5I88A

Brd4 in complex with cpd4 ((e)-3-(6-(but-2-en-1-yl)-7-oxo-6,7-dihydro-1h-pyrrolo[2,3-c]pyridin-4-yl)-n,n-dimethylbenzamide)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
126
structure length
126
Chain Sequence
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 4
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i88A01
3UVYA 5CUBA 4NS5A 5LKXA 3TLPA 5CZGA 4IR5A 4NQMA 5LVRA 3MB4A 5FFVA 4QC3A 4YH3A 5D3PA 4A9OA 3LQIA 4QR5A 5IBNA 3SVGA 5DKCA 5D3HA 5HJCA 5D26A 5A82A 5HQ5A 3UVWA 3AADA 4NUDA 3IU6A 4MEPA 5EWVA 3SVFA 4NUEA 4QEUA 4XYAA 3D7CA 5HM0A 4HXPA 4LDFA 5I83A 2D9EA 4HXRA 2L84A 5DLZA 4O78A 5D3NA 5G4SA 5D3TA 3RCWA 5EISA 5IG6A 4CUTA 5FB0A 3GG3A 4O7CA 5KTUA 5CRZA 5CUCA 5LVQA 4A9EA 5L98A 2WP2A 5E9KA 4O76A 5FH6A 2RS9B 3Q2FA 5AMEA 4IOOA 4YK0A 4NXJA 4YYJA 3MUKA 5FH8A 2RNWA 2RI7A 2DKWA 2NXBA 4O71A 4HXSA 5EK9A 4LZRA 5D25A 4UIWA 5BT3A 4YYMA 5EQ1A 5I29A 4Z1SA 5EPBA 4LZSA 4NYWA 3P1DA 2R0SA 2D82A 5TB6A 5J0DA 4MR4A 4YATA 2OUOA 4A9IA 4C67A 4QSUA 4NR4A 5C87A 2MJVB 5EU1A 3LQHA 4PS5A 5FB1A 4QNSA 4YYDA 5KTWA 5H1TA 3DWYA 5CQ5A 5F5ZA 4UYHA 4C66A 4LZ2A 4MR6A 4GPJA 5LKTA 5EPSA 5FE8A 2G4AA 4N4IA 4KCXA 4OGIA 4YY4A 3MQMA 1X0JA 4QUUA 5CQ8A 5FH7A 4WIVA 3U5JA 3DAIA 5F62A 5A85A 2WP1A 3SVHA 2YQDA 3JVJA 5I40A 4ZC9A 5DW2A 5I7XA 5I88A 4YBMA 4NQNA 4YH4A 3O33A 5ENBA 1WUGA 5HENA 3K2JA 2RFJA 5I86A 4A9NA 4CUUA 4LYIA 4TT6A 4XUAA 5D0CA 4J0SA 1EQFA 3P1EA 4TZ8A 5HFRA 5F63A 4NR9A 5KTXA 4A9FA 5EA1A 4UYFA 2H60A 3Q2EA 5FG4A 5L99A 4NYVA 4QSPA 2YEMA 5L8UA 2R0YA 4HXOA 4NRBA 4UITA 4BW1A 5JI8A 4QUTA 5FG5A 5CQ7A 5HQ6A 5HRXA 4CL9A 3FKMX 3LXJA 4TQNA 3UV5A 5AMFA 4BHWA 4N3WA 5LJ2A 4ALGA 2R10A 5EVAA 2YELA 5F60A 5FE4A 4NRCA 5HRVA 4QZSA 5ENFA 4CUQA 4NR8A 4MR3A 5CPEA 4YYHA 1JSPB 5EWCA 5CUEA 4YY6A 4E96A 5FFYA 3QZTA 4F3IA 4MEQA 5EP7A 2RO1A 4QY4A 4NRAA 5CQ3A 5E73A 4XUBA 4HBYA 4N4GA 4AKNA 5DFCA 4QR4A 3O35A 5AD3A 3U5NA 4PKLA 4UYFB 5CQ6A 5H1UA 5IGLA 4TZ2A 5A83A 3AQAA 5HELA 4YYGA 2N9GA 2YDWA 5FE5A 5L96A 4YADA 4TU4A 3G0LA 5L97A 2E7OA 4O77A 5LJ1A 4ALHA 5F25A 5C85A 4YYIA 5II1A 2F6JA 5F3AA 3MULA 3ONIA 4A9LA 4HBXA 3U5MA 2RNYA 5CFWA 4MR5A 5HEMA 4A9MA 5LKUA 5JWMA 2I7KA 4IR4A 4O7BA 5A5PA 2L5EA 5ENCA 4PCEA 5F36A 5EI4A 5ENEA 5CUAA 5E9LA 4UYDA 5DY7A 5L8TA 3LJWA 4WHWA 5FBXA 3I3JA 4TYLA 4NR6A 4QSQA 4QSXA 2DATA 4HBWA 3QZVA 4N4FA 5I80A 4J0RA 5HLSA 5A81A 4CFLA 4LR6A 5IIDA 5IGKA 2GRCA 4UIZA 4QYLA 5E9IA 4BJXA 2OO1A 5E9MA 5CQTA 4NR7A 5E0RA 4UIUA 4BW3A 5H1VA 3S91A 4UYEA 4PTBA 4LC2A 5F61A 4KV4A 5LUUA 2KTBB 5ENHA 5HFQA 4QEWA 5A5RA 5DFDA 5DKHA 3U5OA 5FE2A 4HBVA 3UW9A 3P1CA 4A9HA 4O70A 3ZYUA 2DVSA 4NUCA 5FFWA 5CU8A 5A5OA 1ZS5A 4BW2A 5HCLA 4XY8A 4N4HA 5EWDA 5H85A 5FE3A 5COIA 5CGPA 3U5KA 2DWWA 4PY6A 4HXKA 5C8GA 3HMFA 5FG6A 5CTLA 5AD2A 4UIYA 5I1QA 3U5LA 2YW5A 5DBMA 3MXFA 4HXNA 5DW1A 5IGMA 5D3RA 5ETDA 3NXBA 3HMEA 5CUDA 5A7CA 4CURA 5A5QA 5EPRA 5FE9A 5K29A 3JVKA 4WHUA 5EGUA 1N72A 3JVLA 5I7YA 4J3IA 4CUPA 2E3KA 4ZW1A 4HXMA 4J1PA 2L85A 5BT4A 4LYWA 3HMHA 4O7FA 2DVVA 2FSAA 5D7XA 1E6IA 4HXLA 4OUFA 5DYXA 4DONA 5ETBA 3LQJA 4O7AA 3S92A 4UIVA 4NR5A 4BW4A 5DYUA 5ACYA 4TU6A 4Z6IA 4MENA 3UVDA 4QSVA 4QSRA 4LYSA 5KO4A 5CY9A 4QSTA 5EM3A 5CQ4A 5E74A 2F6NA 5CP5A 4QBMA 4ZQLA 5EWHA 4NYXA 4YABA 4TT2A 5HRWA 5C4QA 4QEVA 4RVRA 4LRGA 5I89A 4Q0OA 5BT5A 4YBSA 5LJ0A 5C89A 5F1LA 2I8NA 4QB3A 5DYCA 4IR3A 5KU3A 4YBTA 2LSPB 4A9JA 2OSSA 4O75A 4TT4A 5II2A 3G0JA 4O72A 5FE1A 3P1FA 3O34A 5CUGA 4OGJA 2DVRA 4TTEA 4YYKA 4YYNA 5CRMA 4IOQA 4XY9A 4TS8A 4Z93A 5E3DA 4QYDA 5IGNA 5ENJA 5EICA 4QSSA 4MEOA 4X2IA 5DYAA 2YYNA 3JVMA 4Z1QA 4UYGA 4O7EA 5ENGA 5EWWA 1F68A 3O37A 5DFBA 5DX4A 3P5OA 4IORA 5E3GA 4YAXA 5ENIA 4CLBA 5G4RA 2DVQA 3IU5A 4QC1A 4CFKA 5FE0A 5A5SA 3UV2A 5DLXA 5LKZA 5E7DA 4CUSA 5F2PA 4QR3A 5D3SA 3U5PA 4YC9A 5CS8A 5F1HA 4O74A 4FLPA 4UIXA 4KV1A 2YEKA 1WUMA 4A9KA 5E9VA 4PCIA 1JM4B 3QZSA 2R0VA 5CQAA 2RNXA 3UV4A 5E9YA 5KHMA 5HQ7A 4IR6A 4Z6HA 3O36A 2E7NA 5D3JA 5EV9A 5FDZA 4QSWA 5DKDA 3UVXA 5D24A 5FE7A 4Y03A 5C7NA 5D3LA 5FE6A 5A5NA 3MB3A 5TCMA 4Q0NA
chains in the Genus database with same CATH superfamily
3UVYA 5CUBA 4NS5A 5LKXA 3TLPA 5CZGA 4IR5A 4NQMA 5LVRA 3MB4A 5FFVA 4QC3A 4YH3A 5D3PA 4A9OA 3LQIA 4QR5A 5IBNA 3SVGA 5DKCA 5D3HA 5HJCA 5D26A 5A82A 5HQ5A 3UVWA 3AADA 4NUDA 3IU6A 4MEPA 5EWVA 3SVFA 4NUEA 4QEUA 4XYAA 3D7CA 5HM0A 4HXPA 4LDFA 5I83A 2D9EA 4HXRA 2L84A 5DLZA 4O78A 5D3NA 5G4SA 5D3TA 3RCWA 5EISA 5IG6A 4CUTA 5FB0A 3GG3A 4O7CA 5KTUA 5CRZA 5CUCA 5LVQA 4A9EA 5L98A 2WP2A 5E9KA 4O76A 5FH6A 2RS9B 3Q2FA 5AMEA 4IOOA 4YK0A 4NXJA 4YYJA 3MUKA 5FH8A 2RNWA 2RI7A 2DKWA 2NXBA 4O71A 4HXSA 5EK9A 4LZRA 5D25A 4UIWA 5BT3A 4YYMA 5EQ1A 5I29A 4Z1SA 5EPBA 4LZSA 4NYWA 3P1DA 2R0SA 2D82A 5TB6A 5J0DA 4MR4A 4YATA 2OUOA 4A9IA 4C67A 4QSUA 4NR4A 5C87A 2MJVB 5EU1A 3LQHA 4PS5A 5FB1A 4QNSA 4YYDA 5KTWA 5H1TA 3DWYA 5CQ5A 5F5ZA 4UYHA 4C66A 4LZ2A 4MR6A 4GPJA 5LKTA 5EPSA 5FE8A 2G4AA 4N4IA 4KCXA 4OGIA 4YY4A 3MQMA 1X0JA 4QUUA 5CQ8A 5FH7A 4WIVA 3U5JA 3DAIA 5F62A 5A85A 2WP1A 3SVHA 2YQDA 3JVJA 5I40A 4ZC9A 5DW2A 5I7XA 5I88A 4YBMA 4NQNA 4YH4A 3O33A 5ENBA 1WUGA 5HENA 3K2JA 2RFJA 3ERRA 5I86A 4A9NA 4CUUA 4LYIA 4TT6A 4XUAA 5D0CA 4J0SA 1EQFA 3P1EA 4TZ8A 5HFRA 5F63A 4NR9A 5KTXA 4A9FA 5EA1A 4UYFA 2H60A 3Q2EA 5FG4A 5L99A 4NYVA 4AKIA 4QSPA 2YEMA 5L8UA 2R0YA 4HXOA 4NRBA 4UITA 4BW1A 5JI8A 4QUTA 5FG5A 5CQ7A 5HQ6A 5HRXA 4CL9A 3FKMX 3LXJA 3D1BA 4TQNA 3UV5A 5AMFA 4BHWA 4N3WA 5LJ2A 4ALGA 2R10A 5EVAA 2YELA 5F60A 5FE4A 4NRCA 5HRVA 4QZSA 5ENFA 4CUQA 4NR8A 4MR3A 5CPEA 4YYHA 1JSPB 5EWCA 5CUEA 4YY6A 4E96A 5FFYA 3QZTA 4F3IA 4MEQA 5EP7A 2RO1A 4QY4A 4NRAA 3VKGA 5CQ3A 5E73A 4XUBA 4HBYA 4N4GA 4AKNA 5DFCA 4QR4A 3O35A 5AD3A 4AI6A 3U5NA 4PKLA 4UYFB 5CQ6A 5H1UA 5IGLA 4TZ2A 5A83A 3AQAA 4AKGA 5HELA 4YYGA 2N9GA 2YDWA 5FE5A 5L96A 4YADA 4TU4A 3G0LA 5L97A 2E7OA 4O77A 5LJ1A 4ALHA 5F25A 5C85A 4YYIA 5II1A 2F6JA 5F3AA 3MULA 3ONIA 4A9LA 4HBXA 3U5MA 2RNYA 5CFWA 4MR5A 5HEMA 4A9MA 5LKUA 5JWMA 2I7KA 4IR4A 4O7BA 5A5PA 2L5EA 5ENCA 1PUOA 4PCEA 5F36A 5EI4A 5ENEA 5CUAA 5E9LA 4UYDA 5DY7A 5L8TA 3LJWA 4WHWA 5FBXA 3I3JA 4TYLA 4NR6A 4QSQA 4QSXA 2DATA 4HBWA 3QZVA 4N4FA 5I80A 4J0RA 5HLSA 5A81A 3D1DA 4CFLA 4LR6A 5IIDA 5IGKA 2GRCA 4UIZA 4QYLA 5E9IA 4BJXA 2OO1A 5E9MA 5CQTA 4NR7A 5E0RA 4UIUA 4BW3A 5H1VA 3S91A 4UYEA 4PTBA 4LC2A 5F61A 4KV4A 5LUUA 2KTBB 5ENHA 5HFQA 4QEWA 5A5RA 5DFDA 5DKHA 3U5OA 5FE2A 4HBVA 3UW9A 3P1CA 4A9HA 4O70A 3ZYUA 2DVSA 4NUCA 5FFWA 5CU8A 5A5OA 1ZS5A 4BW2A 5HCLA 4XY8A 4N4HA 5EWDA 5H85A 5FE3A 5COIA 5CGPA 3U5KA 2DWWA 4PY6A 4HXKA 5C8GA 3HMFA 5FG6A 5CTLA 5AD2A 4UIYA 5I1QA 3U5LA 2YW5A 5DBMA 3MXFA 4HXNA 5DW1A 5IGMA 5D3RA 5ETDA 3NXBA 3HMEA 5CUDA 5A7CA 4CURA 5A5QA 5EPRA 5FE9A 5K29A 3JVKA 4WHUA 5EGUA 1N72A 3JVLA 5I7YA 4J3IA 4CUPA 2E3KA 4ZW1A 4HXMA 4J1PA 2L85A 5BT4A 4LYWA 3HMHA 4O7FA 2DVVA 2FSAA 5D7XA 1E6IA 4HXLA 4OUFA 5DYXA 4DONA 5ETBA 3LQJA 4O7AA 3S92A 4UIVA 4NR5A 4BW4A 5DYUA 5ACYA 4TU6A 4Z6IA 4MENA 3UVDA 4QSVA 4QSRA 4LYSA 5KO4A 5CY9A 4QSTA 5EM3A 5CQ4A 5E74A 2F6NA 5CP5A 4QBMA 4ZQLA 5EWHA 4NYXA 4YABA 4TT2A 5HRWA 5C4QA 4QEVA 4RVRA 4LRGA 5I89A 4Q0OA 5BT5A 4YBSA 5LJ0A 2EJNA 3VKHA 5C89A 5F1LA 2I8NA 4QB3A 5DYCA 4IR3A 5KU3A 4YBTA 2LSPB 4A9JA 2OSSA 4O75A 4TT4A 5II2A 3G0JA 4O72A 5FE1A 3P1FA 3O34A 5CUGA 4OGJA 2DVRA 4TTEA 4YYKA 1ZKRA 4YYNA 5CRMA 4IOQA 4XY9A 4TS8A 4Z93A 5E3DA 4QYDA 5IGNA 5ENJA 5EICA 4AKHA 4QSSA 4MEOA 4X2IA 5DYAA 2YYNA 3JVMA 4Z1QA 4UYGA 4O7EA 5ENGA 5EWWA 1F68A 3O37A 5DFBA 5DX4A 3P5OA 4IORA 5E3GA 4YAXA 5ENIA 4CLBA 5G4RA 2DVQA 3IU5A 4QC1A 4CFKA 5FE0A 5A5SA 3UV2A 5DLXA 5LKZA 5E7DA 4CUSA 5F2PA 4QR3A 5D3SA 3U5PA 4YC9A 5CS8A 5F1HA 4O74A 4FLPA 4UIXA 4KV1A 2YEKA 1WUMA 4A9KA 5E9VA 4PCIA 1JM4B 3QZSA 2R0VA 5CQAA 2RNXA 3UV4A 5E9YA 5KHMA 5HQ7A 4IR6A 4Z6HA 3O36A 2E7NA 5D3JA 5EV9A 5FDZA 4QSWA 5DKDA 3UVXA 5D24A 5FE7A 4Y03A 5C7NA 5D3LA 5FE6A 5A5NA 3MB3A 5TCMA 4Q0NA
chains in the Genus database with same CATH topology
3UVYA 5CUBA 4NS5A 5LKXA 3TLPA 5CZGA 4IR5A 4NQMA 5LVRA 3MB4A 5FFVA 4QC3A 4YH3A 5D3PA 4A9OA 3LQIA 4QR5A 5IBNA 3SVGA 5DKCA 5D3HA 5HJCA 5D26A 5A82A 5HQ5A 3UVWA 3AADA 4NUDA 3IU6A 4MEPA 5EWVA 3SVFA 4NUEA 4QEUA 4XYAA 3D7CA 5HM0A 4HXPA 4LDFA 5I83A 2D9EA 4HXRA 2L84A 5DLZA 4O78A 5D3NA 5G4SA 5D3TA 3RCWA 5EISA 5IG6A 4CUTA 5FB0A 3GG3A 4O7CA 5KTUA 5CRZA 5CUCA 5LVQA 4A9EA 5L98A 2WP2A 5E9KA 4O76A 5FH6A 2RS9B 3Q2FA 5AMEA 4IOOA 4YK0A 4NXJA 4YYJA 3MUKA 5FH8A 2RNWA 2RI7A 2DKWA 2NXBA 4O71A 4HXSA 5EK9A 4LZRA 5D25A 4UIWA 5BT3A 4YYMA 5EQ1A 5I29A 4Z1SA 5EPBA 4LZSA 4NYWA 3P1DA 2R0SA 2D82A 5TB6A 5J0DA 4MR4A 4YATA 2OUOA 4A9IA 4C67A 4QSUA 4NR4A 5C87A 2MJVB 5EU1A 3LQHA 4PS5A 5FB1A 4QNSA 4YYDA 5KTWA 5H1TA 3DWYA 5CQ5A 5F5ZA 4UYHA 4C66A 4LZ2A 4MR6A 4GPJA 5LKTA 5EPSA 5FE8A 2G4AA 4N4IA 4KCXA 4OGIA 4YY4A 3MQMA 1X0JA 4QUUA 5CQ8A 5FH7A 4WIVA 3U5JA 3DAIA 5F62A 5A85A 2WP1A 3SVHA 2YQDA 3JVJA 5I40A 4ZC9A 5DW2A 5I7XA 5I88A 4YBMA 4NQNA 4YH4A 3O33A 5ENBA 1WUGA 5HENA 3K2JA 2RFJA 5I86A 4A9NA 4CUUA 4LYIA 4TT6A 4XUAA 5D0CA 4J0SA 1EQFA 3P1EA 4TZ8A 5HFRA 5F63A 4NR9A 5KTXA 4A9FA 5EA1A 4UYFA 2H60A 3Q2EA 5FG4A 5L99A 4NYVA 4QSPA 2YEMA 5L8UA 2R0YA 4HXOA 4NRBA 4UITA 4BW1A 5JI8A 4QUTA 5FG5A 5CQ7A 5HQ6A 5HRXA 4CL9A 3FKMX 3LXJA 4TQNA 3UV5A 5AMFA 4BHWA 4N3WA 5LJ2A 4ALGA 2R10A 5EVAA 2YELA 5F60A 5FE4A 4NRCA 5HRVA 4QZSA 5ENFA 4CUQA 4NR8A 4MR3A 5CPEA 4YYHA 1JSPB 5EWCA 5CUEA 4YY6A 4E96A 5FFYA 3QZTA 4F3IA 4MEQA 5EP7A 2RO1A 4QY4A 4NRAA 5CQ3A 5E73A 4XUBA 4HBYA 4N4GA 4AKNA 5DFCA 4QR4A 3O35A 5AD3A 3U5NA 4PKLA 4UYFB 5CQ6A 5H1UA 5IGLA 4TZ2A 5A83A 3AQAA 5HELA 4YYGA 2N9GA 2YDWA 5FE5A 5L96A 4YADA 4TU4A 3G0LA 5L97A 2E7OA 4O77A 5LJ1A 4ALHA 5F25A 5C85A 4YYIA 5II1A 2F6JA 5F3AA 3MULA 3ONIA 4A9LA 4HBXA 3U5MA 2RNYA 5CFWA 4MR5A 5HEMA 4A9MA 5LKUA 5JWMA 2I7KA 4IR4A 4O7BA 5A5PA 2L5EA 5ENCA 4PCEA 5F36A 5EI4A 5ENEA 5CUAA 5E9LA 4UYDA 5DY7A 5L8TA 3LJWA 4WHWA 5FBXA 3I3JA 4TYLA 4NR6A 4QSQA 4QSXA 2DATA 4HBWA 3QZVA 4N4FA 5I80A 4J0RA 5HLSA 5A81A 4CFLA 4LR6A 5IIDA 5IGKA 2GRCA 4UIZA 4QYLA 5E9IA 4BJXA 2OO1A 5E9MA 5CQTA 4NR7A 5E0RA 4UIUA 4BW3A 5H1VA 3S91A 4UYEA 4PTBA 4LC2A 5F61A 4KV4A 5LUUA 2KTBB 5ENHA 5HFQA 4QEWA 5A5RA 5DFDA 5DKHA 3U5OA 5FE2A 4HBVA 3UW9A 3P1CA 4A9HA 4O70A 3ZYUA 2DVSA 4NUCA 5FFWA 5CU8A 5A5OA 1ZS5A 4BW2A 5HCLA 4XY8A 4N4HA 5EWDA 5H85A 5FE3A 5COIA 5CGPA 3U5KA 2DWWA 4PY6A 4HXKA 5C8GA 3HMFA 5FG6A 5CTLA 5AD2A 4UIYA 5I1QA 3U5LA 2YW5A 5DBMA 3MXFA 4HXNA 5DW1A 5IGMA 5D3RA 5ETDA 3NXBA 3HMEA 5CUDA 5A7CA 4CURA 5A5QA 5EPRA 5FE9A 5K29A 3JVKA 4WHUA 5EGUA 1N72A 3JVLA 5I7YA 4J3IA 4CUPA 2E3KA 4ZW1A 4HXMA 4J1PA 2L85A 5BT4A 4LYWA 3HMHA 4O7FA 2DVVA 2FSAA 5D7XA 1E6IA 4HXLA 4OUFA 5DYXA 4DONA 5ETBA 3LQJA 4O7AA 3S92A 4UIVA 4NR5A 4BW4A 5DYUA 5ACYA 4TU6A 4Z6IA 4MENA 3UVDA 4QSVA 4QSRA 4LYSA 5KO4A 5CY9A 4QSTA 5EM3A 5CQ4A 5E74A 2F6NA 5CP5A 4QBMA 4ZQLA 5EWHA 4NYXA 4YABA 4TT2A 5HRWA 5C4QA 4QEVA 4RVRA 4LRGA 5I89A 4Q0OA 5BT5A 4YBSA 5LJ0A 5C89A 5F1LA 2I8NA 4QB3A 5DYCA 4IR3A 5KU3A 4YBTA 2LSPB 4A9JA 2OSSA 4O75A 4TT4A 5II2A 3G0JA 4O72A 5FE1A 3P1FA 3O34A 5CUGA 4OGJA 2DVRA 4TTEA 4YYKA 4YYNA 5CRMA 4IOQA 4XY9A 4TS8A 4Z93A 5E3DA 4QYDA 5IGNA 5ENJA 5EICA 4QSSA 4MEOA 4X2IA 5DYAA 2YYNA 3JVMA 4Z1QA 4UYGA 4O7EA 5ENGA 5EWWA 1F68A 3O37A 5DFBA 5DX4A 3P5OA 4IORA 5E3GA 4YAXA 5ENIA 4CLBA 5G4RA 2DVQA 3IU5A 4QC1A 4CFKA 5FE0A 5A5SA 3UV2A 5DLXA 5LKZA 5E7DA 4CUSA 5F2PA 4QR3A 5D3SA 3U5PA 4YC9A 5CS8A 5F1HA 4O74A 4FLPA 4UIXA 4KV1A 2YEKA 1WUMA 4A9KA 5E9VA 4PCIA 1JM4B 3QZSA 2R0VA 5CQAA 2RNXA 3UV4A 5E9YA 5KHMA 5HQ7A 4IR6A 4Z6HA 3O36A 2E7NA 5D3JA 5EV9A 5FDZA 4QSWA 5DKDA 3UVXA 5D24A 5FE7A 4Y03A 5C7NA 5D3LA 5FE6A 5A5NA 3MB3A 5TCMA 4Q0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UVY A;  5CUB A;  4NS5 A;  5LKX A;  3TLP A;  5CZG A;  4IR5 A;  4NQM A;  5LVR A;  3MB4 A;  5FFV A;  4QC3 A;  4YH3 A;  5D3P A;  4A9O A;  3LQI A;  4QR5 A;  5IBN A;  3SVG A;  5DKC A;  5D3H A;  5HJC A;  5D26 A;  5A82 A;  5HQ5 A;  3UVW A;  3AAD A;  4NUD A;  3IU6 A;  4MEP A;  5EWV A;  3SVF A;  4NUE A;  4QEU A;  4XYA A;  3D7C A;  5HM0 A;  4HXP A;  4LDF A;  5I83 A;  2D9E A;  4HXR A;  2L84 A;  5DLZ A;  4O78 A;  5D3N A;  5G4S A;  5D3T A;  3RCW A;  5EIS A;  5IG6 A;  4CUT A;  5FB0 A;  3GG3 A;  4O7C A;  5KTU A;  5CRZ A;  5CUC A;  5LVQ A;  4A9E A;  5L98 A;  2WP2 A;  5E9K A;  4O76 A;  5FH6 A;  2RS9 B;  3Q2F A;  5AME A;  4IOO A;  4YK0 A;  4NXJ A;  4YYJ A;  3MUK A;  5FH8 A;  2RNW A;  2RI7 A;  2DKW A;  2NXB A;  4O71 A;  4HXS A;  5EK9 A;  4LZR A;  5D25 A;  4UIW A;  5BT3 A;  4YYM A;  5EQ1 A;  5I29 A;  4Z1S A;  5EPB A;  4LZS A;  4NYW A;  3P1D A;  2R0S A;  2D82 A;  5TB6 A;  5J0D A;  4MR4 A;  4YAT A;  2OUO A;  4A9I A;  4C67 A;  4QSU A;  4NR4 A;  5C87 A;  2MJV B;  5EU1 A;  3LQH A;  4PS5 A;  5FB1 A;  4QNS A;  4YYD A;  5KTW A;  5H1T A;  3DWY A;  5CQ5 A;  5F5Z A;  4UYH A;  4C66 A;  4LZ2 A;  4MR6 A;  4GPJ A;  5LKT A;  5EPS A;  5FE8 A;  2G4A A;  4N4I A;  4KCX A;  4OGI A;  4YY4 A;  3MQM A;  1X0J A;  4QUU A;  5CQ8 A;  5FH7 A;  4WIV A;  3U5J A;  3DAI A;  5F62 A;  5A85 A;  2WP1 A;  3SVH A;  2YQD A;  3JVJ A;  5I40 A;  4ZC9 A;  5DW2 A;  5I7X A;  5I88 A;  4YBM A;  4NQN A;  4YH4 A;  3O33 A;  5ENB A;  1WUG A;  5HEN A;  3K2J A;  2RFJ A;  5I86 A;  4A9N A;  4CUU A;  4LYI A;  4TT6 A;  4XUA A;  5D0C A;  4J0S A;  1EQF A;  3P1E A;  4TZ8 A;  5HFR A;  5F63 A;  4NR9 A;  5KTX A;  4A9F A;  5EA1 A;  4UYF A;  2H60 A;  3Q2E A;  5FG4 A;  5L99 A;  4NYV A;  4QSP A;  2YEM A;  5L8U A;  2R0Y A;  4HXO A;  4NRB A;  4UIT A;  4BW1 A;  5JI8 A;  4QUT A;  5FG5 A;  5CQ7 A;  5HQ6 A;  5HRX A;  4CL9 A;  3FKM X;  3LXJ A;  4TQN A;  3UV5 A;  5AMF A;  4BHW A;  4N3W A;  5LJ2 A;  4ALG A;  2R10 A;  5EVA A;  2YEL A;  5F60 A;  5FE4 A;  4NRC A;  5HRV A;  4QZS A;  5ENF A;  4CUQ A;  4NR8 A;  4MR3 A;  5CPE A;  4YYH A;  1JSP B;  5EWC A;  5CUE A;  4YY6 A;  4E96 A;  5FFY A;  3QZT A;  4F3I A;  4MEQ A;  5EP7 A;  2RO1 A;  4QY4 A;  4NRA A;  5CQ3 A;  5E73 A;  4XUB A;  4HBY A;  4N4G A;  4AKN A;  5DFC A;  4QR4 A;  3O35 A;  5AD3 A;  3U5N A;  4PKL A;  4UYF B;  5CQ6 A;  5H1U A;  5IGL A;  4TZ2 A;  5A83 A;  3AQA A;  5HEL A;  4YYG A;  2N9G A;  2YDW A;  5FE5 A;  5L96 A;  4YAD A;  4TU4 A;  3G0L A;  5L97 A;  2E7O A;  4O77 A;  5LJ1 A;  4ALH A;  5F25 A;  5C85 A;  4YYI A;  5II1 A;  2F6J A;  5F3A A;  3MUL A;  3ONI A;  4A9L A;  4HBX A;  3U5M A;  2RNY A;  5CFW A;  4MR5 A;  5HEM A;  4A9M A;  5LKU A;  5JWM A;  2I7K A;  4IR4 A;  4O7B A;  5A5P A;  2L5E A;  5ENC A;  4PCE A;  5F36 A;  5EI4 A;  5ENE A;  5CUA A;  5E9L A;  4UYD A;  5DY7 A;  5L8T A;  3LJW A;  4WHW A;  5FBX A;  3I3J A;  4TYL A;  4NR6 A;  4QSQ A;  4QSX A;  2DAT A;  4HBW A;  3QZV A;  4N4F A;  5I80 A;  4J0R A;  5HLS A;  5A81 A;  4CFL A;  4LR6 A;  5IID A;  5IGK A;  2GRC A;  4UIZ A;  4QYL A;  5E9I A;  4BJX A;  2OO1 A;  5E9M A;  5CQT A;  4NR7 A;  5E0R A;  4UIU A;  4BW3 A;  5H1V A;  3S91 A;  4UYE A;  4PTB A;  4LC2 A;  5F61 A;  4KV4 A;  5LUU A;  2KTB B;  5ENH A;  5HFQ A;  4QEW A;  5A5R A;  5DFD A;  5DKH A;  3U5O A;  5FE2 A;  4HBV A;  3UW9 A;  3P1C A;  4A9H A;  4O70 A;  3ZYU A;  2DVS A;  4NUC A;  5FFW A;  5CU8 A;  5A5O A;  1ZS5 A;  4BW2 A;  5HCL A;  4XY8 A;  4N4H A;  5EWD A;  5H85 A;  5FE3 A;  5COI A;  5CGP A;  3U5K A;  2DWW A;  4PY6 A;  4HXK A;  5C8G A;  3HMF A;  5FG6 A;  5CTL A;  5AD2 A;  4UIY A;  5I1Q A;  3U5L A;  2YW5 A;  5DBM A;  3MXF A;  4HXN A;  5DW1 A;  5IGM A;  5D3R A;  5ETD A;  3NXB A;  3HME A;  5CUD A;  5A7C A;  4CUR A;  5A5Q A;  5EPR A;  5FE9 A;  5K29 A;  3JVK A;  4WHU A;  5EGU A;  1N72 A;  3JVL A;  5I7Y A;  4J3I A;  4CUP A;  2E3K A;  4ZW1 A;  4HXM A;  4J1P A;  2L85 A;  5BT4 A;  4LYW A;  3HMH A;  4O7F A;  2DVV A;  2FSA A;  5D7X A;  1E6I A;  4HXL A;  4OUF A;  5DYX A;  4DON A;  5ETB A;  3LQJ A;  4O7A A;  3S92 A;  4UIV A;  4NR5 A;  4BW4 A;  5DYU A;  5ACY A;  4TU6 A;  4Z6I A;  4MEN A;  3UVD A;  4QSV A;  4QSR A;  4LYS A;  5KO4 A;  5CY9 A;  4QST A;  5EM3 A;  5CQ4 A;  5E74 A;  2F6N A;  5CP5 A;  4QBM A;  4ZQL A;  5EWH A;  4NYX A;  4YAB A;  4TT2 A;  5HRW A;  5C4Q A;  4QEV A;  4RVR A;  4LRG A;  5I89 A;  4Q0O A;  5BT5 A;  4YBS A;  5LJ0 A;  5C89 A;  5F1L A;  2I8N A;  4QB3 A;  5DYC A;  4IR3 A;  5KU3 A;  4YBT A;  2LSP B;  4A9J A;  2OSS A;  4O75 A;  4TT4 A;  5II2 A;  3G0J A;  4O72 A;  5FE1 A;  3P1F A;  3O34 A;  5CUG A;  4OGJ A;  2DVR A;  4TTE A;  4YYK A;  4YYN A;  5CRM A;  4IOQ A;  4XY9 A;  4TS8 A;  4Z93 A;  5E3D A;  4QYD A;  5IGN A;  5ENJ A;  5EIC A;  4QSS A;  4MEO A;  4X2I A;  5DYA A;  2YYN A;  3JVM A;  4Z1Q A;  4UYG A;  4O7E A;  5ENG A;  5EWW A;  1F68 A;  3O37 A;  5DFB A;  5DX4 A;  3P5O A;  4IOR A;  5E3G A;  4YAX A;  5ENI A;  4CLB A;  5G4R A;  2DVQ A;  3IU5 A;  4QC1 A;  4CFK A;  5FE0 A;  5A5S A;  3UV2 A;  5DLX A;  5LKZ A;  5E7D A;  4CUS A;  5F2P A;  4QR3 A;  5D3S A;  3U5P A;  4YC9 A;  5CS8 A;  5F1H A;  4O74 A;  4FLP A;  4UIX A;  4KV1 A;  2YEK A;  1WUM A;  4A9K A;  5E9V A;  4PCI A;  1JM4 B;  3QZS A;  2R0V A;  5CQA A;  2RNX A;  3UV4 A;  5E9Y A;  5KHM A;  5HQ7 A;  4IR6 A;  4Z6H A;  3O36 A;  2E7N A;  5D3J A;  5EV9 A;  5FDZ A;  4QSW A;  5DKD A;  3UVX A;  5D24 A;  5FE7 A;  4Y03 A;  5C7N A;  5D3L A;  5FE6 A;  5A5N A;  3MB3 A;  5TCM A;  4Q0N A; 
#chains in the Genus database with same CATH topology
 3UVY A;  5CUB A;  4NS5 A;  5LKX A;  3TLP A;  5CZG A;  4IR5 A;  4NQM A;  5LVR A;  3MB4 A;  5FFV A;  4QC3 A;  4YH3 A;  5D3P A;  4A9O A;  3LQI A;  4QR5 A;  5IBN A;  3SVG A;  5DKC A;  5D3H A;  5HJC A;  5D26 A;  5A82 A;  5HQ5 A;  3UVW A;  3AAD A;  4NUD A;  3IU6 A;  4MEP A;  5EWV A;  3SVF A;  4NUE A;  4QEU A;  4XYA A;  3D7C A;  5HM0 A;  4HXP A;  4LDF A;  5I83 A;  2D9E A;  4HXR A;  2L84 A;  5DLZ A;  4O78 A;  5D3N A;  5G4S A;  5D3T A;  3RCW A;  5EIS A;  5IG6 A;  4CUT A;  5FB0 A;  3GG3 A;  4O7C A;  5KTU A;  5CRZ A;  5CUC A;  5LVQ A;  4A9E A;  5L98 A;  2WP2 A;  5E9K A;  4O76 A;  5FH6 A;  2RS9 B;  3Q2F A;  5AME A;  4IOO A;  4YK0 A;  4NXJ A;  4YYJ A;  3MUK A;  5FH8 A;  2RNW A;  2RI7 A;  2DKW A;  2NXB A;  4O71 A;  4HXS A;  5EK9 A;  4LZR A;  5D25 A;  4UIW A;  5BT3 A;  4YYM A;  5EQ1 A;  5I29 A;  4Z1S A;  5EPB A;  4LZS A;  4NYW A;  3P1D A;  2R0S A;  2D82 A;  5TB6 A;  5J0D A;  4MR4 A;  4YAT A;  2OUO A;  4A9I A;  4C67 A;  4QSU A;  4NR4 A;  5C87 A;  2MJV B;  5EU1 A;  3LQH A;  4PS5 A;  5FB1 A;  4QNS A;  4YYD A;  5KTW A;  5H1T A;  3DWY A;  5CQ5 A;  5F5Z A;  4UYH A;  4C66 A;  4LZ2 A;  4MR6 A;  4GPJ A;  5LKT A;  5EPS A;  5FE8 A;  2G4A A;  4N4I A;  4KCX A;  4OGI A;  4YY4 A;  3MQM A;  1X0J A;  4QUU A;  5CQ8 A;  5FH7 A;  4WIV A;  3U5J A;  3DAI A;  5F62 A;  5A85 A;  2WP1 A;  3SVH A;  2YQD A;  3JVJ A;  5I40 A;  4ZC9 A;  5DW2 A;  5I7X A;  5I88 A;  4YBM A;  4NQN A;  4YH4 A;  3O33 A;  5ENB A;  1WUG A;  5HEN A;  3K2J A;  2RFJ A;  3ERR A;  5I86 A;  4A9N A;  4CUU A;  4LYI A;  4TT6 A;  4XUA A;  5D0C A;  4J0S A;  1EQF A;  3P1E A;  4TZ8 A;  5HFR A;  5F63 A;  4NR9 A;  5KTX A;  4A9F A;  5EA1 A;  4UYF A;  2H60 A;  3Q2E A;  5FG4 A;  5L99 A;  4NYV A;  4AKI A;  4QSP A;  2YEM A;  5L8U A;  2R0Y A;  4HXO A;  4NRB A;  4UIT A;  4BW1 A;  5JI8 A;  4QUT A;  5FG5 A;  5CQ7 A;  5HQ6 A;  5HRX A;  4CL9 A;  3FKM X;  3LXJ A;  3D1B A;  4TQN A;  3UV5 A;  5AMF A;  4BHW A;  4N3W A;  5LJ2 A;  4ALG A;  2R10 A;  5EVA A;  2YEL A;  5F60 A;  5FE4 A;  4NRC A;  5HRV A;  4QZS A;  5ENF A;  4CUQ A;  4NR8 A;  4MR3 A;  5CPE A;  4YYH A;  1JSP B;  5EWC A;  5CUE A;  4YY6 A;  4E96 A;  5FFY A;  3QZT A;  4F3I A;  4MEQ A;  5EP7 A;  2RO1 A;  4QY4 A;  4NRA A;  3VKG A;  5CQ3 A;  5E73 A;  4XUB A;  4HBY A;  4N4G A;  4AKN A;  5DFC A;  4QR4 A;  3O35 A;  5AD3 A;  4AI6 A;  3U5N A;  4PKL A;  4UYF B;  5CQ6 A;  5H1U A;  5IGL A;  4TZ2 A;  5A83 A;  3AQA A;  4AKG A;  5HEL A;  4YYG A;  2N9G A;  2YDW A;  5FE5 A;  5L96 A;  4YAD A;  4TU4 A;  3G0L A;  5L97 A;  2E7O A;  4O77 A;  5LJ1 A;  4ALH A;  5F25 A;  5C85 A;  4YYI A;  5II1 A;  2F6J A;  5F3A A;  3MUL A;  3ONI A;  4A9L A;  4HBX A;  3U5M A;  2RNY A;  5CFW A;  4MR5 A;  5HEM A;  4A9M A;  5LKU A;  5JWM A;  2I7K A;  4IR4 A;  4O7B A;  5A5P A;  2L5E A;  5ENC A;  1PUO A;  4PCE A;  5F36 A;  5EI4 A;  5ENE A;  5CUA A;  5E9L A;  4UYD A;  5DY7 A;  5L8T A;  3LJW A;  4WHW A;  5FBX A;  3I3J A;  4TYL A;  4NR6 A;  4QSQ A;  4QSX A;  2DAT A;  4HBW A;  3QZV A;  4N4F A;  5I80 A;  4J0R A;  5HLS A;  5A81 A;  3D1D A;  4CFL A;  4LR6 A;  5IID A;  5IGK A;  2GRC A;  4UIZ A;  4QYL A;  5E9I A;  4BJX A;  2OO1 A;  5E9M A;  5CQT A;  4NR7 A;  5E0R A;  4UIU A;  4BW3 A;  5H1V A;  3S91 A;  4UYE A;  4PTB A;  4LC2 A;  5F61 A;  4KV4 A;  5LUU A;  2KTB B;  5ENH A;  5HFQ A;  4QEW A;  5A5R A;  5DFD A;  5DKH A;  3U5O A;  5FE2 A;  4HBV A;  3UW9 A;  3P1C A;  4A9H A;  4O70 A;  3ZYU A;  2DVS A;  4NUC A;  5FFW A;  5CU8 A;  5A5O A;  1ZS5 A;  4BW2 A;  5HCL A;  4XY8 A;  4N4H A;  5EWD A;  5H85 A;  5FE3 A;  5COI A;  5CGP A;  3U5K A;  2DWW A;  4PY6 A;  4HXK A;  5C8G A;  3HMF A;  5FG6 A;  5CTL A;  5AD2 A;  4UIY A;  5I1Q A;  3U5L A;  2YW5 A;  5DBM A;  3MXF A;  4HXN A;  5DW1 A;  5IGM A;  5D3R A;  5ETD A;  3NXB A;  3HME A;  5CUD A;  5A7C A;  4CUR A;  5A5Q A;  5EPR A;  5FE9 A;  5K29 A;  3JVK A;  4WHU A;  5EGU A;  1N72 A;  3JVL A;  5I7Y A;  4J3I A;  4CUP A;  2E3K A;  4ZW1 A;  4HXM A;  4J1P A;  2L85 A;  5BT4 A;  4LYW A;  3HMH A;  4O7F A;  2DVV A;  2FSA A;  5D7X A;  1E6I A;  4HXL A;  4OUF A;  5DYX A;  4DON A;  5ETB A;  3LQJ A;  4O7A A;  3S92 A;  4UIV A;  4NR5 A;  4BW4 A;  5DYU A;  5ACY A;  4TU6 A;  4Z6I A;  4MEN A;  3UVD A;  4QSV A;  4QSR A;  4LYS A;  5KO4 A;  5CY9 A;  4QST A;  5EM3 A;  5CQ4 A;  5E74 A;  2F6N A;  5CP5 A;  4QBM A;  4ZQL A;  5EWH A;  4NYX A;  4YAB A;  4TT2 A;  5HRW A;  5C4Q A;  4QEV A;  4RVR A;  4LRG A;  5I89 A;  4Q0O A;  5BT5 A;  4YBS A;  5LJ0 A;  2EJN A;  3VKH A;  5C89 A;  5F1L A;  2I8N A;  4QB3 A;  5DYC A;  4IR3 A;  5KU3 A;  4YBT A;  2LSP B;  4A9J A;  2OSS A;  4O75 A;  4TT4 A;  5II2 A;  3G0J A;  4O72 A;  5FE1 A;  3P1F A;  3O34 A;  5CUG A;  4OGJ A;  2DVR A;  4TTE A;  4YYK A;  1ZKR A;  4YYN A;  5CRM A;  4IOQ A;  4XY9 A;  4TS8 A;  4Z93 A;  5E3D A;  4QYD A;  5IGN A;  5ENJ A;  5EIC A;  4AKH A;  4QSS A;  4MEO A;  4X2I A;  5DYA A;  2YYN A;  3JVM A;  4Z1Q A;  4UYG A;  4O7E A;  5ENG A;  5EWW A;  1F68 A;  3O37 A;  5DFB A;  5DX4 A;  3P5O A;  4IOR A;  5E3G A;  4YAX A;  5ENI A;  4CLB A;  5G4R A;  2DVQ A;  3IU5 A;  4QC1 A;  4CFK A;  5FE0 A;  5A5S A;  3UV2 A;  5DLX A;  5LKZ A;  5E7D A;  4CUS A;  5F2P A;  4QR3 A;  5D3S A;  3U5P A;  4YC9 A;  5CS8 A;  5F1H A;  4O74 A;  4FLP A;  4UIX A;  4KV1 A;  2YEK A;  1WUM A;  4A9K A;  5E9V A;  4PCI A;  1JM4 B;  3QZS A;  2R0V A;  5CQA A;  2RNX A;  3UV4 A;  5E9Y A;  5KHM A;  5HQ7 A;  4IR6 A;  4Z6H A;  3O36 A;  2E7N A;  5D3J A;  5EV9 A;  5FDZ A;  4QSW A;  5DKD A;  3UVX A;  5D24 A;  5FE7 A;  4Y03 A;  5C7N A;  5D3L A;  5FE6 A;  5A5N A;  3MB3 A;  5TCM A;  4Q0N A; 
#chains in the Genus database with same CATH homology
 3UVY A;  5CUB A;  4NS5 A;  5LKX A;  3TLP A;  5CZG A;  4IR5 A;  4NQM A;  5LVR A;  3MB4 A;  5FFV A;  4QC3 A;  4YH3 A;  5D3P A;  4A9O A;  3LQI A;  4QR5 A;  5IBN A;  3SVG A;  5DKC A;  5D3H A;  5HJC A;  5D26 A;  5A82 A;  5HQ5 A;  3UVW A;  3AAD A;  4NUD A;  3IU6 A;  4MEP A;  5EWV A;  3SVF A;  4NUE A;  4QEU A;  4XYA A;  3D7C A;  5HM0 A;  4HXP A;  4LDF A;  5I83 A;  2D9E A;  4HXR A;  2L84 A;  5DLZ A;  4O78 A;  5D3N A;  5G4S A;  5D3T A;  3RCW A;  5EIS A;  5IG6 A;  4CUT A;  5FB0 A;  3GG3 A;  4O7C A;  5KTU A;  5CRZ A;  5CUC A;  5LVQ A;  4A9E A;  5L98 A;  2WP2 A;  5E9K A;  4O76 A;  5FH6 A;  2RS9 B;  3Q2F A;  5AME A;  4IOO A;  4YK0 A;  4NXJ A;  4YYJ A;  3MUK A;  5FH8 A;  2RNW A;  2RI7 A;  2DKW A;  2NXB A;  4O71 A;  4HXS A;  5EK9 A;  4LZR A;  5D25 A;  4UIW A;  5BT3 A;  4YYM A;  5EQ1 A;  5I29 A;  4Z1S A;  5EPB A;  4LZS A;  4NYW A;  3P1D A;  2R0S A;  2D82 A;  5TB6 A;  5J0D A;  4MR4 A;  4YAT A;  2OUO A;  4A9I A;  4C67 A;  4QSU A;  4NR4 A;  5C87 A;  2MJV B;  5EU1 A;  3LQH A;  4PS5 A;  5FB1 A;  4QNS A;  4YYD A;  5KTW A;  5H1T A;  3DWY A;  5CQ5 A;  5F5Z A;  4UYH A;  4C66 A;  4LZ2 A;  4MR6 A;  4GPJ A;  5LKT A;  5EPS A;  5FE8 A;  2G4A A;  4N4I A;  4KCX A;  4OGI A;  4YY4 A;  3MQM A;  1X0J A;  4QUU A;  5CQ8 A;  5FH7 A;  4WIV A;  3U5J A;  3DAI A;  5F62 A;  5A85 A;  2WP1 A;  3SVH A;  2YQD A;  3JVJ A;  5I40 A;  4ZC9 A;  5DW2 A;  5I7X A;  5I88 A;  4YBM A;  4NQN A;  4YH4 A;  3O33 A;  5ENB A;  1WUG A;  5HEN A;  3K2J A;  2RFJ A;  5I86 A;  4A9N A;  4CUU A;  4LYI A;  4TT6 A;  4XUA A;  5D0C A;  4J0S A;  1EQF A;  3P1E A;  4TZ8 A;  5HFR A;  5F63 A;  4NR9 A;  5KTX A;  4A9F A;  5EA1 A;  4UYF A;  2H60 A;  3Q2E A;  5FG4 A;  5L99 A;  4NYV A;  4QSP A;  2YEM A;  5L8U A;  2R0Y A;  4HXO A;  4NRB A;  4UIT A;  4BW1 A;  5JI8 A;  4QUT A;  5FG5 A;  5CQ7 A;  5HQ6 A;  5HRX A;  4CL9 A;  3FKM X;  3LXJ A;  4TQN A;  3UV5 A;  5AMF A;  4BHW A;  4N3W A;  5LJ2 A;  4ALG A;  2R10 A;  5EVA A;  2YEL A;  5F60 A;  5FE4 A;  4NRC A;  5HRV A;  4QZS A;  5ENF A;  4CUQ A;  4NR8 A;  4MR3 A;  5CPE A;  4YYH A;  1JSP B;  5EWC A;  5CUE A;  4YY6 A;  4E96 A;  5FFY A;  3QZT A;  4F3I A;  4MEQ A;  5EP7 A;  2RO1 A;  4QY4 A;  4NRA A;  5CQ3 A;  5E73 A;  4XUB A;  4HBY A;  4N4G A;  4AKN A;  5DFC A;  4QR4 A;  3O35 A;  5AD3 A;  3U5N A;  4PKL A;  4UYF B;  5CQ6 A;  5H1U A;  5IGL A;  4TZ2 A;  5A83 A;  3AQA A;  5HEL A;  4YYG A;  2N9G A;  2YDW A;  5FE5 A;  5L96 A;  4YAD A;  4TU4 A;  3G0L A;  5L97 A;  2E7O A;  4O77 A;  5LJ1 A;  4ALH A;  5F25 A;  5C85 A;  4YYI A;  5II1 A;  2F6J A;  5F3A A;  3MUL A;  3ONI A;  4A9L A;  4HBX A;  3U5M A;  2RNY A;  5CFW A;  4MR5 A;  5HEM A;  4A9M A;  5LKU A;  5JWM A;  2I7K A;  4IR4 A;  4O7B A;  5A5P A;  2L5E A;  5ENC A;  4PCE A;  5F36 A;  5EI4 A;  5ENE A;  5CUA A;  5E9L A;  4UYD A;  5DY7 A;  5L8T A;  3LJW A;  4WHW A;  5FBX A;  3I3J A;  4TYL A;  4NR6 A;  4QSQ A;  4QSX A;  2DAT A;  4HBW A;  3QZV A;  4N4F A;  5I80 A;  4J0R A;  5HLS A;  5A81 A;  4CFL A;  4LR6 A;  5IID A;  5IGK A;  2GRC A;  4UIZ A;  4QYL A;  5E9I A;  4BJX A;  2OO1 A;  5E9M A;  5CQT A;  4NR7 A;  5E0R A;  4UIU A;  4BW3 A;  5H1V A;  3S91 A;  4UYE A;  4PTB A;  4LC2 A;  5F61 A;  4KV4 A;  5LUU A;  2KTB B;  5ENH A;  5HFQ A;  4QEW A;  5A5R A;  5DFD A;  5DKH A;  3U5O A;  5FE2 A;  4HBV A;  3UW9 A;  3P1C A;  4A9H A;  4O70 A;  3ZYU A;  2DVS A;  4NUC A;  5FFW A;  5CU8 A;  5A5O A;  1ZS5 A;  4BW2 A;  5HCL A;  4XY8 A;  4N4H A;  5EWD A;  5H85 A;  5FE3 A;  5COI A;  5CGP A;  3U5K A;  2DWW A;  4PY6 A;  4HXK A;  5C8G A;  3HMF A;  5FG6 A;  5CTL A;  5AD2 A;  4UIY A;  5I1Q A;  3U5L A;  2YW5 A;  5DBM A;  3MXF A;  4HXN A;  5DW1 A;  5IGM A;  5D3R A;  5ETD A;  3NXB A;  3HME A;  5CUD A;  5A7C A;  4CUR A;  5A5Q A;  5EPR A;  5FE9 A;  5K29 A;  3JVK A;  4WHU A;  5EGU A;  1N72 A;  3JVL A;  5I7Y A;  4J3I A;  4CUP A;  2E3K A;  4ZW1 A;  4HXM A;  4J1P A;  2L85 A;  5BT4 A;  4LYW A;  3HMH A;  4O7F A;  2DVV A;  2FSA A;  5D7X A;  1E6I A;  4HXL A;  4OUF A;  5DYX A;  4DON A;  5ETB A;  3LQJ A;  4O7A A;  3S92 A;  4UIV A;  4NR5 A;  4BW4 A;  5DYU A;  5ACY A;  4TU6 A;  4Z6I A;  4MEN A;  3UVD A;  4QSV A;  4QSR A;  4LYS A;  5KO4 A;  5CY9 A;  4QST A;  5EM3 A;  5CQ4 A;  5E74 A;  2F6N A;  5CP5 A;  4QBM A;  4ZQL A;  5EWH A;  4NYX A;  4YAB A;  4TT2 A;  5HRW A;  5C4Q A;  4QEV A;  4RVR A;  4LRG A;  5I89 A;  4Q0O A;  5BT5 A;  4YBS A;  5LJ0 A;  5C89 A;  5F1L A;  2I8N A;  4QB3 A;  5DYC A;  4IR3 A;  5KU3 A;  4YBT A;  2LSP B;  4A9J A;  2OSS A;  4O75 A;  4TT4 A;  5II2 A;  3G0J A;  4O72 A;  5FE1 A;  3P1F A;  3O34 A;  5CUG A;  4OGJ A;  2DVR A;  4TTE A;  4YYK A;  4YYN A;  5CRM A;  4IOQ A;  4XY9 A;  4TS8 A;  4Z93 A;  5E3D A;  4QYD A;  5IGN A;  5ENJ A;  5EIC A;  4QSS A;  4MEO A;  4X2I A;  5DYA A;  2YYN A;  3JVM A;  4Z1Q A;  4UYG A;  4O7E A;  5ENG A;  5EWW A;  1F68 A;  3O37 A;  5DFB A;  5DX4 A;  3P5O A;  4IOR A;  5E3G A;  4YAX A;  5ENI A;  4CLB A;  5G4R A;  2DVQ A;  3IU5 A;  4QC1 A;  4CFK A;  5FE0 A;  5A5S A;  3UV2 A;  5DLX A;  5LKZ A;  5E7D A;  4CUS A;  5F2P A;  4QR3 A;  5D3S A;  3U5P A;  4YC9 A;  5CS8 A;  5F1H A;  4O74 A;  4FLP A;  4UIX A;  4KV1 A;  2YEK A;  1WUM A;  4A9K A;  5E9V A;  4PCI A;  1JM4 B;  3QZS A;  2R0V A;  5CQA A;  2RNX A;  3UV4 A;  5E9Y A;  5KHM A;  5HQ7 A;  4IR6 A;  4Z6H A;  3O36 A;  2E7N A;  5D3J A;  5EV9 A;  5FDZ A;  4QSW A;  5DKD A;  3UVX A;  5D24 A;  5FE7 A;  4Y03 A;  5C7N A;  5D3L A;  5FE6 A;  5A5N A;  3MB3 A;  5TCM A;  4Q0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...