A 5E74A 3MB4A 4A9IA 4BW2A 3QZSA 3P1DA 5HM0A 2E7OA 5AD3A 5HFQA 4XUBA 1JM4B 5COIA 5IGKA 4MR5A 5CRZA 5LVRA 4HBWA 5G4SA 2MJVB 3HMEA 4YY6A 4YBMA 5LJ2A 5E9MA 3LJWA 5IG6A 5I86A 5CZGA 4UIWA 5DFCA 5C7NA 4C66A 5A5OA 4QUUA 5ENGA 5F1HA 2RS9B 4TT4A 5I29A 5CQ6A 5CUCA 5JWMA 4QUTA 5FH7A 5L99A 5LUUA 4O7FA 5C87A 2YW5A 4A9NA 3DWYA 4J0RA 3G0JA 5L8UA 4YATA 5FFYA 5CFWA 2DVRA 5AMFA 5LVQA 5F1LA 2YEKA 5CUAA 4N4GA 5KTUA 4HXLA 5FB1A 3U5LA 4O7BA 4ALHA 4Z6IA 4QC1A 3MB3A 2YEMA 4QSSA 5DBMA 5I1QA 4QB3A 4YAXA 5A5NA 4N4FA 4QNSA 4YYDA 5DYAA 5E9VA 5D3RA 4CURA 4NUDA 5E7DA 4KCXA 5CGPA 5HRVA 4NR7A 4TZ8A 5ENJA 4Z1QA 1WUMA 4AKNA 5CY9A 3O37A 5E3DA 4MR3A 5E73A 5H1UA 4Q0OA 1X0JA 4IR6A 4CUTA 5JI8A 4O7CA 4PCEA 5E3GA 5HQ5A 5EICA 3TLPA 3ZYUA 2R0YA 2KTBB 4CUQA 5EWCA 5FE3A 4MR6A 2DVVA 5CPEA 5HLSA 3G0LA 5EPRA 5A5RA 5L98A 4TQNA 5C89A 4QSPA 5L96A 3AQAA 4BW1A 4QYDA 2DVSA 4J1PA 4QBMA 3LQIA 5CP5A 5EWVA 4QC3A 5A5QA 4A9JA 5EK9A 4QSUA 1EQFA 5LJ1A 3S91A 4UYGA 4HXSA 5EQ1A 4QSTA 4UIYA 4O7EA 4A9OA 5FE0A 4OGJA 5IIDA 3QZVA 5A81A 4NR8A 5DFBA 5ENBA 3P5OA 4NYWA 5TB6A 5ENCA 4YADA 4J3IA 5I88A 5HFRA 5F25A 5I7YA 5D3TA 4LR6A 4GPJA 4X2IA 4LYSA 5FH8A 4O71A 3MXFA 4YH3A 4NYXA 3SVGA 5DFDA 4N3WA 5AMEA 2F6NA 4O70A 3MUKA 4UIUA 2L5EA 5DW2A 2WP1A 5F5ZA 3MQMA 4NQMA 1ZS5A 4YBSA 4QSQA 2N9GA 4TYLA 5HRWA 4NQNA 4TU4A 4UIZA 4DONA 3U5OA 5F36A 5E9LA 4PS5A 2I7KA 4QZSA 2E7NA 5E9IA 4OUFA 5FG4A 4O78A 4F3IA 4QEWA 4NXJA 4UYEA 4IORA 3HMHA 4NRAA 4YYNA 4YYKA 3UV2A 2YELA 5FBXA 5CUDA 4PKLA 4QEVA 4N4IA 5HENA 4QR5A 1E6IA 5IGLA 4YABA 4MEQA 5FE7A 5KTXA 4ZQLA 4NR6A 4NUCA 4HXPA 5FE4A 4A9KA 5LKTA 3U5NA 5ACYA 2R10A 5CQ5A 2RFJA 4MEOA 4Z1SA 5EWWA 2H60A 3MULA 3P1FA 4CLBA 4N4HA 4BW3A 2FSAA 2YQDA 5D3PA 4YC9A 5F60A 3U5MA 4IOOA 4HBVA 4YYHA 4CUPA 3QZTA 4Z6HA 3P1CA 2R0VA 4WHUA 5I40A 5D3HA 2R0SA 2OSSA 2I8NA 2G4AA 5D3NA 5A5PA 5BT3A 5F62A 4YYGA 5IGMA 4CFKA 4LZRA 4WIVA 3D7CA 5CU8A 4XY8A 4LDFA 4ALGA 5F63A 3O36A 4YH4A 4XY9A 2GRCA 4LRGA 5DKDA 3LQJA 4Q0NA 3O35A 5DX4A 3LXJA 5TCMA 4QYLA 2LSPB 5A7CA 5LKUA 5D3LA 2WP2A 4NRCA 5CRMA 5CQ7A 3HMFA 3ONIA 4MEPA 3UVYA 4PTBA 2DKWA 5D3JA 5I89A 5A85A 5FFVA 4YYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3K A;  2DAT A;  5D26 A;  4O74 A;  5DW1 A;  4BW4 A;  4ZW1 A;  4HXK A;  4O75 A;  5DLZ A;  3SVF A;  4NS5 A;  4HXM A;  4PY6 A;  5FFW A;  4QSV A;  4LC2 A;  5EU1 A;  5A5S A;  3JVK A;  4UIX A;  3AAD A;  2RNY A;  4C67 A;  5FE1 A;  5EIS A;  5AD2 A;  4UYH A;  4NR4 A;  4LZ2 A;  5FB0 A;  3Q2F A;  5C4Q A;  4HBY A;  4XYA A;  2RNW A;  4J0S A;  5BT4 A;  5ETD A;  4MR4 A;  5FE6 A;  5D0C A;  3K2J A;  5C85 A;  5J0D A;  4YBT A;  5EP7 A;  3RCW A;  5DYU A;  5FE9 A;  4O7A A;  5FE5 A;  4Z93 A;  3I3J A;  5HEM A;  3SVH A;  1WUG A;  2RI7 A;  4IR4 A;  4UYF B;  5CQA A;  5EVA A;  5FE2 A;  4TTE A;  4LZS A;  5F61 A;  1JSP B;  5A82 A;  5F2P A;  4NUE A;  4UIT A;  5FG5 A;  2DVQ A;  3S92 A;  5L97 A;  3Q2E A;  3O34 A;  3IU5 A;  4QSX A;  5CUE A;  5ENE A;  5D25 A;  5L8T A;  4QR3 A;  4NR9 A;  4LYW A;  5EI4 A;  3U5K A;  2RO1 A;  5I80 A;  4HXN A;  2F6J A;  5ENI A;  5K29 A;  4MEN A;  5CTL A;  2OO1 A;  4HXO A;  3LQH A;  4TS8 A;  5HEL A;  5EPS A;  4CL9 A;  4HBX A;  5CQ3 A;  4KV4 A;  5EWH A;  4A9F A;  5KU3 A;  4CFL A;  5II1 A;  5E9K A;  5A83 A;  3UW9 A;  4CUS A;  5LJ0 A;  4UYF A;  4IR3 A;  4TZ2 A;  2DWW A;  4O76 A;  3U5J A;  5HQ6 A;  5CUG A;  3FKM X;  4O72 A;  5FE8 A;  4TT6 A;  5ENF A;  2D9E A;  3P1E A;  4KV1 A;  5CS8 A;  3JVJ A;  5FH6 A;  5FDZ A;  3JVM A;  5H85 A;  5KHM A;  5CUB A;  4E96 A;  1F68 A;  4A9E A;  4IOQ A;  4RVR A;  5C8G A;  5FG6 A;  4Y03 A;  3U5P A;  5D24 A;  5CQT A;  3IU6 A;  5DYC A;  4BHW A;  5LKX A;  5EM3 A;  5H1T A;  5KO4 A;  5CQ8 A;  3UV4 A;  3DAI A;  4WHW A;  4CUU A;  5EWD A;  2OUO A;  5DLX A;  4YY4 A;  4O77 A;  5DY7 A;  5BT5 A;  2L85 A;  3O33 A;  4A9M A;  2RNX A;  5IBN A;  4QR4 A;  5E9Y A;  4YYJ A;  2NXB A;  5EPB A;  4UYD A;  5EV9 A;  4PCI A;  4TT2 A;  5G4R A;  3UVW A;  3JVL A;  3NXB A;  5ENH A;  5KTW A;  5H1V A;  4OGI A;  5HJC A;  4QY4 A;  1N72 A;  5EGU A;  3GG3 A;  4QSR A;  2YDW A;  5DYX A;  4A9H A;  5D7X A;  4A9L A;  4BJX A;  5HQ7 A;  4HXR A;  5II2 A;  4FLP A;  5IGN A;  5LKZ A;  5CQ4 A;  4NR5 A;  4YYM A;  4IR5 A;  3UVX A;  4LYI A;  4XUA A;  2YYN A;  4NYV A;  4QEU A;  5ETB A;  5DKH A;  4NRB A;  2L84 A;  4YK0 A;  4QSW A;  4UIV A;  2D82 A;  5I7X A;  5D3S A;  5DKC A;  5HCL A;  5EA1 A;  5I83 A;  3UV5 A;  5F3A A;  5HRX A;  4ZC9 A;  3UVD A;  5E0R A;  4TU6 A;  5E74 A;  3MB4 A;  4A9I A;  4BW2 A;  3QZS A;  3P1D A;  5HM0 A;  2E7O A;  5AD3 A;  5HFQ A;  4XUB A;  1JM4 B;  5COI A;  5IGK A;  4MR5 A;  5CRZ A;  5LVR A;  4HBW A;  5G4S A;  2MJV B;  3HME A;  4YY6 A;  4YBM A;  5LJ2 A;  5E9M A;  3LJW A;  5IG6 A;  5I86 A;  5CZG A;  4UIW A;  5DFC A;  5C7N A;  4C66 A;  5A5O A;  4QUU A;  5ENG A;  5F1H A;  2RS9 B;  4TT4 A;  5I29 A;  5CQ6 A;  5CUC A;  5JWM A;  4QUT A;  5FH7 A;  5L99 A;  5LUU A;  4O7F A;  5C87 A;  2YW5 A;  4A9N A;  3DWY A;  4J0R A;  3G0J A;  5L8U A;  4YAT A;  5FFY A;  5CFW A;  2DVR A;  5AMF A;  5LVQ A;  5F1L A;  2YEK A;  5CUA A;  4N4G A;  5KTU A;  4HXL A;  5FB1 A;  3U5L A;  4O7B A;  4ALH A;  4Z6I A;  4QC1 A;  3MB3 A;  2YEM A;  4QSS A;  5DBM A;  5I1Q A;  4QB3 A;  4YAX A;  5A5N A;  4N4F A;  4QNS A;  4YYD A;  5DYA A;  5E9V A;  5D3R A;  4CUR A;  4NUD A;  5E7D A;  4KCX A;  5CGP A;  5HRV A;  4NR7 A;  4TZ8 A;  5ENJ A;  4Z1Q A;  1WUM A;  4AKN A;  5CY9 A;  3O37 A;  5E3D A;  4MR3 A;  5E73 A;  5H1U A;  4Q0O A;  1X0J A;  4IR6 A;  4CUT A;  5JI8 A;  4O7C A;  4PCE A;  5E3G A;  5HQ5 A;  5EIC A;  3TLP A;  3ZYU A;  2R0Y A;  2KTB B;  4CUQ A;  5EWC A;  5FE3 A;  4MR6 A;  2DVV A;  5CPE A;  5HLS A;  3G0L A;  5EPR A;  5A5R A;  5L98 A;  4TQN A;  5C89 A;  4QSP A;  5L96 A;  3AQA A;  4BW1 A;  4QYD A;  2DVS A;  4J1P A;  4QBM A;  3LQI A;  5CP5 A;  5EWV A;  4QC3 A;  5A5Q A;  4A9J A;  5EK9 A;  4QSU A;  1EQF A;  5LJ1 A;  3S91 A;  4UYG A;  4HXS A;  5EQ1 A;  4QST A;  4UIY A;  4O7E A;  4A9O A;  5FE0 A;  4OGJ A;  5IID A;  3QZV A;  5A81 A;  4NR8 A;  5DFB A;  5ENB A;  3P5O A;  4NYW A;  5TB6 A;  5ENC A;  4YAD A;  4J3I A;  5I88 A;  5HFR A;  5F25 A;  5I7Y A;  5D3T A;  4LR6 A;  4GPJ A;  4X2I A;  4LYS A;  5FH8 A;  4O71 A;  3MXF A;  4YH3 A;  4NYX A;  3SVG A;  5DFD A;  4N3W A;  5AME A;  2F6N A;  4O70 A;  3MUK A;  4UIU A;  2L5E A;  5DW2 A;  2WP1 A;  5F5Z A;  3MQM A;  4NQM A;  1ZS5 A;  4YBS A;  4QSQ A;  2N9G A;  4TYL A;  5HRW A;  4NQN A;  4TU4 A;  4UIZ A;  4DON A;  3U5O A;  5F36 A;  5E9L A;  4PS5 A;  2I7K A;  4QZS A;  2E7N A;  5E9I A;  4OUF A;  5FG4 A;  4O78 A;  4F3I A;  4QEW A;  4NXJ A;  4UYE A;  4IOR A;  3HMH A;  4NRA A;  4YYN A;  4YYK A;  3UV2 A;  2YEL A;  5FBX A;  5CUD A;  4PKL A;  4QEV A;  4N4I A;  5HEN A;  4QR5 A;  1E6I A;  5IGL A;  4YAB A;  4MEQ A;  5FE7 A;  5KTX A;  4ZQL A;  4NR6 A;  4NUC A;  4HXP A;  5FE4 A;  4A9K A;  5LKT A;  3U5N A;  5ACY A;  2R10 A;  5CQ5 A;  2RFJ A;  4MEO A;  4Z1S A;  5EWW A;  2H60 A;  3MUL A;  3P1F A;  4CLB A;  4N4H A;  4BW3 A;  2FSA A;  2YQD A;  5D3P A;  4YC9 A;  5F60 A;  3U5M A;  4IOO A;  4HBV A;  4YYH A;  4CUP A;  3QZT A;  4Z6H A;  3P1C A;  2R0V A;  4WHU A;  5I40 A;  5D3H A;  2R0S A;  2OSS A;  2I8N A;  2G4A A;  5D3N A;  5A5P A;  5BT3 A;  5F62 A;  4YYG A;  5IGM A;  4CFK A;  4LZR A;  4WIV A;  3D7C A;  5CU8 A;  4XY8 A;  4LDF A;  4ALG A;  5F63 A;  3O36 A;  4YH4 A;  4XY9 A;  2GRC A;  4LRG A;  5DKD A;  3LQJ A;  4Q0N A;  3O35 A;  5DX4 A;  3LXJ A;  5TCM A;  4QYL A;  2LSP B;  5A7C A;  5LKU A;  5D3L A;  2WP2 A;  4NRC A;  5CRM A;  5CQ7 A;  3HMF A;  3ONI A;  4MEP A;  3UVY A;  4PTB A;  2DKW A;  5D3J A;  5I89 A;  5A85 A;  5FFV A;  4YYI A; 
#chains in the Genus database with same CATH topology
 2E3K A;  2DAT A;  5D26 A;  4O74 A;  4AI6 A;  5DW1 A;  4BW4 A;  4ZW1 A;  4HXK A;  4O75 A;  5DLZ A;  3SVF A;  4NS5 A;  4HXM A;  4PY6 A;  5FFW A;  4QSV A;  4LC2 A;  5EU1 A;  5A5S A;  3JVK A;  4UIX A;  3AAD A;  2RNY A;  4C67 A;  5FE1 A;  5EIS A;  5AD2 A;  4UYH A;  4NR4 A;  4LZ2 A;  5FB0 A;  3Q2F A;  5C4Q A;  4HBY A;  4XYA A;  2RNW A;  4J0S A;  5BT4 A;  5ETD A;  4MR4 A;  5FE6 A;  5D0C A;  3K2J A;  5C85 A;  5J0D A;  4YBT A;  5EP7 A;  3RCW A;  5DYU A;  5FE9 A;  4O7A A;  5FE5 A;  4Z93 A;  3I3J A;  5HEM A;  3SVH A;  1WUG A;  2RI7 A;  4IR4 A;  4UYF B;  5CQA A;  5EVA A;  5FE2 A;  4TTE A;  4LZS A;  5F61 A;  1JSP B;  5A82 A;  5F2P A;  4NUE A;  4UIT A;  5FG5 A;  2DVQ A;  3S92 A;  5L97 A;  3Q2E A;  3O34 A;  3IU5 A;  4QSX A;  5CUE A;  5ENE A;  5D25 A;  5L8T A;  4QR3 A;  4NR9 A;  4LYW A;  5EI4 A;  3U5K A;  2RO1 A;  5I80 A;  4HXN A;  2F6J A;  5ENI A;  5K29 A;  4MEN A;  5CTL A;  2OO1 A;  4HXO A;  3LQH A;  4TS8 A;  5HEL A;  5EPS A;  4CL9 A;  4HBX A;  5CQ3 A;  4KV4 A;  5EWH A;  4A9F A;  5KU3 A;  4CFL A;  5II1 A;  5E9K A;  5A83 A;  3UW9 A;  4CUS A;  5LJ0 A;  1ZKR A;  4UYF A;  4IR3 A;  4TZ2 A;  2DWW A;  4O76 A;  3U5J A;  5HQ6 A;  5CUG A;  3FKM X;  4O72 A;  5FE8 A;  4TT6 A;  5ENF A;  2D9E A;  3P1E A;  4KV1 A;  5CS8 A;  3JVJ A;  4AKH A;  5FH6 A;  5FDZ A;  3JVM A;  5H85 A;  5KHM A;  5CUB A;  4E96 A;  1F68 A;  4A9E A;  4IOQ A;  4RVR A;  5C8G A;  5FG6 A;  4Y03 A;  3U5P A;  5D24 A;  5CQT A;  3IU6 A;  5DYC A;  4BHW A;  5LKX A;  5EM3 A;  5H1T A;  5KO4 A;  5CQ8 A;  3UV4 A;  3DAI A;  4WHW A;  4CUU A;  5EWD A;  2OUO A;  5DLX A;  4YY4 A;  4O77 A;  5DY7 A;  5BT5 A;  2L85 A;  3O33 A;  4A9M A;  2RNX A;  5IBN A;  4QR4 A;  5E9Y A;  4YYJ A;  2NXB A;  5EPB A;  4UYD A;  3VKH A;  5EV9 A;  4PCI A;  4TT2 A;  5G4R A;  3UVW A;  3JVL A;  4AKG A;  3NXB A;  5ENH A;  5KTW A;  3VKG A;  5H1V A;  4OGI A;  5HJC A;  4QY4 A;  1N72 A;  5EGU A;  3D1D A;  3GG3 A;  4QSR A;  2YDW A;  5DYX A;  4A9H A;  5D7X A;  4A9L A;  4BJX A;  5HQ7 A;  4HXR A;  5II2 A;  4FLP A;  5IGN A;  5LKZ A;  5CQ4 A;  4NR5 A;  4YYM A;  4IR5 A;  3UVX A;  4LYI A;  4XUA A;  2YYN A;  4NYV A;  4QEU A;  5ETB A;  5DKH A;  4NRB A;  2L84 A;  3ERR A;  4YK0 A;  4QSW A;  4UIV A;  2D82 A;  5I7X A;  5D3S A;  5DKC A;  5HCL A;  5EA1 A;  5I83 A;  3UV5 A;  5F3A A;  5HRX A;  4ZC9 A;  3UVD A;  5E0R A;  4TU6 A;  5E74 A;  3MB4 A;  4A9I A;  4BW2 A;  3QZS A;  3P1D A;  5HM0 A;  2E7O A;  5AD3 A;  5HFQ A;  4XUB A;  1JM4 B;  5COI A;  5IGK A;  4MR5 A;  5CRZ A;  5LVR A;  4HBW A;  5G4S A;  2MJV B;  3HME A;  4YY6 A;  4YBM A;  5LJ2 A;  5E9M A;  3LJW A;  5IG6 A;  5I86 A;  5CZG A;  4UIW A;  5DFC A;  5C7N A;  4C66 A;  5A5O A;  4QUU A;  5ENG A;  5F1H A;  2RS9 B;  4TT4 A;  5I29 A;  5CQ6 A;  5CUC A;  5JWM A;  4QUT A;  5FH7 A;  5L99 A;  5LUU A;  4O7F A;  5C87 A;  2YW5 A;  4A9N A;  3DWY A;  4J0R A;  3G0J A;  5L8U A;  4YAT A;  5FFY A;  5CFW A;  2DVR A;  5AMF A;  5LVQ A;  5F1L A;  2YEK A;  5CUA A;  4N4G A;  5KTU A;  4HXL A;  5FB1 A;  3U5L A;  4O7B A;  4ALH A;  4Z6I A;  4QC1 A;  3MB3 A;  2YEM A;  4QSS A;  5DBM A;  2EJN A;  5I1Q A;  4QB3 A;  4YAX A;  5A5N A;  4N4F A;  4QNS A;  4YYD A;  5DYA A;  5E9V A;  5D3R A;  4CUR A;  4NUD A;  5E7D A;  4KCX A;  5CGP A;  5HRV A;  4NR7 A;  4TZ8 A;  5ENJ A;  4Z1Q A;  1WUM A;  4AKN A;  5CY9 A;  3O37 A;  5E3D A;  4MR3 A;  5E73 A;  5H1U A;  4Q0O A;  1X0J A;  4IR6 A;  4CUT A;  5JI8 A;  4O7C A;  4PCE A;  5E3G A;  5HQ5 A;  5EIC A;  3TLP A;  3ZYU A;  2R0Y A;  2KTB B;  4CUQ A;  5EWC A;  5FE3 A;  4MR6 A;  2DVV A;  5CPE A;  5HLS A;  3G0L A;  5EPR A;  5A5R A;  5L98 A;  4TQN A;  5C89 A;  4QSP A;  5L96 A;  3AQA A;  4BW1 A;  4QYD A;  2DVS A;  4J1P A;  4QBM A;  3LQI A;  5CP5 A;  5EWV A;  4QC3 A;  5A5Q A;  4A9J A;  5EK9 A;  4QSU A;  1PUO A;  1EQF A;  5LJ1 A;  3S91 A;  3D1B A;  4UYG A;  4HXS A;  5EQ1 A;  4QST A;  4UIY A;  4O7E A;  4A9O A;  5FE0 A;  4OGJ A;  5IID A;  3QZV A;  5A81 A;  4NR8 A;  5DFB A;  5ENB A;  3P5O A;  4NYW A;  5TB6 A;  5ENC A;  4YAD A;  4J3I A;  5I88 A;  5HFR A;  5F25 A;  5I7Y A;  5D3T A;  4LR6 A;  4GPJ A;  4X2I A;  4LYS A;  5FH8 A;  4O71 A;  3MXF A;  4YH3 A;  4NYX A;  4AKI A;  3SVG A;  5DFD A;  4N3W A;  5AME A;  2F6N A;  4O70 A;  3MUK A;  4UIU A;  2L5E A;  5DW2 A;  2WP1 A;  5F5Z A;  3MQM A;  4NQM A;  1ZS5 A;  4YBS A;  4QSQ A;  2N9G A;  4TYL A;  5HRW A;  4NQN A;  4TU4 A;  4UIZ A;  4DON A;  3U5O A;  5F36 A;  5E9L A;  4PS5 A;  2I7K A;  4QZS A;  2E7N A;  5E9I A;  4OUF A;  5FG4 A;  4O78 A;  4F3I A;  4QEW A;  4NXJ A;  4UYE A;  4IOR A;  3HMH A;  4NRA A;  4YYN A;  4YYK A;  3UV2 A;  2YEL A;  5FBX A;  5CUD A;  4PKL A;  4QEV A;  4N4I A;  5HEN A;  4QR5 A;  1E6I A;  5IGL A;  4YAB A;  4MEQ A;  5FE7 A;  5KTX A;  4ZQL A;  4NR6 A;  4NUC A;  4HXP A;  5FE4 A;  4A9K A;  5LKT A;  3U5N A;  5ACY A;  2R10 A;  5CQ5 A;  2RFJ A;  4MEO A;  4Z1S A;  5EWW A;  2H60 A;  3MUL A;  3P1F A;  4CLB A;  4N4H A;  4BW3 A;  2FSA A;  2YQD A;  5D3P A;  4YC9 A;  5F60 A;  3U5M A;  4IOO A;  4HBV A;  4YYH A;  4CUP A;  3QZT A;  4Z6H A;  3P1C A;  2R0V A;  4WHU A;  5I40 A;  5D3H A;  2R0S A;  2OSS A;  2I8N A;  2G4A A;  5D3N A;  5A5P A;  5BT3 A;  5F62 A;  4YYG A;  5IGM A;  4CFK A;  4LZR A;  4WIV A;  3D7C A;  5CU8 A;  4XY8 A;  4LDF A;  4ALG A;  5F63 A;  3O36 A;  4YH4 A;  4XY9 A;  2GRC A;  4LRG A;  5DKD A;  3LQJ A;  4Q0N A;  3O35 A;  5DX4 A;  3LXJ A;  5TCM A;  4QYL A;  2LSP B;  5A7C A;  5LKU A;  5D3L A;  2WP2 A;  4NRC A;  5CRM A;  5CQ7 A;  3HMF A;  3ONI A;  4MEP A;  3UVY A;  4PTB A;  2DKW A;  5D3J A;  5I89 A;  5A85 A;  5FFV A;  4YYI A; 
#chains in the Genus database with same CATH homology
 2E3K A;  2DAT A;  5D26 A;  4O74 A;  5DW1 A;  4BW4 A;  4ZW1 A;  4HXK A;  4O75 A;  5DLZ A;  3SVF A;  4NS5 A;  4HXM A;  4PY6 A;  5FFW A;  4QSV A;  4LC2 A;  5EU1 A;  5A5S A;  3JVK A;  4UIX A;  3AAD A;  2RNY A;  4C67 A;  5FE1 A;  5EIS A;  5AD2 A;  4UYH A;  4NR4 A;  4LZ2 A;  5FB0 A;  3Q2F A;  5C4Q A;  4HBY A;  4XYA A;  2RNW A;  4J0S A;  5BT4 A;  5ETD A;  4MR4 A;  5FE6 A;  5D0C A;  3K2J A;  5C85 A;  5J0D A;  4YBT A;  5EP7 A;  3RCW A;  5DYU A;  5FE9 A;  4O7A A;  5FE5 A;  4Z93 A;  3I3J A;  5HEM A;  3SVH A;  1WUG A;  2RI7 A;  4IR4 A;  4UYF B;  5CQA A;  5EVA A;  5FE2 A;  4TTE A;  4LZS A;  5F61 A;  1JSP B;  5A82 A;  5F2P A;  4NUE A;  4UIT A;  5FG5 A;  2DVQ A;  3S92 A;  5L97 A;  3Q2E A;  3O34 A;  3IU5 A;  4QSX A;  5CUE A;  5ENE A;  5D25 A;  5L8T A;  4QR3 A;  4NR9 A;  4LYW A;  5EI4 A;  3U5K A;  2RO1 A;  5I80 A;  4HXN A;  2F6J A;  5ENI A;  5K29 A;  4MEN A;  5CTL A;  2OO1 A;  4HXO A;  3LQH A;  4TS8 A;  5HEL A;  5EPS A;  4CL9 A;  4HBX A;  5CQ3 A;  4KV4 A;  5EWH A;  4A9F A;  5KU3 A;  4CFL A;  5II1 A;  5E9K A;  5A83 A;  3UW9 A;  4CUS A;  5LJ0 A;  4UYF A;  4IR3 A;  4TZ2 A;  2DWW A;  4O76 A;  3U5J A;  5HQ6 A;  5CUG A;  3FKM X;  4O72 A;  5FE8 A;  4TT6 A;  5ENF A;  2D9E A;  3P1E A;  4KV1 A;  5CS8 A;  3JVJ A;  5FH6 A;  5FDZ A;  3JVM A;  5H85 A;  5KHM A;  5CUB A;  4E96 A;  1F68 A;  4A9E A;  4IOQ A;  4RVR A;  5C8G A;  5FG6 A;  4Y03 A;  3U5P A;  5D24 A;  5CQT A;  3IU6 A;  5DYC A;  4BHW A;  5LKX A;  5EM3 A;  5H1T A;  5KO4 A;  5CQ8 A;  3UV4 A;  3DAI A;  4WHW A;  4CUU A;  5EWD A;  2OUO A;  5DLX A;  4YY4 A;  4O77 A;  5DY7 A;  5BT5 A;  2L85 A;  3O33 A;  4A9M A;  2RNX A;  5IBN A;  4QR4 A;  5E9Y A;  4YYJ A;  2NXB A;  5EPB A;  4UYD A;  5EV9 A;  4PCI A;  4TT2 A;  5G4R A;  3UVW A;  3JVL A;  3NXB A;  5ENH A;  5KTW A;  5H1V A;  4OGI A;  5HJC A;  4QY4 A;  1N72 A;  5EGU A;  3GG3 A;  4QSR A;  2YDW A;  5DYX A;  4A9H A;  5D7X A;  4A9L A;  4BJX A;  5HQ7 A;  4HXR A;  5II2 A;  4FLP A;  5IGN A;  5LKZ A;  5CQ4 A;  4NR5 A;  4YYM A;  4IR5 A;  3UVX A;  4LYI A;  4XUA A;  2YYN A;  4NYV A;  4QEU A;  5ETB A;  5DKH A;  4NRB A;  2L84 A;  4YK0 A;  4QSW A;  4UIV A;  2D82 A;  5I7X A;  5D3S A;  5DKC A;  5HCL A;  5EA1 A;  5I83 A;  3UV5 A;  5F3A A;  5HRX A;  4ZC9 A;  3UVD A;  5E0R A;  4TU6 A;  5E74 A;  3MB4 A;  4A9I A;  4BW2 A;  3QZS A;  3P1D A;  5HM0 A;  2E7O A;  5AD3 A;  5HFQ A;  4XUB A;  1JM4 B;  5COI A;  5IGK A;  4MR5 A;  5CRZ A;  5LVR A;  4HBW A;  5G4S A;  2MJV B;  3HME A;  4YY6 A;  4YBM A;  5LJ2 A;  5E9M A;  3LJW A;  5IG6 A;  5I86 A;  5CZG A;  4UIW A;  5DFC A;  5C7N A;  4C66 A;  5A5O A;  4QUU A;  5ENG A;  5F1H A;  2RS9 B;  4TT4 A;  5I29 A;  5CQ6 A;  5CUC A;  5JWM A;  4QUT A;  5FH7 A;  5L99 A;  5LUU A;  4O7F A;  5C87 A;  2YW5 A;  4A9N A;  3DWY A;  4J0R A;  3G0J A;  5L8U A;  4YAT A;  5FFY A;  5CFW A;  2DVR A;  5AMF A;  5LVQ A;  5F1L A;  2YEK A;  5CUA A;  4N4G A;  5KTU A;  4HXL A;  5FB1 A;  3U5L A;  4O7B A;  4ALH A;  4Z6I A;  4QC1 A;  3MB3 A;  2YEM A;  4QSS A;  5DBM A;  5I1Q A;  4QB3 A;  4YAX A;  5A5N A;  4N4F A;  4QNS A;  4YYD A;  5DYA A;  5E9V A;  5D3R A;  4CUR A;  4NUD A;  5E7D A;  4KCX A;  5CGP A;  5HRV A;  4NR7 A;  4TZ8 A;  5ENJ A;  4Z1Q A;  1WUM A;  4AKN A;  5CY9 A;  3O37 A;  5E3D A;  4MR3 A;  5E73 A;  5H1U A;  4Q0O A;  1X0J A;  4IR6 A;  4CUT A;  5JI8 A;  4O7C A;  4PCE A;  5E3G A;  5HQ5 A;  5EIC A;  3TLP A;  3ZYU A;  2R0Y A;  2KTB B;  4CUQ A;  5EWC A;  5FE3 A;  4MR6 A;  2DVV A;  5CPE A;  5HLS A;  3G0L A;  5EPR A;  5A5R A;  5L98 A;  4TQN A;  5C89 A;  4QSP A;  5L96 A;  3AQA A;  4BW1 A;  4QYD A;  2DVS A;  4J1P A;  4QBM A;  3LQI A;  5CP5 A;  5EWV A;  4QC3 A;  5A5Q A;  4A9J A;  5EK9 A;  4QSU A;  1EQF A;  5LJ1 A;  3S91 A;  4UYG A;  4HXS A;  5EQ1 A;  4QST A;  4UIY A;  4O7E A;  4A9O A;  5FE0 A;  4OGJ A;  5IID A;  3QZV A;  5A81 A;  4NR8 A;  5DFB A;  5ENB A;  3P5O A;  4NYW A;  5TB6 A;  5ENC A;  4YAD A;  4J3I A;  5I88 A;  5HFR A;  5F25 A;  5I7Y A;  5D3T A;  4LR6 A;  4GPJ A;  4X2I A;  4LYS A;  5FH8 A;  4O71 A;  3MXF A;  4YH3 A;  4NYX A;  3SVG A;  5DFD A;  4N3W A;  5AME A;  2F6N A;  4O70 A;  3MUK A;  4UIU A;  2L5E A;  5DW2 A;  2WP1 A;  5F5Z A;  3MQM A;  4NQM A;  1ZS5 A;  4YBS A;  4QSQ A;  2N9G A;  4TYL A;  5HRW A;  4NQN A;  4TU4 A;  4UIZ A;  4DON A;  3U5O A;  5F36 A;  5E9L A;  4PS5 A;  2I7K A;  4QZS A;  2E7N A;  5E9I A;  4OUF A;  5FG4 A;  4O78 A;  4F3I A;  4QEW A;  4NXJ A;  4UYE A;  4IOR A;  3HMH A;  4NRA A;  4YYN A;  4YYK A;  3UV2 A;  2YEL A;  5FBX A;  5CUD A;  4PKL A;  4QEV A;  4N4I A;  5HEN A;  4QR5 A;  1E6I A;  5IGL A;  4YAB A;  4MEQ A;  5FE7 A;  5KTX A;  4ZQL A;  4NR6 A;  4NUC A;  4HXP A;  5FE4 A;  4A9K A;  5LKT A;  3U5N A;  5ACY A;  2R10 A;  5CQ5 A;  2RFJ A;  4MEO A;  4Z1S A;  5EWW A;  2H60 A;  3MUL A;  3P1F A;  4CLB A;  4N4H A;  4BW3 A;  2FSA A;  2YQD A;  5D3P A;  4YC9 A;  5F60 A;  3U5M A;  4IOO A;  4HBV A;  4YYH A;  4CUP A;  3QZT A;  4Z6H A;  3P1C A;  2R0V A;  4WHU A;  5I40 A;  5D3H A;  2R0S A;  2OSS A;  2I8N A;  2G4A A;  5D3N A;  5A5P A;  5BT3 A;  5F62 A;  4YYG A;  5IGM A;  4CFK A;  4LZR A;  4WIV A;  3D7C A;  5CU8 A;  4XY8 A;  4LDF A;  4ALG A;  5F63 A;  3O36 A;  4YH4 A;  4XY9 A;  2GRC A;  4LRG A;  5DKD A;  3LQJ A;  4Q0N A;  3O35 A;  5DX4 A;  3LXJ A;  5TCM A;  4QYL A;  2LSP B;  5A7C A;  5LKU A;  5D3L A;  2WP2 A;  4NRC A;  5CRM A;  5CQ7 A;  3HMF A;  3ONI A;  4MEP A;  3UVY A;  4PTB A;  2DKW A;  5D3J A;  5I89 A;  5A85 A;  5FFV A;  4YYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...