4NYWA

Crystal structure of the bromodomain of human crebbp in complex with a dihydroquinoxalinone ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
116
structure length
116
Chain Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords CREB-binding protein
publication title Crystal Structure of the Bromodomain of human CREBBP in complex with a dihydroquinoxalinone ligand
rcsb
source organism Homo sapiens
total genus 41
structure length 116
sequence length 116
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4nywA00
5HELA 1ZS5A 2D9EA 5FG4A 5F36A 4PY6A 2R0SA 4IR5A 2E7NA 4O71A 4QSWA 2D82A 5FBXA 4CLBA 5CFWA 3UVWA 4HXSA 3SVFA 5CP5A 5F5ZA 4A9KA 4J1PA 4NQMA 5I83A 4J0SA 2DVVA 5FG6A 4DONA 1WUGA 2OUOA 5E9VA 1JSPB 3AQAA 4O7AA 4OGJA 5ETBA 4HBXA 4QSQA 5HRWA 5EI4A 3S91A 4QR5A 3JVKA 1WUMA 4BW3A 4O7FA 5IGNA 2DVRA 5CQ7A 4ZC9A 3FKMX 4PS5A 4J0RA 4J3IA 5EWDA 5I80A 4TT4A 5CQ3A 5D3JA 2I7KA 3MQMA 4UIUA 5FE5A 3IU5A 4NR4A 4Q0NA 5E9KA 2E3KA 4NS5A 5E9LA 4QB3A 5DYAA 5G4RA 4BW2A 5A5OA 5ETDA 4Q0OA 4LZRA 5EGUA 3P1FA 5DLZA 5DFBA 2MJVB 1N72A 5F1LA 3MULA 4O76A 3U5MA 5HFRA 5CQ5A 4QSXA 3UV5A 3S92A 3U5OA 4NYVA 5HRVA 5DW2A 5CRZA 3HMHA 4C66A 5E0RA 4MR3A 4XUAA 4QYDA 3JVMA 4NR8A 4BJXA 5EK9A 5DYUA 5CUGA 4WHWA 4X2IA 4ZW1A 4XY8A 5F1HA 5EPBA 4HXPA 5A5PA 4HXOA 4IOQA 5F61A 5E3GA 4QSVA 2KTBB 4Y03A 5DKHA 3IU6A 5EA1A 5E73A 5IGKA 5FH8A 2RNXA 4LZSA 3AADA 2YYNA 2F6NA 3MUKA 4ZQLA 3JVLA 4NRAA 5CUAA 4TT6A 5A7CA 4A9LA 4CUQA 4YBSA 5E3DA 5IIDA 4KCXA 5CUDA 5HQ5A 4QYLA 4F3IA 4UIYA 5LJ0A 4BW4A 4NUDA 5D3NA 4BHWA 5LVRA 5AD2A 5AMFA 3U5JA 5BT4A 5COIA 5CU8A 3HMFA 4YYIA 5HJCA 4QZSA 5AD3A 3UVDA 2DKWA 4MR4A 5DKDA 5I1QA 5LKXA 4MENA 4HXLA 3LQHA 4UIZA 4QNSA 4YYKA 2R0YA 4QEVA 5C8GA 2F6JA 5IGMA 4N4FA 5FG5A 2H60A 4FLPA 5CZGA 4ALGA 4UYDA 5D3HA 4YK0A 5E9MA 5EWWA 3DWYA 5F60A 2G4AA 3TLPA 3JVJA 3DAIA 2YDWA 4QY4A 5CQ4A 5E7DA 4CUTA 4YH4A 5DFCA 3MXFA 4YYHA 2WP1A 5JWMA 4HXNA 3O37A 1E6IA 5A82A 5LKZA 5H1TA 4O75A 5F25A 5A85A 3LQJA 4LR6A 4NUCA 5ENJA 3G0LA 4QSRA 4CUSA 4YBTA 4QEWA 5FB0A 2YW5A 3UV4A 2RI7A 5DKCA 4LYSA 5L8UA 4A9FA 5ENEA 5EV9A 5D26A 2R10A 5II2A 5FFVA 4LYWA 5EU1A 4CUUA 4HBWA 5F63A 3Q2FA 4WHUA 5HEMA 4QC3A 2RFJA 4IR6A 3D7CA 4CL9A 2GRCA 3NXBA 3ZYUA 2R0VA 4XYAA 5I29A 5H1VA 4MEQA 4N4IA 5EQ1A 5DY7A 5G4SA 5KTXA 4CFLA 5EVAA 5LUUA 4OUFA 4HBVA 3P1DA 5H85A 4O78A 4TZ8A 4A9JA 5F3AA 3QZTA 4YY6A 5I40A 4QBMA 5I7YA 5CQAA 4QSPA 4UYHA 4IR4A 5DBMA 4Z6HA 4QR4A 5CPEA 3UVYA 4NR6A 4AKNA 3U5NA 4UIVA 4LRGA 5EP7A 5CUEA 4LDFA 4BW1A 4MEOA 5KO4A 4O7BA 5FB1A 1X0JA 4UIWA 4O70A 5L8TA 5I89A 3P1EA 4OGIA 4YH3A 5ENIA 4A9EA 2N9GA 4QR3A 3I3JA 4TZ2A 5EWCA 3P1CA 2NXBA 5EWVA 5HLSA 5L98A 5ENGA 3K2JA 4YYNA 4QEUA 3HMEA 5EICA 4YBMA 4O7CA 4QUTA 4MR6A 4YYDA 4IORA 4O72A 2WP2A 4NUEA 5KTUA 5FE7A 4O77A 4C67A 2DVSA 5AMEA 5ACYA 4A9OA 4A9MA 4RVRA 2RS9B 3P5OA 5D24A 5C4QA 5K29A 5FE3A 2DWWA 5FFWA 2LSPB 5IBNA 4N4HA 4QUUA 5ENFA 5EM3A 4TTEA 5J0DA 4HBYA 4XUBA 5CTLA 4PKLA 5FH6A 5BT5A 5ENBA 4IR3A 5A83A 5FE0A 3SVHA 2RNWA 5E9YA 4LZ2A 3O35A 5EWHA 4Z6IA 5L97A 4NYXA 4TS8A 2L5EA 5C87A 5LJ1A 1EQFA 5HCLA 5ENHA 3LQIA 5F62A 4A9IA 3QZVA 4XY9A 5D3SA 3UV2A 4Z1QA 5FH7A 5D7XA 5D0CA 4MEPA 4TQNA 4NRBA 4O74A 4HXMA 4E96A 2OSSA 5KTWA 5A5QA 4UYEA 4KV4A 5EPRA 4MR5A 4NQNA 4UIXA 5KHMA 4CFKA 5A81A 4TYLA 3QZSA 5H1UA 3LXJA 5CUBA 5DX4A 5L99A 3RCWA 5E74A 3GG3A 5FE4A 3G0JA 4UYFA 3ONIA 5HENA 3UW9A 5FE2A 2L85A 4QC1A 3U5KA 4NR5A 4Z1SA 4PCIA 4GPJA 5DW1A 4KV1A 5A5RA 5L96A 5KU3A 5D3RA 3MB4A 4NXJA 4YC9A 3MB3A 4CURA 1F68A 5A5SA 5TCMA 4YAXA 4NR9A 4NRCA 5CQTA 2E7OA 2YEMA 5C7NA 5C89A 4N4GA 2OO1A 3SVGA 4TU6A 4YYMA 2YELA 4PCEA 5C85A 5CS8A 5HM0A 5CQ8A 1JM4B 2L84A 5II1A 5LKTA 4CUPA 5DYCA 5I86A 5CQ6A 4N3WA 5D25A 5I88A 4A9NA 4IOOA 5DYXA 5A5NA 5FE6A 5DFDA 3U5LA 4NYWA 3O36A 2FSAA 4WIVA 5E9IA 4TT2A 5FE1A 5BT3A 4PTBA 4HXKA 4YADA 4UYFB 5HQ6A 3UVXA 5F2PA 3U5PA 5LVQA 4O7EA 5HQ7A 4HXRA 5CY9A 4A9HA 5CGPA 5ENCA 3O34A 5TB6A 5CUCA 4QSTA 4YYJA 5HRXA 4Z93A 5FE8A 5I7XA 2DATA 4ALHA 5CRMA 4YATA 5EISA 4LYIA 5FE9A 5DLXA 5EPSA 2DVQA 4QSUA 4YYGA 4YY4A 4YABA 3Q2EA 5JI8A 5D3PA 2I8NA 2YEKA 4QSSA 2RO1A 3O33A 4NR7A 4LC2A 2RNYA 5IG6A 5LJ2A 5LKUA 2YQDA 4UITA 4UYGA 5D3TA 5FFYA 4TU4A 5FDZA 5D3LA 5HFQA 5IGLA 3LJWA
chains in the Genus database with same CATH superfamily
5HELA 1ZS5A 2D9EA 5FG4A 5F36A 3VKGA 4PY6A 2R0SA 4IR5A 2E7NA 4O71A 4QSWA 2D82A 5FBXA 4CLBA 5CFWA 3UVWA 4HXSA 3SVFA 5CP5A 5F5ZA 4A9KA 4J1PA 4NQMA 5I83A 4J0SA 2DVVA 4AKGA 5FG6A 4DONA 1WUGA 2OUOA 5E9VA 1JSPB 3AQAA 4O7AA 4OGJA 5ETBA 4HBXA 4QSQA 5HRWA 5EI4A 3S91A 4QR5A 3JVKA 1WUMA 4BW3A 4O7FA 5IGNA 2DVRA 5CQ7A 4ZC9A 3FKMX 4PS5A 4J0RA 4J3IA 5EWDA 5I80A 4TT4A 5CQ3A 5D3JA 2I7KA 3MQMA 4UIUA 5FE5A 3IU5A 4NR4A 4Q0NA 5E9KA 2E3KA 4NS5A 5E9LA 2EJNA 4QB3A 5DYAA 5G4RA 4BW2A 5A5OA 5ETDA 4Q0OA 4LZRA 5EGUA 3P1FA 5DLZA 5DFBA 2MJVB 1N72A 5F1LA 3MULA 4O76A 3U5MA 5HFRA 5CQ5A 4QSXA 3UV5A 3S92A 3U5OA 4NYVA 5HRVA 5DW2A 3ERRA 5CRZA 3HMHA 4C66A 5E0RA 4MR3A 4XUAA 4QYDA 3JVMA 4NR8A 4BJXA 5EK9A 5DYUA 5CUGA 4WHWA 4X2IA 4ZW1A 4XY8A 5F1HA 5EPBA 4HXPA 5A5PA 4HXOA 4IOQA 5F61A 5E3GA 4QSVA 2KTBB 4Y03A 5DKHA 3IU6A 5EA1A 5E73A 5IGKA 5FH8A 2RNXA 4LZSA 3AADA 2YYNA 2F6NA 3MUKA 4ZQLA 3JVLA 4NRAA 5CUAA 4TT6A 5A7CA 4A9LA 4CUQA 4YBSA 5E3DA 5IIDA 4KCXA 5CUDA 5HQ5A 4QYLA 4F3IA 4UIYA 5LJ0A 4BW4A 4NUDA 5D3NA 4BHWA 5LVRA 5AD2A 5AMFA 3U5JA 5BT4A 5COIA 5CU8A 3HMFA 4YYIA 5HJCA 4QZSA 5AD3A 3UVDA 4AI6A 2DKWA 4MR4A 5DKDA 5I1QA 5LKXA 4MENA 4HXLA 3LQHA 4UIZA 4QNSA 4YYKA 2R0YA 4QEVA 5C8GA 2F6JA 5IGMA 4N4FA 5FG5A 2H60A 4FLPA 5CZGA 4ALGA 4UYDA 5D3HA 4YK0A 5E9MA 5EWWA 3DWYA 5F60A 2G4AA 3TLPA 3JVJA 3DAIA 2YDWA 4QY4A 5CQ4A 5E7DA 4CUTA 4YH4A 5DFCA 3MXFA 4YYHA 2WP1A 5JWMA 4HXNA 3O37A 1E6IA 5A82A 5LKZA 5H1TA 4O75A 5F25A 5A85A 3LQJA 4LR6A 4NUCA 5ENJA 3G0LA 4QSRA 4CUSA 4YBTA 4QEWA 5FB0A 2YW5A 3UV4A 2RI7A 5DKCA 4LYSA 5L8UA 4A9FA 5ENEA 5EV9A 5D26A 2R10A 5II2A 5FFVA 4LYWA 5EU1A 4CUUA 4HBWA 5F63A 3Q2FA 4WHUA 5HEMA 4QC3A 2RFJA 4IR6A 3D7CA 4CL9A 2GRCA 3NXBA 3ZYUA 2R0VA 4XYAA 5I29A 5H1VA 4MEQA 4N4IA 5EQ1A 5DY7A 5G4SA 5KTXA 4CFLA 5EVAA 5LUUA 4OUFA 4HBVA 3P1DA 5H85A 4O78A 4TZ8A 4A9JA 5F3AA 3QZTA 4YY6A 5I40A 4QBMA 5I7YA 5CQAA 4QSPA 4UYHA 4IR4A 5DBMA 4Z6HA 4QR4A 5CPEA 3UVYA 4NR6A 4AKNA 3U5NA 4UIVA 4LRGA 5EP7A 5CUEA 4LDFA 4BW1A 4MEOA 5KO4A 4O7BA 5FB1A 1X0JA 4UIWA 4O70A 5L8TA 5I89A 3P1EA 4OGIA 4YH3A 5ENIA 4A9EA 2N9GA 4QR3A 3I3JA 4TZ2A 5EWCA 3P1CA 2NXBA 5EWVA 3D1BA 5HLSA 5L98A 5ENGA 3K2JA 4YYNA 4QEUA 3HMEA 5EICA 4YBMA 4O7CA 4QUTA 4MR6A 4YYDA 4IORA 4O72A 2WP2A 4NUEA 5KTUA 5FE7A 4O77A 4C67A 2DVSA 5AMEA 5ACYA 4A9OA 4A9MA 4RVRA 2RS9B 3P5OA 5D24A 5C4QA 5K29A 5FE3A 2DWWA 4AKHA 5FFWA 2LSPB 5IBNA 4N4HA 4QUUA 5ENFA 5EM3A 4TTEA 5J0DA 4HBYA 4XUBA 5CTLA 4PKLA 5FH6A 5BT5A 5ENBA 4IR3A 5A83A 5FE0A 3SVHA 2RNWA 5E9YA 4LZ2A 3O35A 5EWHA 4Z6IA 5L97A 4NYXA 4TS8A 2L5EA 5C87A 5LJ1A 1EQFA 5HCLA 5ENHA 3LQIA 5F62A 3VKHA 4A9IA 3QZVA 4XY9A 5D3SA 3UV2A 4Z1QA 5FH7A 5D7XA 5D0CA 4MEPA 4TQNA 4NRBA 4O74A 4HXMA 4E96A 2OSSA 5KTWA 5A5QA 4UYEA 4KV4A 5EPRA 4MR5A 4NQNA 4UIXA 5KHMA 4CFKA 5A81A 4TYLA 3QZSA 5H1UA 3LXJA 5CUBA 5DX4A 5L99A 3RCWA 5E74A 3GG3A 1PUOA 5FE4A 3G0JA 4UYFA 3ONIA 5HENA 3UW9A 5FE2A 2L85A 4QC1A 3U5KA 4NR5A 4Z1SA 4PCIA 4GPJA 5DW1A 4KV1A 5A5RA 5L96A 5KU3A 5D3RA 3MB4A 4NXJA 4YC9A 3MB3A 4CURA 1F68A 5A5SA 5TCMA 4YAXA 4NR9A 4NRCA 5CQTA 2E7OA 2YEMA 5C7NA 5C89A 4N4GA 2OO1A 3SVGA 4TU6A 4YYMA 2YELA 4PCEA 5C85A 5CS8A 5HM0A 5CQ8A 1JM4B 2L84A 5II1A 5LKTA 4CUPA 5DYCA 5I86A 5CQ6A 1ZKRA 4N3WA 5D25A 5I88A 4A9NA 4IOOA 5DYXA 5A5NA 5FE6A 5DFDA 3U5LA 4NYWA 3O36A 2FSAA 4WIVA 5E9IA 4TT2A 5FE1A 5BT3A 4PTBA 4HXKA 4YADA 4UYFB 5HQ6A 3UVXA 5F2PA 3U5PA 5LVQA 4O7EA 4AKIA 5HQ7A 4HXRA 5CY9A 4A9HA 5CGPA 5ENCA 3O34A 5TB6A 5CUCA 4QSTA 4YYJA 5HRXA 4Z93A 5FE8A 5I7XA 2DATA 4ALHA 5CRMA 4YATA 5EISA 3D1DA 4LYIA 5DLXA 5FE9A 5EPSA 2DVQA 4QSUA 4YYGA 4YY4A 4YABA 3Q2EA 5JI8A 5D3PA 2I8NA 2YEKA 4QSSA 2RO1A 3O33A 4NR7A 4LC2A 2RNYA 5IG6A 5LJ2A 5LKUA 2YQDA 4UITA 4UYGA 5D3TA 5FFYA 4TU4A 5FDZA 5D3LA 5HFQA 5IGLA 3LJWA
chains in the Genus database with same CATH topology
5HELA 1ZS5A 2D9EA 5FG4A 5F36A 4PY6A 2R0SA 4IR5A 2E7NA 4O71A 4QSWA 2D82A 5FBXA 4CLBA 5CFWA 3UVWA 4HXSA 3SVFA 5CP5A 5F5ZA 4A9KA 4J1PA 4NQMA 5I83A 4J0SA 2DVVA 5FG6A 4DONA 1WUGA 2OUOA 5E9VA 1JSPB 3AQAA 4O7AA 4OGJA 5ETBA 4HBXA 4QSQA 5HRWA 5EI4A 3S91A 4QR5A 3JVKA 1WUMA 4BW3A 4O7FA 5IGNA 2DVRA 5CQ7A 4ZC9A 3FKMX 4PS5A 4J0RA 4J3IA 5EWDA 5I80A 4TT4A 5CQ3A 5D3JA 2I7KA 3MQMA 4UIUA 5FE5A 3IU5A 4NR4A 4Q0NA 5E9KA 2E3KA 4NS5A 5E9LA 4QB3A 5DYAA 5G4RA 4BW2A 5A5OA 5ETDA 4Q0OA 4LZRA 5EGUA 3P1FA 5DLZA 5DFBA 2MJVB 1N72A 5F1LA 3MULA 4O76A 3U5MA 5HFRA 5CQ5A 4QSXA 3UV5A 3S92A 3U5OA 4NYVA 5HRVA 5DW2A 5CRZA 3HMHA 4C66A 5E0RA 4MR3A 4XUAA 4QYDA 3JVMA 4NR8A 4BJXA 5EK9A 5DYUA 5CUGA 4WHWA 4X2IA 4ZW1A 4XY8A 5F1HA 5EPBA 4HXPA 5A5PA 4HXOA 4IOQA 5F61A 5E3GA 4QSVA 2KTBB 4Y03A 5DKHA 3IU6A 5EA1A 5E73A 5IGKA 5FH8A 2RNXA 4LZSA 3AADA 2YYNA 2F6NA 3MUKA 4ZQLA 3JVLA 4NRAA 5CUAA 4TT6A 5A7CA 4A9LA 4CUQA 4YBSA 5E3DA 5IIDA 4KCXA 5CUDA 5HQ5A 4QYLA 4F3IA 4UIYA 5LJ0A 4BW4A 4NUDA 5D3NA 4BHWA 5LVRA 5AD2A 5AMFA 3U5JA 5BT4A 5COIA 5CU8A 3HMFA 4YYIA 5HJCA 4QZSA 5AD3A 3UVDA 2DKWA 4MR4A 5DKDA 5I1QA 5LKXA 4MENA 4HXLA 3LQHA 4UIZA 4QNSA 4YYKA 2R0YA 4QEVA 5C8GA 2F6JA 5IGMA 4N4FA 5FG5A 2H60A 4FLPA 5CZGA 4ALGA 4UYDA 5D3HA 4YK0A 5E9MA 5EWWA 3DWYA 5F60A 2G4AA 3TLPA 3JVJA 3DAIA 2YDWA 4QY4A 5CQ4A 5E7DA 4CUTA 4YH4A 5DFCA 3MXFA 4YYHA 2WP1A 5JWMA 4HXNA 3O37A 1E6IA 5A82A 5LKZA 5H1TA 4O75A 5F25A 5A85A 3LQJA 4LR6A 4NUCA 5ENJA 3G0LA 4QSRA 4CUSA 4YBTA 4QEWA 5FB0A 2YW5A 3UV4A 2RI7A 5DKCA 4LYSA 5L8UA 4A9FA 5ENEA 5EV9A 5D26A 2R10A 5II2A 5FFVA 4LYWA 5EU1A 4CUUA 4HBWA 5F63A 3Q2FA 4WHUA 5HEMA 4QC3A 2RFJA 4IR6A 3D7CA 4CL9A 2GRCA 3NXBA 3ZYUA 2R0VA 4XYAA 5I29A 5H1VA 4MEQA 4N4IA 5EQ1A 5DY7A 5G4SA 5KTXA 4CFLA 5EVAA 5LUUA 4OUFA 4HBVA 3P1DA 5H85A 4O78A 4TZ8A 4A9JA 5F3AA 3QZTA 4YY6A 5I40A 4QBMA 5I7YA 5CQAA 4QSPA 4UYHA 4IR4A 5DBMA 4Z6HA 4QR4A 5CPEA 3UVYA 4NR6A 4AKNA 3U5NA 4UIVA 4LRGA 5EP7A 5CUEA 4LDFA 4BW1A 4MEOA 5KO4A 4O7BA 5FB1A 1X0JA 4UIWA 4O70A 5L8TA 5I89A 3P1EA 4OGIA 4YH3A 5ENIA 4A9EA 2N9GA 4QR3A 3I3JA 4TZ2A 5EWCA 3P1CA 2NXBA 5EWVA 5HLSA 5L98A 5ENGA 3K2JA 4YYNA 4QEUA 3HMEA 5EICA 4YBMA 4O7CA 4QUTA 4MR6A 4YYDA 4IORA 4O72A 2WP2A 4NUEA 5KTUA 5FE7A 4O77A 4C67A 2DVSA 5AMEA 5ACYA 4A9OA 4A9MA 4RVRA 2RS9B 3P5OA 5D24A 5C4QA 5K29A 5FE3A 2DWWA 5FFWA 2LSPB 5IBNA 4N4HA 4QUUA 5ENFA 5EM3A 4TTEA 5J0DA 4HBYA 4XUBA 5CTLA 4PKLA 5FH6A 5BT5A 5ENBA 4IR3A 5A83A 5FE0A 3SVHA 2RNWA 5E9YA 4LZ2A 3O35A 5EWHA 4Z6IA 5L97A 4NYXA 4TS8A 2L5EA 5C87A 5LJ1A 1EQFA 5HCLA 5ENHA 3LQIA 5F62A 4A9IA 3QZVA 4XY9A 5D3SA 3UV2A 4Z1QA 5FH7A 5D7XA 5D0CA 4MEPA 4TQNA 4NRBA 4O74A 4HXMA 4E96A 2OSSA 5KTWA 5A5QA 4UYEA 4KV4A 5EPRA 4MR5A 4NQNA 4UIXA 5KHMA 4CFKA 5A81A 4TYLA 3QZSA 5H1UA 3LXJA 5CUBA 5DX4A 5L99A 3RCWA 5E74A 3GG3A 5FE4A 3G0JA 4UYFA 3ONIA 5HENA 3UW9A 5FE2A 2L85A 4QC1A 3U5KA 4NR5A 4Z1SA 4PCIA 4GPJA 5DW1A 4KV1A 5A5RA 5L96A 5KU3A 5D3RA 3MB4A 4NXJA 4YC9A 3MB3A 4CURA 1F68A 5A5SA 5TCMA 4YAXA 4NR9A 4NRCA 5CQTA 2E7OA 2YEMA 5C7NA 5C89A 4N4GA 2OO1A 3SVGA 4TU6A 4YYMA 2YELA 4PCEA 5C85A 5CS8A 5HM0A 5CQ8A 1JM4B 2L84A 5II1A 5LKTA 4CUPA 5DYCA 5I86A 5CQ6A 4N3WA 5D25A 5I88A 4A9NA 4IOOA 5DYXA 5A5NA 5FE6A 5DFDA 3U5LA 4NYWA 3O36A 2FSAA 4WIVA 5E9IA 4TT2A 5FE1A 5BT3A 4PTBA 4HXKA 4YADA 4UYFB 5HQ6A 3UVXA 5F2PA 3U5PA 5LVQA 4O7EA 5HQ7A 4HXRA 5CY9A 4A9HA 5CGPA 5ENCA 3O34A 5TB6A 5CUCA 4QSTA 4YYJA 5HRXA 4Z93A 5FE8A 5I7XA 2DATA 4ALHA 5CRMA 4YATA 5EISA 4LYIA 5FE9A 5DLXA 5EPSA 2DVQA 4QSUA 4YYGA 4YY4A 4YABA 3Q2EA 5JI8A 5D3PA 2I8NA 2YEKA 4QSSA 2RO1A 3O33A 4NR7A 4LC2A 2RNYA 5IG6A 5LJ2A 5LKUA 2YQDA 4UITA 4UYGA 5D3TA 5FFYA 4TU4A 5FDZA 5D3LA 5HFQA 5IGLA 3LJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEL A;  1ZS5 A;  2D9E A;  5FG4 A;  5F36 A;  4PY6 A;  2R0S A;  4IR5 A;  2E7N A;  4O71 A;  4QSW A;  2D82 A;  5FBX A;  4CLB A;  5CFW A;  3UVW A;  4HXS A;  3SVF A;  5CP5 A;  5F5Z A;  4A9K A;  4J1P A;  4NQM A;  5I83 A;  4J0S A;  2DVV A;  5FG6 A;  4DON A;  1WUG A;  2OUO A;  5E9V A;  1JSP B;  3AQA A;  4O7A A;  4OGJ A;  5ETB A;  4HBX A;  4QSQ A;  5HRW A;  5EI4 A;  3S91 A;  4QR5 A;  3JVK A;  1WUM A;  4BW3 A;  4O7F A;  5IGN A;  2DVR A;  5CQ7 A;  4ZC9 A;  3FKM X;  4PS5 A;  4J0R A;  4J3I A;  5EWD A;  5I80 A;  4TT4 A;  5CQ3 A;  5D3J A;  2I7K A;  3MQM A;  4UIU A;  5FE5 A;  3IU5 A;  4NR4 A;  4Q0N A;  5E9K A;  2E3K A;  4NS5 A;  5E9L A;  4QB3 A;  5DYA A;  5G4R A;  4BW2 A;  5A5O A;  5ETD A;  4Q0O A;  4LZR A;  5EGU A;  3P1F A;  5DLZ A;  5DFB A;  2MJV B;  1N72 A;  5F1L A;  3MUL A;  4O76 A;  3U5M A;  5HFR A;  5CQ5 A;  4QSX A;  3UV5 A;  3S92 A;  3U5O A;  4NYV A;  5HRV A;  5DW2 A;  5CRZ A;  3HMH A;  4C66 A;  5E0R A;  4MR3 A;  4XUA A;  4QYD A;  3JVM A;  4NR8 A;  4BJX A;  5EK9 A;  5DYU A;  5CUG A;  4WHW A;  4X2I A;  4ZW1 A;  4XY8 A;  5F1H A;  5EPB A;  4HXP A;  5A5P A;  4HXO A;  4IOQ A;  5F61 A;  5E3G A;  4QSV A;  2KTB B;  4Y03 A;  5DKH A;  3IU6 A;  5EA1 A;  5E73 A;  5IGK A;  5FH8 A;  2RNX A;  4LZS A;  3AAD A;  2YYN A;  2F6N A;  3MUK A;  4ZQL A;  3JVL A;  4NRA A;  5CUA A;  4TT6 A;  5A7C A;  4A9L A;  4CUQ A;  4YBS A;  5E3D A;  5IID A;  4KCX A;  5CUD A;  5HQ5 A;  4QYL A;  4F3I A;  4UIY A;  5LJ0 A;  4BW4 A;  4NUD A;  5D3N A;  4BHW A;  5LVR A;  5AD2 A;  5AMF A;  3U5J A;  5BT4 A;  5COI A;  5CU8 A;  3HMF A;  4YYI A;  5HJC A;  4QZS A;  5AD3 A;  3UVD A;  2DKW A;  4MR4 A;  5DKD A;  5I1Q A;  5LKX A;  4MEN A;  4HXL A;  3LQH A;  4UIZ A;  4QNS A;  4YYK A;  2R0Y A;  4QEV A;  5C8G A;  2F6J A;  5IGM A;  4N4F A;  5FG5 A;  2H60 A;  4FLP A;  5CZG A;  4ALG A;  4UYD A;  5D3H A;  4YK0 A;  5E9M A;  5EWW A;  3DWY A;  5F60 A;  2G4A A;  3TLP A;  3JVJ A;  3DAI A;  2YDW A;  4QY4 A;  5CQ4 A;  5E7D A;  4CUT A;  4YH4 A;  5DFC A;  3MXF A;  4YYH A;  2WP1 A;  5JWM A;  4HXN A;  3O37 A;  1E6I A;  5A82 A;  5LKZ A;  5H1T A;  4O75 A;  5F25 A;  5A85 A;  3LQJ A;  4LR6 A;  4NUC A;  5ENJ A;  3G0L A;  4QSR A;  4CUS A;  4YBT A;  4QEW A;  5FB0 A;  2YW5 A;  3UV4 A;  2RI7 A;  5DKC A;  4LYS A;  5L8U A;  4A9F A;  5ENE A;  5EV9 A;  5D26 A;  2R10 A;  5II2 A;  5FFV A;  4LYW A;  5EU1 A;  4CUU A;  4HBW A;  5F63 A;  3Q2F A;  4WHU A;  5HEM A;  4QC3 A;  2RFJ A;  4IR6 A;  3D7C A;  4CL9 A;  2GRC A;  3NXB A;  3ZYU A;  2R0V A;  4XYA A;  5I29 A;  5H1V A;  4MEQ A;  4N4I A;  5EQ1 A;  5DY7 A;  5G4S A;  5KTX A;  4CFL A;  5EVA A;  5LUU A;  4OUF A;  4HBV A;  3P1D A;  5H85 A;  4O78 A;  4TZ8 A;  4A9J A;  5F3A A;  3QZT A;  4YY6 A;  5I40 A;  4QBM A;  5I7Y A;  5CQA A;  4QSP A;  4UYH A;  4IR4 A;  5DBM A;  4Z6H A;  4QR4 A;  5CPE A;  3UVY A;  4NR6 A;  4AKN A;  3U5N A;  4UIV A;  4LRG A;  5EP7 A;  5CUE A;  4LDF A;  4BW1 A;  4MEO A;  5KO4 A;  4O7B A;  5FB1 A;  1X0J A;  4UIW A;  4O70 A;  5L8T A;  5I89 A;  3P1E A;  4OGI A;  4YH3 A;  5ENI A;  4A9E A;  2N9G A;  4QR3 A;  3I3J A;  4TZ2 A;  5EWC A;  3P1C A;  2NXB A;  5EWV A;  5HLS A;  5L98 A;  5ENG A;  3K2J A;  4YYN A;  4QEU A;  3HME A;  5EIC A;  4YBM A;  4O7C A;  4QUT A;  4MR6 A;  4YYD A;  4IOR A;  4O72 A;  2WP2 A;  4NUE A;  5KTU A;  5FE7 A;  4O77 A;  4C67 A;  2DVS A;  5AME A;  5ACY A;  4A9O A;  4A9M A;  4RVR A;  2RS9 B;  3P5O A;  5D24 A;  5C4Q A;  5K29 A;  5FE3 A;  2DWW A;  5FFW A;  2LSP B;  5IBN A;  4N4H A;  4QUU A;  5ENF A;  5EM3 A;  4TTE A;  5J0D A;  4HBY A;  4XUB A;  5CTL A;  4PKL A;  5FH6 A;  5BT5 A;  5ENB A;  4IR3 A;  5A83 A;  5FE0 A;  3SVH A;  2RNW A;  5E9Y A;  4LZ2 A;  3O35 A;  5EWH A;  4Z6I A;  5L97 A;  4NYX A;  4TS8 A;  2L5E A;  5C87 A;  5LJ1 A;  1EQF A;  5HCL A;  5ENH A;  3LQI A;  5F62 A;  4A9I A;  3QZV A;  4XY9 A;  5D3S A;  3UV2 A;  4Z1Q A;  5FH7 A;  5D7X A;  5D0C A;  4MEP A;  4TQN A;  4NRB A;  4O74 A;  4HXM A;  4E96 A;  2OSS A;  5KTW A;  5A5Q A;  4UYE A;  4KV4 A;  5EPR A;  4MR5 A;  4NQN A;  4UIX A;  5KHM A;  4CFK A;  5A81 A;  4TYL A;  3QZS A;  5H1U A;  3LXJ A;  5CUB A;  5DX4 A;  5L99 A;  3RCW A;  5E74 A;  3GG3 A;  5FE4 A;  3G0J A;  4UYF A;  3ONI A;  5HEN A;  3UW9 A;  5FE2 A;  2L85 A;  4QC1 A;  3U5K A;  4NR5 A;  4Z1S A;  4PCI A;  4GPJ A;  5DW1 A;  4KV1 A;  5A5R A;  5L96 A;  5KU3 A;  5D3R A;  3MB4 A;  4NXJ A;  4YC9 A;  3MB3 A;  4CUR A;  1F68 A;  5A5S A;  5TCM A;  4YAX A;  4NR9 A;  4NRC A;  5CQT A;  2E7O A;  2YEM A;  5C7N A;  5C89 A;  4N4G A;  2OO1 A;  3SVG A;  4TU6 A;  4YYM A;  2YEL A;  4PCE A;  5C85 A;  5CS8 A;  5HM0 A;  5CQ8 A;  1JM4 B;  2L84 A;  5II1 A;  5LKT A;  4CUP A;  5DYC A;  5I86 A;  5CQ6 A;  4N3W A;  5D25 A;  5I88 A;  4A9N A;  4IOO A;  5DYX A;  5A5N A;  5FE6 A;  5DFD A;  3U5L A;  4NYW A;  3O36 A;  2FSA A;  4WIV A;  5E9I A;  4TT2 A;  5FE1 A;  5BT3 A;  4PTB A;  4HXK A;  4YAD A;  4UYF B;  5HQ6 A;  3UVX A;  5F2P A;  3U5P A;  5LVQ A;  4O7E A;  5HQ7 A;  4HXR A;  5CY9 A;  4A9H A;  5CGP A;  5ENC A;  3O34 A;  5TB6 A;  5CUC A;  4QST A;  4YYJ A;  5HRX A;  4Z93 A;  5FE8 A;  5I7X A;  2DAT A;  4ALH A;  5CRM A;  4YAT A;  5EIS A;  4LYI A;  5FE9 A;  5DLX A;  5EPS A;  2DVQ A;  4QSU A;  4YYG A;  4YY4 A;  4YAB A;  3Q2E A;  5JI8 A;  5D3P A;  2I8N A;  2YEK A;  4QSS A;  2RO1 A;  3O33 A;  4NR7 A;  4LC2 A;  2RNY A;  5IG6 A;  5LJ2 A;  5LKU A;  2YQD A;  4UIT A;  4UYG A;  5D3T A;  5FFY A;  4TU4 A;  5FDZ A;  5D3L A;  5HFQ A;  5IGL A;  3LJW A; 
#chains in the Genus database with same CATH topology
 5HEL A;  1ZS5 A;  2D9E A;  5FG4 A;  5F36 A;  3VKG A;  4PY6 A;  2R0S A;  4IR5 A;  2E7N A;  4O71 A;  4QSW A;  2D82 A;  5FBX A;  4CLB A;  5CFW A;  3UVW A;  4HXS A;  3SVF A;  5CP5 A;  5F5Z A;  4A9K A;  4J1P A;  4NQM A;  5I83 A;  4J0S A;  2DVV A;  4AKG A;  5FG6 A;  4DON A;  1WUG A;  2OUO A;  5E9V A;  1JSP B;  3AQA A;  4O7A A;  4OGJ A;  5ETB A;  4HBX A;  4QSQ A;  5HRW A;  5EI4 A;  3S91 A;  4QR5 A;  3JVK A;  1WUM A;  4BW3 A;  4O7F A;  5IGN A;  2DVR A;  5CQ7 A;  4ZC9 A;  3FKM X;  4PS5 A;  4J0R A;  4J3I A;  5EWD A;  5I80 A;  4TT4 A;  5CQ3 A;  5D3J A;  2I7K A;  3MQM A;  4UIU A;  5FE5 A;  3IU5 A;  4NR4 A;  4Q0N A;  5E9K A;  2E3K A;  4NS5 A;  5E9L A;  2EJN A;  4QB3 A;  5DYA A;  5G4R A;  4BW2 A;  5A5O A;  5ETD A;  4Q0O A;  4LZR A;  5EGU A;  3P1F A;  5DLZ A;  5DFB A;  2MJV B;  1N72 A;  5F1L A;  3MUL A;  4O76 A;  3U5M A;  5HFR A;  5CQ5 A;  4QSX A;  3UV5 A;  3S92 A;  3U5O A;  4NYV A;  5HRV A;  5DW2 A;  3ERR A;  5CRZ A;  3HMH A;  4C66 A;  5E0R A;  4MR3 A;  4XUA A;  4QYD A;  3JVM A;  4NR8 A;  4BJX A;  5EK9 A;  5DYU A;  5CUG A;  4WHW A;  4X2I A;  4ZW1 A;  4XY8 A;  5F1H A;  5EPB A;  4HXP A;  5A5P A;  4HXO A;  4IOQ A;  5F61 A;  5E3G A;  4QSV A;  2KTB B;  4Y03 A;  5DKH A;  3IU6 A;  5EA1 A;  5E73 A;  5IGK A;  5FH8 A;  2RNX A;  4LZS A;  3AAD A;  2YYN A;  2F6N A;  3MUK A;  4ZQL A;  3JVL A;  4NRA A;  5CUA A;  4TT6 A;  5A7C A;  4A9L A;  4CUQ A;  4YBS A;  5E3D A;  5IID A;  4KCX A;  5CUD A;  5HQ5 A;  4QYL A;  4F3I A;  4UIY A;  5LJ0 A;  4BW4 A;  4NUD A;  5D3N A;  4BHW A;  5LVR A;  5AD2 A;  5AMF A;  3U5J A;  5BT4 A;  5COI A;  5CU8 A;  3HMF A;  4YYI A;  5HJC A;  4QZS A;  5AD3 A;  3UVD A;  4AI6 A;  2DKW A;  4MR4 A;  5DKD A;  5I1Q A;  5LKX A;  4MEN A;  4HXL A;  3LQH A;  4UIZ A;  4QNS A;  4YYK A;  2R0Y A;  4QEV A;  5C8G A;  2F6J A;  5IGM A;  4N4F A;  5FG5 A;  2H60 A;  4FLP A;  5CZG A;  4ALG A;  4UYD A;  5D3H A;  4YK0 A;  5E9M A;  5EWW A;  3DWY A;  5F60 A;  2G4A A;  3TLP A;  3JVJ A;  3DAI A;  2YDW A;  4QY4 A;  5CQ4 A;  5E7D A;  4CUT A;  4YH4 A;  5DFC A;  3MXF A;  4YYH A;  2WP1 A;  5JWM A;  4HXN A;  3O37 A;  1E6I A;  5A82 A;  5LKZ A;  5H1T A;  4O75 A;  5F25 A;  5A85 A;  3LQJ A;  4LR6 A;  4NUC A;  5ENJ A;  3G0L A;  4QSR A;  4CUS A;  4YBT A;  4QEW A;  5FB0 A;  2YW5 A;  3UV4 A;  2RI7 A;  5DKC A;  4LYS A;  5L8U A;  4A9F A;  5ENE A;  5EV9 A;  5D26 A;  2R10 A;  5II2 A;  5FFV A;  4LYW A;  5EU1 A;  4CUU A;  4HBW A;  5F63 A;  3Q2F A;  4WHU A;  5HEM A;  4QC3 A;  2RFJ A;  4IR6 A;  3D7C A;  4CL9 A;  2GRC A;  3NXB A;  3ZYU A;  2R0V A;  4XYA A;  5I29 A;  5H1V A;  4MEQ A;  4N4I A;  5EQ1 A;  5DY7 A;  5G4S A;  5KTX A;  4CFL A;  5EVA A;  5LUU A;  4OUF A;  4HBV A;  3P1D A;  5H85 A;  4O78 A;  4TZ8 A;  4A9J A;  5F3A A;  3QZT A;  4YY6 A;  5I40 A;  4QBM A;  5I7Y A;  5CQA A;  4QSP A;  4UYH A;  4IR4 A;  5DBM A;  4Z6H A;  4QR4 A;  5CPE A;  3UVY A;  4NR6 A;  4AKN A;  3U5N A;  4UIV A;  4LRG A;  5EP7 A;  5CUE A;  4LDF A;  4BW1 A;  4MEO A;  5KO4 A;  4O7B A;  5FB1 A;  1X0J A;  4UIW A;  4O70 A;  5L8T A;  5I89 A;  3P1E A;  4OGI A;  4YH3 A;  5ENI A;  4A9E A;  2N9G A;  4QR3 A;  3I3J A;  4TZ2 A;  5EWC A;  3P1C A;  2NXB A;  5EWV A;  3D1B A;  5HLS A;  5L98 A;  5ENG A;  3K2J A;  4YYN A;  4QEU A;  3HME A;  5EIC A;  4YBM A;  4O7C A;  4QUT A;  4MR6 A;  4YYD A;  4IOR A;  4O72 A;  2WP2 A;  4NUE A;  5KTU A;  5FE7 A;  4O77 A;  4C67 A;  2DVS A;  5AME A;  5ACY A;  4A9O A;  4A9M A;  4RVR A;  2RS9 B;  3P5O A;  5D24 A;  5C4Q A;  5K29 A;  5FE3 A;  2DWW A;  4AKH A;  5FFW A;  2LSP B;  5IBN A;  4N4H A;  4QUU A;  5ENF A;  5EM3 A;  4TTE A;  5J0D A;  4HBY A;  4XUB A;  5CTL A;  4PKL A;  5FH6 A;  5BT5 A;  5ENB A;  4IR3 A;  5A83 A;  5FE0 A;  3SVH A;  2RNW A;  5E9Y A;  4LZ2 A;  3O35 A;  5EWH A;  4Z6I A;  5L97 A;  4NYX A;  4TS8 A;  2L5E A;  5C87 A;  5LJ1 A;  1EQF A;  5HCL A;  5ENH A;  3LQI A;  5F62 A;  3VKH A;  4A9I A;  3QZV A;  4XY9 A;  5D3S A;  3UV2 A;  4Z1Q A;  5FH7 A;  5D7X A;  5D0C A;  4MEP A;  4TQN A;  4NRB A;  4O74 A;  4HXM A;  4E96 A;  2OSS A;  5KTW A;  5A5Q A;  4UYE A;  4KV4 A;  5EPR A;  4MR5 A;  4NQN A;  4UIX A;  5KHM A;  4CFK A;  5A81 A;  4TYL A;  3QZS A;  5H1U A;  3LXJ A;  5CUB A;  5DX4 A;  5L99 A;  3RCW A;  5E74 A;  3GG3 A;  1PUO A;  5FE4 A;  3G0J A;  4UYF A;  3ONI A;  5HEN A;  3UW9 A;  5FE2 A;  2L85 A;  4QC1 A;  3U5K A;  4NR5 A;  4Z1S A;  4PCI A;  4GPJ A;  5DW1 A;  4KV1 A;  5A5R A;  5L96 A;  5KU3 A;  5D3R A;  3MB4 A;  4NXJ A;  4YC9 A;  3MB3 A;  4CUR A;  1F68 A;  5A5S A;  5TCM A;  4YAX A;  4NR9 A;  4NRC A;  5CQT A;  2E7O A;  2YEM A;  5C7N A;  5C89 A;  4N4G A;  2OO1 A;  3SVG A;  4TU6 A;  4YYM A;  2YEL A;  4PCE A;  5C85 A;  5CS8 A;  5HM0 A;  5CQ8 A;  1JM4 B;  2L84 A;  5II1 A;  5LKT A;  4CUP A;  5DYC A;  5I86 A;  5CQ6 A;  1ZKR A;  4N3W A;  5D25 A;  5I88 A;  4A9N A;  4IOO A;  5DYX A;  5A5N A;  5FE6 A;  5DFD A;  3U5L A;  4NYW A;  3O36 A;  2FSA A;  4WIV A;  5E9I A;  4TT2 A;  5FE1 A;  5BT3 A;  4PTB A;  4HXK A;  4YAD A;  4UYF B;  5HQ6 A;  3UVX A;  5F2P A;  3U5P A;  5LVQ A;  4O7E A;  4AKI A;  5HQ7 A;  4HXR A;  5CY9 A;  4A9H A;  5CGP A;  5ENC A;  3O34 A;  5TB6 A;  5CUC A;  4QST A;  4YYJ A;  5HRX A;  4Z93 A;  5FE8 A;  5I7X A;  2DAT A;  4ALH A;  5CRM A;  4YAT A;  5EIS A;  3D1D A;  4LYI A;  5DLX A;  5FE9 A;  5EPS A;  2DVQ A;  4QSU A;  4YYG A;  4YY4 A;  4YAB A;  3Q2E A;  5JI8 A;  5D3P A;  2I8N A;  2YEK A;  4QSS A;  2RO1 A;  3O33 A;  4NR7 A;  4LC2 A;  2RNY A;  5IG6 A;  5LJ2 A;  5LKU A;  2YQD A;  4UIT A;  4UYG A;  5D3T A;  5FFY A;  4TU4 A;  5FDZ A;  5D3L A;  5HFQ A;  5IGL A;  3LJW A; 
#chains in the Genus database with same CATH homology
 5HEL A;  1ZS5 A;  2D9E A;  5FG4 A;  5F36 A;  4PY6 A;  2R0S A;  4IR5 A;  2E7N A;  4O71 A;  4QSW A;  2D82 A;  5FBX A;  4CLB A;  5CFW A;  3UVW A;  4HXS A;  3SVF A;  5CP5 A;  5F5Z A;  4A9K A;  4J1P A;  4NQM A;  5I83 A;  4J0S A;  2DVV A;  5FG6 A;  4DON A;  1WUG A;  2OUO A;  5E9V A;  1JSP B;  3AQA A;  4O7A A;  4OGJ A;  5ETB A;  4HBX A;  4QSQ A;  5HRW A;  5EI4 A;  3S91 A;  4QR5 A;  3JVK A;  1WUM A;  4BW3 A;  4O7F A;  5IGN A;  2DVR A;  5CQ7 A;  4ZC9 A;  3FKM X;  4PS5 A;  4J0R A;  4J3I A;  5EWD A;  5I80 A;  4TT4 A;  5CQ3 A;  5D3J A;  2I7K A;  3MQM A;  4UIU A;  5FE5 A;  3IU5 A;  4NR4 A;  4Q0N A;  5E9K A;  2E3K A;  4NS5 A;  5E9L A;  4QB3 A;  5DYA A;  5G4R A;  4BW2 A;  5A5O A;  5ETD A;  4Q0O A;  4LZR A;  5EGU A;  3P1F A;  5DLZ A;  5DFB A;  2MJV B;  1N72 A;  5F1L A;  3MUL A;  4O76 A;  3U5M A;  5HFR A;  5CQ5 A;  4QSX A;  3UV5 A;  3S92 A;  3U5O A;  4NYV A;  5HRV A;  5DW2 A;  5CRZ A;  3HMH A;  4C66 A;  5E0R A;  4MR3 A;  4XUA A;  4QYD A;  3JVM A;  4NR8 A;  4BJX A;  5EK9 A;  5DYU A;  5CUG A;  4WHW A;  4X2I A;  4ZW1 A;  4XY8 A;  5F1H A;  5EPB A;  4HXP A;  5A5P A;  4HXO A;  4IOQ A;  5F61 A;  5E3G A;  4QSV A;  2KTB B;  4Y03 A;  5DKH A;  3IU6 A;  5EA1 A;  5E73 A;  5IGK A;  5FH8 A;  2RNX A;  4LZS A;  3AAD A;  2YYN A;  2F6N A;  3MUK A;  4ZQL A;  3JVL A;  4NRA A;  5CUA A;  4TT6 A;  5A7C A;  4A9L A;  4CUQ A;  4YBS A;  5E3D A;  5IID A;  4KCX A;  5CUD A;  5HQ5 A;  4QYL A;  4F3I A;  4UIY A;  5LJ0 A;  4BW4 A;  4NUD A;  5D3N A;  4BHW A;  5LVR A;  5AD2 A;  5AMF A;  3U5J A;  5BT4 A;  5COI A;  5CU8 A;  3HMF A;  4YYI A;  5HJC A;  4QZS A;  5AD3 A;  3UVD A;  2DKW A;  4MR4 A;  5DKD A;  5I1Q A;  5LKX A;  4MEN A;  4HXL A;  3LQH A;  4UIZ A;  4QNS A;  4YYK A;  2R0Y A;  4QEV A;  5C8G A;  2F6J A;  5IGM A;  4N4F A;  5FG5 A;  2H60 A;  4FLP A;  5CZG A;  4ALG A;  4UYD A;  5D3H A;  4YK0 A;  5E9M A;  5EWW A;  3DWY A;  5F60 A;  2G4A A;  3TLP A;  3JVJ A;  3DAI A;  2YDW A;  4QY4 A;  5CQ4 A;  5E7D A;  4CUT A;  4YH4 A;  5DFC A;  3MXF A;  4YYH A;  2WP1 A;  5JWM A;  4HXN A;  3O37 A;  1E6I A;  5A82 A;  5LKZ A;  5H1T A;  4O75 A;  5F25 A;  5A85 A;  3LQJ A;  4LR6 A;  4NUC A;  5ENJ A;  3G0L A;  4QSR A;  4CUS A;  4YBT A;  4QEW A;  5FB0 A;  2YW5 A;  3UV4 A;  2RI7 A;  5DKC A;  4LYS A;  5L8U A;  4A9F A;  5ENE A;  5EV9 A;  5D26 A;  2R10 A;  5II2 A;  5FFV A;  4LYW A;  5EU1 A;  4CUU A;  4HBW A;  5F63 A;  3Q2F A;  4WHU A;  5HEM A;  4QC3 A;  2RFJ A;  4IR6 A;  3D7C A;  4CL9 A;  2GRC A;  3NXB A;  3ZYU A;  2R0V A;  4XYA A;  5I29 A;  5H1V A;  4MEQ A;  4N4I A;  5EQ1 A;  5DY7 A;  5G4S A;  5KTX A;  4CFL A;  5EVA A;  5LUU A;  4OUF A;  4HBV A;  3P1D A;  5H85 A;  4O78 A;  4TZ8 A;  4A9J A;  5F3A A;  3QZT A;  4YY6 A;  5I40 A;  4QBM A;  5I7Y A;  5CQA A;  4QSP A;  4UYH A;  4IR4 A;  5DBM A;  4Z6H A;  4QR4 A;  5CPE A;  3UVY A;  4NR6 A;  4AKN A;  3U5N A;  4UIV A;  4LRG A;  5EP7 A;  5CUE A;  4LDF A;  4BW1 A;  4MEO A;  5KO4 A;  4O7B A;  5FB1 A;  1X0J A;  4UIW A;  4O70 A;  5L8T A;  5I89 A;  3P1E A;  4OGI A;  4YH3 A;  5ENI A;  4A9E A;  2N9G A;  4QR3 A;  3I3J A;  4TZ2 A;  5EWC A;  3P1C A;  2NXB A;  5EWV A;  5HLS A;  5L98 A;  5ENG A;  3K2J A;  4YYN A;  4QEU A;  3HME A;  5EIC A;  4YBM A;  4O7C A;  4QUT A;  4MR6 A;  4YYD A;  4IOR A;  4O72 A;  2WP2 A;  4NUE A;  5KTU A;  5FE7 A;  4O77 A;  4C67 A;  2DVS A;  5AME A;  5ACY A;  4A9O A;  4A9M A;  4RVR A;  2RS9 B;  3P5O A;  5D24 A;  5C4Q A;  5K29 A;  5FE3 A;  2DWW A;  5FFW A;  2LSP B;  5IBN A;  4N4H A;  4QUU A;  5ENF A;  5EM3 A;  4TTE A;  5J0D A;  4HBY A;  4XUB A;  5CTL A;  4PKL A;  5FH6 A;  5BT5 A;  5ENB A;  4IR3 A;  5A83 A;  5FE0 A;  3SVH A;  2RNW A;  5E9Y A;  4LZ2 A;  3O35 A;  5EWH A;  4Z6I A;  5L97 A;  4NYX A;  4TS8 A;  2L5E A;  5C87 A;  5LJ1 A;  1EQF A;  5HCL A;  5ENH A;  3LQI A;  5F62 A;  4A9I A;  3QZV A;  4XY9 A;  5D3S A;  3UV2 A;  4Z1Q A;  5FH7 A;  5D7X A;  5D0C A;  4MEP A;  4TQN A;  4NRB A;  4O74 A;  4HXM A;  4E96 A;  2OSS A;  5KTW A;  5A5Q A;  4UYE A;  4KV4 A;  5EPR A;  4MR5 A;  4NQN A;  4UIX A;  5KHM A;  4CFK A;  5A81 A;  4TYL A;  3QZS A;  5H1U A;  3LXJ A;  5CUB A;  5DX4 A;  5L99 A;  3RCW A;  5E74 A;  3GG3 A;  5FE4 A;  3G0J A;  4UYF A;  3ONI A;  5HEN A;  3UW9 A;  5FE2 A;  2L85 A;  4QC1 A;  3U5K A;  4NR5 A;  4Z1S A;  4PCI A;  4GPJ A;  5DW1 A;  4KV1 A;  5A5R A;  5L96 A;  5KU3 A;  5D3R A;  3MB4 A;  4NXJ A;  4YC9 A;  3MB3 A;  4CUR A;  1F68 A;  5A5S A;  5TCM A;  4YAX A;  4NR9 A;  4NRC A;  5CQT A;  2E7O A;  2YEM A;  5C7N A;  5C89 A;  4N4G A;  2OO1 A;  3SVG A;  4TU6 A;  4YYM A;  2YEL A;  4PCE A;  5C85 A;  5CS8 A;  5HM0 A;  5CQ8 A;  1JM4 B;  2L84 A;  5II1 A;  5LKT A;  4CUP A;  5DYC A;  5I86 A;  5CQ6 A;  4N3W A;  5D25 A;  5I88 A;  4A9N A;  4IOO A;  5DYX A;  5A5N A;  5FE6 A;  5DFD A;  3U5L A;  4NYW A;  3O36 A;  2FSA A;  4WIV A;  5E9I A;  4TT2 A;  5FE1 A;  5BT3 A;  4PTB A;  4HXK A;  4YAD A;  4UYF B;  5HQ6 A;  3UVX A;  5F2P A;  3U5P A;  5LVQ A;  4O7E A;  5HQ7 A;  4HXR A;  5CY9 A;  4A9H A;  5CGP A;  5ENC A;  3O34 A;  5TB6 A;  5CUC A;  4QST A;  4YYJ A;  5HRX A;  4Z93 A;  5FE8 A;  5I7X A;  2DAT A;  4ALH A;  5CRM A;  4YAT A;  5EIS A;  4LYI A;  5FE9 A;  5DLX A;  5EPS A;  2DVQ A;  4QSU A;  4YYG A;  4YY4 A;  4YAB A;  3Q2E A;  5JI8 A;  5D3P A;  2I8N A;  2YEK A;  4QSS A;  2RO1 A;  3O33 A;  4NR7 A;  4LC2 A;  2RNY A;  5IG6 A;  5LJ2 A;  5LKU A;  2YQD A;  4UIT A;  4UYG A;  5D3T A;  5FFY A;  4TU4 A;  5FDZ A;  5D3L A;  5HFQ A;  5IGL A;  3LJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...