5I88A

Brd4 in complex with cpd4 ((e)-3-(6-(but-2-en-1-yl)-7-oxo-6,7-dihydro-1h-pyrrolo[2,3-c]pyridin-4-yl)-n,n-dimethylbenzamide)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
126
structure length
126
Chain Sequence
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 43
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i88A01
5DLXA 5E0RA 5ENCA 4UIYA 5CUGA 4QC1A 2DVSA 3SVFA 5I40A 2R0VA 3FKMX 3Q2FA 4YBTA 5A7CA 5FE1A 4YABA 5H1VA 3P1CA 2DVVA 4MEOA 4IORA 3G0LA 4YH3A 4O7FA 3K2JA 4Q0NA 4IR4A 4TYLA 5II1A 4YYMA 5HRWA 5IGKA 3U5LA 4WHUA 5ETBA 4A9OA 4Z6IA 2E3KA 4YYIA 4YY6A 5EWHA 4TT6A 5FE7A 4QEWA 5A83A 5F60A 5FBXA 4HBWA 4YH4A 5I80A 5CUBA 4Z93A 4O70A 5JI8A 4A9HA 2RO1A 2RS9B 5TB6A 4YYKA 2I7KA 2D9EA 4QEUA 3U5OA 4Z1SA 5H1TA 3S92A 2NXBA 5C7NA 5E9LA 5L8UA 2WP2A 5G4RA 1WUMA 4IR5A 3Q2EA 4QB3A 2G4AA 5D3LA 4HXSA 4PY6A 3G0JA 4UYEA 4NQMA 4HBVA 4N3WA 4Z1QA 4UIXA 4CFLA 5AMFA 4IOOA 5EPRA 3AQAA 5ACYA 4Q0OA 5EISA 3ONIA 5HQ6A 2RNWA 5CQAA 2F6NA 4FLPA 4BJXA 5JWMA 5C87A 5LJ0A 5LVRA 2OSSA 4UYFB 4QZSA 4WIVA 4LZ2A 4C67A 3LXJA 4UIZA 4MR5A 1E6IA 3IU5A 5CQTA 5CRMA 4QR4A 4QEVA 5EWWA 3QZTA 4PKLA 5F3AA 4NYXA 5AD2A 5HFRA 5ETDA 3HMHA 4TU4A 4GPJA 5BT5A 1JM4B 4QR3A 5I1QA 4ALHA 4MR4A 4LZRA 5L98A 5CZGA 5EICA 5BT3A 2F6JA 4QSSA 5E9VA 5LJ1A 2H60A 1X0JA 5L96A 2R10A 5FH8A 4UYGA 5F63A 5FFWA 5D24A 5F62A 2YEKA 2YEMA 5I89A 3UVDA 2L5EA 3D7CA 5FDZA 3JVKA 5E9MA 5CPEA 5EM3A 4HXOA 4UIUA 5FB1A 4QBMA 3P1FA 4UIVA 4YC9A 5FE3A 3MXFA 5I7XA 4KV1A 5KTUA 5E3GA 5DKCA 5CQ7A 4XYAA 5IGMA 4LRGA 5I86A 5I88A 4QSUA 4YBSA 4J0RA 5D7XA 5F5ZA 4NUCA 5DYUA 4XY8A 4XY9A 4TQNA 3GG3A 4O75A 4NUEA 5A5OA 4J1PA 2YQDA 5FB0A 3P5OA 2YELA 4OGIA 4QSWA 4A9IA 4NXJA 2DATA 5KTWA 4PCIA 4KCXA 2I8NA 1N72A 5HRXA 3MUKA 4MENA 4A9KA 5DFCA 4IR3A 4YYNA 5E7DA 5FE6A 5CRZA 4HXRA 4NR4A 5CUCA 5F2PA 2RFJA 3UW9A 5I83A 4NR7A 5EQ1A 4CFKA 2E7OA 4WHWA 4CUPA 5DLZA 3U5PA 5LKUA 1WUGA 4LR6A 4LZSA 5HENA 4QNSA 4J3IA 5IG6A 5HJCA 5FH6A 5HCLA 4NYWA 2RI7A 3HMEA 5A82A 4CL9A 5F25A 4LYWA 5ENFA 5D25A 5KU3A 4O78A 4CURA 3SVGA 3S91A 5LUUA 4MR6A 2WP1A 4IOQA 5G4SA 5AD3A 2DKWA 5A5RA 5A5QA 5HRVA 5CUDA 4O71A 3TLPA 4MEPA 5CQ4A 4N4HA 5D3NA 4LYIA 5CY9A 4Z6HA 4QSPA 5CU8A 5D3TA 4A9EA 3UVWA 5C89A 4LC2A 4A9MA 4MEQA 3O36A 5FE0A 5E73A 5FE5A 5L8TA 3JVLA 5A5PA 5EV9A 5DW1A 5EI4A 5KTXA 5H1UA 4NRAA 5FFVA 4N4FA 4TTEA 2OO1A 3MB3A 5LVQA 4QUTA 5DYCA 3UVYA 4NUDA 4O7BA 4F3IA 5DX4A 5CQ3A 5E3DA 5DKDA 4HXNA 2L84A 4OUFA 5FG6A 3UV4A 3DAIA 4YYGA 3JVJA 1JSPB 5E9IA 5ENGA 3AADA 5LKTA 5D0CA 4N4IA 4CUSA 4QY4A 2GRCA 5EP7A 4BW3A 4HXPA 4QYDA 2N9GA 4YYHA 4NYVA 4QSXA 5CGPA 5IIDA 2OUOA 5H85A 5K29A 4TT4A 4DONA 4O72A 2DVRA 4NQNA 4QSTA 4YBMA 5IBNA 4BW1A 5DFDA 5F36A 5HM0A 5F1LA 4Y03A 5C85A 5LKXA 5E9YA 5E9KA 4O77A 4QSVA 3IU6A 4HXKA 4QSQA 2R0SA 5EK9A 4CLBA 4TZ2A 5A5SA 5LKZA 5EA1A 5D26A 4HXMA 4YYJA 4NR6A 5COIA 4LDFA 4MR3A 5CQ6A 4QSRA 2L85A 4PS5A 4TU6A 5I29A 3P1DA 5HEMA 4CUQA 4ALGA 5DYXA 3LJWA 5CQ5A 5ENIA 3JVMA 4TS8A 5ENBA 5HQ7A 4YK0A 2KTBB 2R0YA 4QUUA 5L99A 4UYHA 2YYNA 3O34A 5DFBA 4C66A 3LQIA 2DWWA 4HBYA 3P1EA 4N4GA 4PCEA 3U5KA 2DVQA 5J0DA 5D3JA 5C8GA 4X2IA 4A9FA 5EVAA 4XUAA 4NR5A 4YAXA 4YY4A 1ZS5A 5EU1A 2E7NA 4O74A 5FG4A 4LYSA 4ZW1A 5BT4A 3RCWA 5DBMA 5AMEA 3UV5A 4HXLA 4TZ8A 5HELA 2RNXA 4KV4A 4NRCA 5FE9A 5LJ2A 5HQ5A 4HBXA 4UYFA 3DWYA 5DKHA 3I3JA 4QYLA 2D82A 5ENEA 4NR8A 4OGJA 4A9JA 4O76A 4CUUA 4O7AA 4UIWA 5CUAA 5EPBA 5I7YA 5CQ8A 4QR5A 5FG5A 4YATA 1F68A 5HLSA 5A5NA 5CTLA 3UV2A 4QC3A 4ZQLA 3U5JA 5C4QA 3U5MA 5L97A 5IGNA 3ZYUA 4IR6A 5F61A 5EWVA 4E96A 5EWDA 4UITA 4ZC9A 5DY7A 3O37A 4PTBA 4J0SA 5EGUA 5D3SA 4YADA 1EQFA 4UYDA 2MJVB 5F1HA 3SVHA 4BW2A 3O35A 5FH7A 5D3RA 4BW4A 3QZSA 5KO4A 4NRBA 4O7CA 2FSAA 3UVXA 4BHWA 5ENHA 5DYAA 2YW5A 4RVRA 5DW2A 5E74A 5FE8A 5TCMA 3MULA 5II2A 3MB4A 2RNYA 5FFYA 5D3HA 3LQHA 5CFWA 4AKNA 4A9NA 5ENJA 3MQMA 5EWCA 3HMFA 3NXBA 4TT2A 4A9LA 4YYDA 5EPSA 4NS5A 5HFQA 5CP5A 2LSPB 5FE2A 5IGLA 3QZVA 3LQJA 4NR9A 3U5NA 4O7EA 2YDWA 4CUTA 5KHMA 3O33A 5CS8A 5A81A 5A85A 5CUEA 5FE4A 4XUBA 5D3PA
chains in the Genus database with same CATH superfamily
5DLXA 5E0RA 5ENCA 4UIYA 5CUGA 4QC1A 2DVSA 3SVFA 5I40A 2R0VA 3FKMX 3Q2FA 4YBTA 5A7CA 5FE1A 4YABA 5H1VA 3P1CA 2DVVA 4MEOA 4IORA 3G0LA 4YH3A 4O7FA 3K2JA 4Q0NA 4IR4A 4TYLA 5II1A 4YYMA 5HRWA 5IGKA 3U5LA 4WHUA 5ETBA 4A9OA 4Z6IA 2E3KA 4YYIA 4YY6A 5EWHA 4TT6A 5FE7A 4QEWA 5A83A 5F60A 5FBXA 4HBWA 4YH4A 5I80A 5CUBA 4Z93A 4O70A 5JI8A 4A9HA 2RO1A 2RS9B 5TB6A 4YYKA 2I7KA 2D9EA 4QEUA 3U5OA 4Z1SA 5H1TA 3S92A 3VKHA 2NXBA 5C7NA 5E9LA 5L8UA 2WP2A 5G4RA 1WUMA 4IR5A 3Q2EA 4QB3A 2G4AA 5D3LA 4HXSA 4PY6A 3G0JA 4UYEA 4NQMA 4HBVA 4N3WA 4Z1QA 4UIXA 4CFLA 5AMFA 4IOOA 5EPRA 3AQAA 5ACYA 4Q0OA 5EISA 3ONIA 5HQ6A 2RNWA 5CQAA 2F6NA 4FLPA 4BJXA 5JWMA 5C87A 5LJ0A 5LVRA 2OSSA 4UYFB 4QZSA 4WIVA 4LZ2A 4C67A 3LXJA 4UIZA 4MR5A 1E6IA 3IU5A 5CQTA 5CRMA 4QR4A 4QEVA 5EWWA 3QZTA 4PKLA 5F3AA 4NYXA 5AD2A 5HFRA 5ETDA 3HMHA 4TU4A 4GPJA 5BT5A 1JM4B 4QR3A 5I1QA 4ALHA 4MR4A 4LZRA 5L98A 5CZGA 5EICA 5BT3A 2F6JA 4QSSA 5E9VA 5LJ1A 2H60A 1X0JA 5L96A 2R10A 5FH8A 4UYGA 5F63A 5FFWA 5D24A 5F62A 2YEKA 2YEMA 5I89A 3UVDA 2L5EA 3D7CA 5FDZA 3JVKA 5E9MA 5CPEA 5EM3A 4HXOA 4UIUA 5FB1A 4QBMA 3P1FA 4UIVA 4YC9A 5FE3A 3MXFA 5I7XA 4KV1A 5KTUA 5E3GA 5DKCA 5CQ7A 4XYAA 5IGMA 4LRGA 5I86A 5I88A 4QSUA 4YBSA 4J0RA 5D7XA 5F5ZA 4NUCA 5DYUA 4XY8A 4XY9A 4TQNA 3GG3A 4O75A 3D1DA 4NUEA 5A5OA 4J1PA 2YQDA 5FB0A 3P5OA 2YELA 4OGIA 4QSWA 4A9IA 4NXJA 2DATA 5KTWA 4PCIA 4KCXA 2I8NA 1N72A 5HRXA 3MUKA 4MENA 4A9KA 5DFCA 4IR3A 4YYNA 5E7DA 5FE6A 5CRZA 4HXRA 4NR4A 5CUCA 5F2PA 2RFJA 3UW9A 5I83A 4NR7A 5EQ1A 4CFKA 2E7OA 4WHWA 3D1BA 5DLZA 4CUPA 3U5PA 5LKUA 1WUGA 4LR6A 4LZSA 5HENA 4QNSA 4J3IA 5IG6A 5HJCA 5FH6A 5HCLA 4NYWA 2RI7A 3HMEA 5A82A 4CL9A 5F25A 4LYWA 5ENFA 5D25A 5KU3A 4O78A 4CURA 3SVGA 3S91A 5LUUA 4MR6A 2WP1A 4IOQA 5G4SA 5AD3A 2DKWA 5A5RA 5A5QA 5HRVA 5CUDA 4O71A 3TLPA 1PUOA 4MEPA 5CQ4A 4N4HA 5D3NA 4LYIA 5CY9A 4Z6HA 4QSPA 5CU8A 5D3TA 4A9EA 3UVWA 5C89A 4LC2A 4A9MA 4MEQA 3O36A 5FE0A 5E73A 5FE5A 5L8TA 3JVLA 5A5PA 5EV9A 5DW1A 5EI4A 5KTXA 5H1UA 4NRAA 5FFVA 4N4FA 4TTEA 2OO1A 2EJNA 3MB3A 5LVQA 4QUTA 5DYCA 3UVYA 4NUDA 4O7BA 4F3IA 5DX4A 5CQ3A 5E3DA 5DKDA 4HXNA 2L84A 4OUFA 5FG6A 3UV4A 3DAIA 4YYGA 3JVJA 1JSPB 5E9IA 5ENGA 3AADA 5LKTA 5D0CA 4N4IA 4AKGA 4CUSA 4QY4A 2GRCA 5EP7A 4BW3A 3VKGA 4HXPA 4QYDA 2N9GA 4YYHA 4NYVA 4QSXA 5CGPA 5IIDA 2OUOA 5H85A 5K29A 4TT4A 4DONA 4O72A 2DVRA 4NQNA 4QSTA 4YBMA 5IBNA 4BW1A 5DFDA 5F36A 5HM0A 5F1LA 4Y03A 5C85A 5LKXA 5E9YA 5E9KA 4AI6A 4O77A 4QSVA 3IU6A 4HXKA 4QSQA 2R0SA 5EK9A 4CLBA 4TZ2A 5A5SA 5LKZA 5EA1A 5D26A 4HXMA 4YYJA 4NR6A 1ZKRA 5COIA 4LDFA 4MR3A 5CQ6A 4QSRA 2L85A 4PS5A 4TU6A 5I29A 3P1DA 5HEMA 4CUQA 4ALGA 5DYXA 3LJWA 5CQ5A 5ENIA 3JVMA 4TS8A 5ENBA 5HQ7A 4YK0A 2KTBB 2R0YA 4QUUA 5L99A 4UYHA 2YYNA 3O34A 5DFBA 4C66A 3LQIA 2DWWA 4HBYA 3P1EA 4N4GA 4PCEA 3U5KA 2DVQA 5J0DA 5D3JA 5C8GA 4X2IA 4A9FA 5EVAA 4AKHA 4XUAA 4NR5A 4YAXA 4YY4A 1ZS5A 5EU1A 2E7NA 4O74A 5FG4A 4LYSA 4ZW1A 5BT4A 3RCWA 5DBMA 5AMEA 3UV5A 4HXLA 4TZ8A 5HELA 2RNXA 4KV4A 4NRCA 5FE9A 5LJ2A 5HQ5A 4HBXA 4UYFA 3DWYA 5DKHA 3I3JA 4QYLA 2D82A 5ENEA 4NR8A 4OGJA 4A9JA 4O76A 4CUUA 4O7AA 4UIWA 5CUAA 5EPBA 5I7YA 5CQ8A 4QR5A 5FG5A 4YATA 1F68A 5HLSA 5A5NA 5CTLA 3UV2A 4QC3A 4ZQLA 3U5JA 3ERRA 5C4QA 3U5MA 5L97A 5IGNA 3ZYUA 4IR6A 5F61A 5EWVA 4E96A 5EWDA 4UITA 4ZC9A 5DY7A 3O37A 4PTBA 4J0SA 5EGUA 5D3SA 4YADA 1EQFA 4UYDA 2MJVB 5F1HA 3SVHA 4BW2A 3O35A 5FH7A 5D3RA 4BW4A 3QZSA 5KO4A 4NRBA 4O7CA 2FSAA 3UVXA 4BHWA 5ENHA 5DYAA 2YW5A 4RVRA 5DW2A 5E74A 5FE8A 5TCMA 3MULA 5II2A 3MB4A 2RNYA 5FFYA 5D3HA 3LQHA 5CFWA 4AKNA 4A9NA 5ENJA 3MQMA 5EWCA 3HMFA 3NXBA 4TT2A 4A9LA 4YYDA 5EPSA 4NS5A 5HFQA 5CP5A 2LSPB 5FE2A 5IGLA 3QZVA 3LQJA 4NR9A 3U5NA 4O7EA 2YDWA 4CUTA 4AKIA 5KHMA 3O33A 5CS8A 5A81A 5A85A 5CUEA 5FE4A 4XUBA 5D3PA
chains in the Genus database with same CATH topology
5DLXA 5E0RA 5ENCA 4UIYA 5CUGA 4QC1A 2DVSA 3SVFA 5I40A 2R0VA 3FKMX 3Q2FA 4YBTA 5A7CA 5FE1A 4YABA 5H1VA 3P1CA 2DVVA 4MEOA 4IORA 3G0LA 4YH3A 4O7FA 3K2JA 4Q0NA 4IR4A 4TYLA 5II1A 4YYMA 5HRWA 5IGKA 3U5LA 4WHUA 5ETBA 4A9OA 4Z6IA 2E3KA 4YYIA 4YY6A 5EWHA 4TT6A 5FE7A 4QEWA 5A83A 5F60A 5FBXA 4HBWA 4YH4A 5I80A 5CUBA 4Z93A 4O70A 5JI8A 4A9HA 2RO1A 2RS9B 5TB6A 4YYKA 2I7KA 2D9EA 4QEUA 3U5OA 4Z1SA 5H1TA 3S92A 2NXBA 5C7NA 5E9LA 5L8UA 2WP2A 5G4RA 1WUMA 4IR5A 3Q2EA 4QB3A 2G4AA 5D3LA 4HXSA 4PY6A 3G0JA 4UYEA 4NQMA 4HBVA 4N3WA 4Z1QA 4UIXA 4CFLA 5AMFA 4IOOA 5EPRA 3AQAA 5ACYA 4Q0OA 5EISA 3ONIA 5HQ6A 2RNWA 5CQAA 2F6NA 4FLPA 4BJXA 5JWMA 5C87A 5LJ0A 5LVRA 2OSSA 4UYFB 4QZSA 4WIVA 4LZ2A 4C67A 3LXJA 4UIZA 4MR5A 1E6IA 3IU5A 5CQTA 5CRMA 4QR4A 4QEVA 5EWWA 3QZTA 4PKLA 5F3AA 4NYXA 5AD2A 5HFRA 5ETDA 3HMHA 4TU4A 4GPJA 5BT5A 1JM4B 4QR3A 5I1QA 4ALHA 4MR4A 4LZRA 5L98A 5CZGA 5EICA 5BT3A 2F6JA 4QSSA 5E9VA 5LJ1A 2H60A 1X0JA 5L96A 2R10A 5FH8A 4UYGA 5F63A 5FFWA 5D24A 5F62A 2YEKA 2YEMA 5I89A 3UVDA 2L5EA 3D7CA 5FDZA 3JVKA 5E9MA 5CPEA 5EM3A 4HXOA 4UIUA 5FB1A 4QBMA 3P1FA 4UIVA 4YC9A 5FE3A 3MXFA 5I7XA 4KV1A 5KTUA 5E3GA 5DKCA 5CQ7A 4XYAA 5IGMA 4LRGA 5I86A 5I88A 4QSUA 4YBSA 4J0RA 5D7XA 5F5ZA 4NUCA 5DYUA 4XY8A 4XY9A 4TQNA 3GG3A 4O75A 4NUEA 5A5OA 4J1PA 2YQDA 5FB0A 3P5OA 2YELA 4OGIA 4QSWA 4A9IA 4NXJA 2DATA 5KTWA 4PCIA 4KCXA 2I8NA 1N72A 5HRXA 3MUKA 4MENA 4A9KA 5DFCA 4IR3A 4YYNA 5E7DA 5FE6A 5CRZA 4HXRA 4NR4A 5CUCA 5F2PA 2RFJA 3UW9A 5I83A 4NR7A 5EQ1A 4CFKA 2E7OA 4WHWA 4CUPA 5DLZA 3U5PA 5LKUA 1WUGA 4LR6A 4LZSA 5HENA 4QNSA 4J3IA 5IG6A 5HJCA 5FH6A 5HCLA 4NYWA 2RI7A 3HMEA 5A82A 4CL9A 5F25A 4LYWA 5ENFA 5D25A 5KU3A 4O78A 4CURA 3SVGA 3S91A 5LUUA 4MR6A 2WP1A 4IOQA 5G4SA 5AD3A 2DKWA 5A5RA 5A5QA 5HRVA 5CUDA 4O71A 3TLPA 4MEPA 5CQ4A 4N4HA 5D3NA 4LYIA 5CY9A 4Z6HA 4QSPA 5CU8A 5D3TA 4A9EA 3UVWA 5C89A 4LC2A 4A9MA 4MEQA 3O36A 5FE0A 5E73A 5FE5A 5L8TA 3JVLA 5A5PA 5EV9A 5DW1A 5EI4A 5KTXA 5H1UA 4NRAA 5FFVA 4N4FA 4TTEA 2OO1A 3MB3A 5LVQA 4QUTA 5DYCA 3UVYA 4NUDA 4O7BA 4F3IA 5DX4A 5CQ3A 5E3DA 5DKDA 4HXNA 2L84A 4OUFA 5FG6A 3UV4A 3DAIA 4YYGA 3JVJA 1JSPB 5E9IA 5ENGA 3AADA 5LKTA 5D0CA 4N4IA 4CUSA 4QY4A 2GRCA 5EP7A 4BW3A 4HXPA 4QYDA 2N9GA 4YYHA 4NYVA 4QSXA 5CGPA 5IIDA 2OUOA 5H85A 5K29A 4TT4A 4DONA 4O72A 2DVRA 4NQNA 4QSTA 4YBMA 5IBNA 4BW1A 5DFDA 5F36A 5HM0A 5F1LA 4Y03A 5C85A 5LKXA 5E9YA 5E9KA 4O77A 4QSVA 3IU6A 4HXKA 4QSQA 2R0SA 5EK9A 4CLBA 4TZ2A 5A5SA 5LKZA 5EA1A 5D26A 4HXMA 4YYJA 4NR6A 5COIA 4LDFA 4MR3A 5CQ6A 4QSRA 2L85A 4PS5A 4TU6A 5I29A 3P1DA 5HEMA 4CUQA 4ALGA 5DYXA 3LJWA 5CQ5A 5ENIA 3JVMA 4TS8A 5ENBA 5HQ7A 4YK0A 2KTBB 2R0YA 4QUUA 5L99A 4UYHA 2YYNA 3O34A 5DFBA 4C66A 3LQIA 2DWWA 4HBYA 3P1EA 4N4GA 4PCEA 3U5KA 2DVQA 5J0DA 5D3JA 5C8GA 4X2IA 4A9FA 5EVAA 4XUAA 4NR5A 4YAXA 4YY4A 1ZS5A 5EU1A 2E7NA 4O74A 5FG4A 4LYSA 4ZW1A 5BT4A 3RCWA 5DBMA 5AMEA 3UV5A 4HXLA 4TZ8A 5HELA 2RNXA 4KV4A 4NRCA 5FE9A 5LJ2A 5HQ5A 4HBXA 4UYFA 3DWYA 5DKHA 3I3JA 4QYLA 2D82A 5ENEA 4NR8A 4OGJA 4A9JA 4O76A 4CUUA 4O7AA 4UIWA 5CUAA 5EPBA 5I7YA 5CQ8A 4QR5A 5FG5A 4YATA 1F68A 5HLSA 5A5NA 5CTLA 3UV2A 4QC3A 4ZQLA 3U5JA 5C4QA 3U5MA 5L97A 5IGNA 3ZYUA 4IR6A 5F61A 5EWVA 4E96A 5EWDA 4UITA 4ZC9A 5DY7A 3O37A 4PTBA 4J0SA 5EGUA 5D3SA 4YADA 1EQFA 4UYDA 2MJVB 5F1HA 3SVHA 4BW2A 3O35A 5FH7A 5D3RA 4BW4A 3QZSA 5KO4A 4NRBA 4O7CA 2FSAA 3UVXA 4BHWA 5ENHA 5DYAA 2YW5A 4RVRA 5DW2A 5E74A 5FE8A 5TCMA 3MULA 5II2A 3MB4A 2RNYA 5FFYA 5D3HA 3LQHA 5CFWA 4AKNA 4A9NA 5ENJA 3MQMA 5EWCA 3HMFA 3NXBA 4TT2A 4A9LA 4YYDA 5EPSA 4NS5A 5HFQA 5CP5A 2LSPB 5FE2A 5IGLA 3QZVA 3LQJA 4NR9A 3U5NA 4O7EA 2YDWA 4CUTA 5KHMA 3O33A 5CS8A 5A81A 5A85A 5CUEA 5FE4A 4XUBA 5D3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DLX A;  5E0R A;  5ENC A;  4UIY A;  5CUG A;  4QC1 A;  2DVS A;  3SVF A;  5I40 A;  2R0V A;  3FKM X;  3Q2F A;  4YBT A;  5A7C A;  5FE1 A;  4YAB A;  5H1V A;  3P1C A;  2DVV A;  4MEO A;  4IOR A;  3G0L A;  4YH3 A;  4O7F A;  3K2J A;  4Q0N A;  4IR4 A;  4TYL A;  5II1 A;  4YYM A;  5HRW A;  5IGK A;  3U5L A;  4WHU A;  5ETB A;  4A9O A;  4Z6I A;  2E3K A;  4YYI A;  4YY6 A;  5EWH A;  4TT6 A;  5FE7 A;  4QEW A;  5A83 A;  5F60 A;  5FBX A;  4HBW A;  4YH4 A;  5I80 A;  5CUB A;  4Z93 A;  4O70 A;  5JI8 A;  4A9H A;  2RO1 A;  2RS9 B;  5TB6 A;  4YYK A;  2I7K A;  2D9E A;  4QEU A;  3U5O A;  4Z1S A;  5H1T A;  3S92 A;  2NXB A;  5C7N A;  5E9L A;  5L8U A;  2WP2 A;  5G4R A;  1WUM A;  4IR5 A;  3Q2E A;  4QB3 A;  2G4A A;  5D3L A;  4HXS A;  4PY6 A;  3G0J A;  4UYE A;  4NQM A;  4HBV A;  4N3W A;  4Z1Q A;  4UIX A;  4CFL A;  5AMF A;  4IOO A;  5EPR A;  3AQA A;  5ACY A;  4Q0O A;  5EIS A;  3ONI A;  5HQ6 A;  2RNW A;  5CQA A;  2F6N A;  4FLP A;  4BJX A;  5JWM A;  5C87 A;  5LJ0 A;  5LVR A;  2OSS A;  4UYF B;  4QZS A;  4WIV A;  4LZ2 A;  4C67 A;  3LXJ A;  4UIZ A;  4MR5 A;  1E6I A;  3IU5 A;  5CQT A;  5CRM A;  4QR4 A;  4QEV A;  5EWW A;  3QZT A;  4PKL A;  5F3A A;  4NYX A;  5AD2 A;  5HFR A;  5ETD A;  3HMH A;  4TU4 A;  4GPJ A;  5BT5 A;  1JM4 B;  4QR3 A;  5I1Q A;  4ALH A;  4MR4 A;  4LZR A;  5L98 A;  5CZG A;  5EIC A;  5BT3 A;  2F6J A;  4QSS A;  5E9V A;  5LJ1 A;  2H60 A;  1X0J A;  5L96 A;  2R10 A;  5FH8 A;  4UYG A;  5F63 A;  5FFW A;  5D24 A;  5F62 A;  2YEK A;  2YEM A;  5I89 A;  3UVD A;  2L5E A;  3D7C A;  5FDZ A;  3JVK A;  5E9M A;  5CPE A;  5EM3 A;  4HXO A;  4UIU A;  5FB1 A;  4QBM A;  3P1F A;  4UIV A;  4YC9 A;  5FE3 A;  3MXF A;  5I7X A;  4KV1 A;  5KTU A;  5E3G A;  5DKC A;  5CQ7 A;  4XYA A;  5IGM A;  4LRG A;  5I86 A;  5I88 A;  4QSU A;  4YBS A;  4J0R A;  5D7X A;  5F5Z A;  4NUC A;  5DYU A;  4XY8 A;  4XY9 A;  4TQN A;  3GG3 A;  4O75 A;  4NUE A;  5A5O A;  4J1P A;  2YQD A;  5FB0 A;  3P5O A;  2YEL A;  4OGI A;  4QSW A;  4A9I A;  4NXJ A;  2DAT A;  5KTW A;  4PCI A;  4KCX A;  2I8N A;  1N72 A;  5HRX A;  3MUK A;  4MEN A;  4A9K A;  5DFC A;  4IR3 A;  4YYN A;  5E7D A;  5FE6 A;  5CRZ A;  4HXR A;  4NR4 A;  5CUC A;  5F2P A;  2RFJ A;  3UW9 A;  5I83 A;  4NR7 A;  5EQ1 A;  4CFK A;  2E7O A;  4WHW A;  4CUP A;  5DLZ A;  3U5P A;  5LKU A;  1WUG A;  4LR6 A;  4LZS A;  5HEN A;  4QNS A;  4J3I A;  5IG6 A;  5HJC A;  5FH6 A;  5HCL A;  4NYW A;  2RI7 A;  3HME A;  5A82 A;  4CL9 A;  5F25 A;  4LYW A;  5ENF A;  5D25 A;  5KU3 A;  4O78 A;  4CUR A;  3SVG A;  3S91 A;  5LUU A;  4MR6 A;  2WP1 A;  4IOQ A;  5G4S A;  5AD3 A;  2DKW A;  5A5R A;  5A5Q A;  5HRV A;  5CUD A;  4O71 A;  3TLP A;  4MEP A;  5CQ4 A;  4N4H A;  5D3N A;  4LYI A;  5CY9 A;  4Z6H A;  4QSP A;  5CU8 A;  5D3T A;  4A9E A;  3UVW A;  5C89 A;  4LC2 A;  4A9M A;  4MEQ A;  3O36 A;  5FE0 A;  5E73 A;  5FE5 A;  5L8T A;  3JVL A;  5A5P A;  5EV9 A;  5DW1 A;  5EI4 A;  5KTX A;  5H1U A;  4NRA A;  5FFV A;  4N4F A;  4TTE A;  2OO1 A;  3MB3 A;  5LVQ A;  4QUT A;  5DYC A;  3UVY A;  4NUD A;  4O7B A;  4F3I A;  5DX4 A;  5CQ3 A;  5E3D A;  5DKD A;  4HXN A;  2L84 A;  4OUF A;  5FG6 A;  3UV4 A;  3DAI A;  4YYG A;  3JVJ A;  1JSP B;  5E9I A;  5ENG A;  3AAD A;  5LKT A;  5D0C A;  4N4I A;  4CUS A;  4QY4 A;  2GRC A;  5EP7 A;  4BW3 A;  4HXP A;  4QYD A;  2N9G A;  4YYH A;  4NYV A;  4QSX A;  5CGP A;  5IID A;  2OUO A;  5H85 A;  5K29 A;  4TT4 A;  4DON A;  4O72 A;  2DVR A;  4NQN A;  4QST A;  4YBM A;  5IBN A;  4BW1 A;  5DFD A;  5F36 A;  5HM0 A;  5F1L A;  4Y03 A;  5C85 A;  5LKX A;  5E9Y A;  5E9K A;  4O77 A;  4QSV A;  3IU6 A;  4HXK A;  4QSQ A;  2R0S A;  5EK9 A;  4CLB A;  4TZ2 A;  5A5S A;  5LKZ A;  5EA1 A;  5D26 A;  4HXM A;  4YYJ A;  4NR6 A;  5COI A;  4LDF A;  4MR3 A;  5CQ6 A;  4QSR A;  2L85 A;  4PS5 A;  4TU6 A;  5I29 A;  3P1D A;  5HEM A;  4CUQ A;  4ALG A;  5DYX A;  3LJW A;  5CQ5 A;  5ENI A;  3JVM A;  4TS8 A;  5ENB A;  5HQ7 A;  4YK0 A;  2KTB B;  2R0Y A;  4QUU A;  5L99 A;  4UYH A;  2YYN A;  3O34 A;  5DFB A;  4C66 A;  3LQI A;  2DWW A;  4HBY A;  3P1E A;  4N4G A;  4PCE A;  3U5K A;  2DVQ A;  5J0D A;  5D3J A;  5C8G A;  4X2I A;  4A9F A;  5EVA A;  4XUA A;  4NR5 A;  4YAX A;  4YY4 A;  1ZS5 A;  5EU1 A;  2E7N A;  4O74 A;  5FG4 A;  4LYS A;  4ZW1 A;  5BT4 A;  3RCW A;  5DBM A;  5AME A;  3UV5 A;  4HXL A;  4TZ8 A;  5HEL A;  2RNX A;  4KV4 A;  4NRC A;  5FE9 A;  5LJ2 A;  5HQ5 A;  4HBX A;  4UYF A;  3DWY A;  5DKH A;  3I3J A;  4QYL A;  2D82 A;  5ENE A;  4NR8 A;  4OGJ A;  4A9J A;  4O76 A;  4CUU A;  4O7A A;  4UIW A;  5CUA A;  5EPB A;  5I7Y A;  5CQ8 A;  4QR5 A;  5FG5 A;  4YAT A;  1F68 A;  5HLS A;  5A5N A;  5CTL A;  3UV2 A;  4QC3 A;  4ZQL A;  3U5J A;  5C4Q A;  3U5M A;  5L97 A;  5IGN A;  3ZYU A;  4IR6 A;  5F61 A;  5EWV A;  4E96 A;  5EWD A;  4UIT A;  4ZC9 A;  5DY7 A;  3O37 A;  4PTB A;  4J0S A;  5EGU A;  5D3S A;  4YAD A;  1EQF A;  4UYD A;  2MJV B;  5F1H A;  3SVH A;  4BW2 A;  3O35 A;  5FH7 A;  5D3R A;  4BW4 A;  3QZS A;  5KO4 A;  4NRB A;  4O7C A;  2FSA A;  3UVX A;  4BHW A;  5ENH A;  5DYA A;  2YW5 A;  4RVR A;  5DW2 A;  5E74 A;  5FE8 A;  5TCM A;  3MUL A;  5II2 A;  3MB4 A;  2RNY A;  5FFY A;  5D3H A;  3LQH A;  5CFW A;  4AKN A;  4A9N A;  5ENJ A;  3MQM A;  5EWC A;  3HMF A;  3NXB A;  4TT2 A;  4A9L A;  4YYD A;  5EPS A;  4NS5 A;  5HFQ A;  5CP5 A;  2LSP B;  5FE2 A;  5IGL A;  3QZV A;  3LQJ A;  4NR9 A;  3U5N A;  4O7E A;  2YDW A;  4CUT A;  5KHM A;  3O33 A;  5CS8 A;  5A81 A;  5A85 A;  5CUE A;  5FE4 A;  4XUB A;  5D3P A; 
#chains in the Genus database with same CATH topology
 5DLX A;  5E0R A;  5ENC A;  4UIY A;  5CUG A;  4QC1 A;  2DVS A;  3SVF A;  5I40 A;  2R0V A;  3FKM X;  3Q2F A;  4YBT A;  5A7C A;  5FE1 A;  4YAB A;  5H1V A;  3P1C A;  2DVV A;  4MEO A;  4IOR A;  3G0L A;  4YH3 A;  4O7F A;  3K2J A;  4Q0N A;  4IR4 A;  4TYL A;  5II1 A;  4YYM A;  5HRW A;  5IGK A;  3U5L A;  4WHU A;  5ETB A;  4A9O A;  4Z6I A;  2E3K A;  4YYI A;  4YY6 A;  5EWH A;  4TT6 A;  5FE7 A;  4QEW A;  5A83 A;  5F60 A;  5FBX A;  4HBW A;  4YH4 A;  5I80 A;  5CUB A;  4Z93 A;  4O70 A;  5JI8 A;  4A9H A;  2RO1 A;  2RS9 B;  5TB6 A;  4YYK A;  2I7K A;  2D9E A;  4QEU A;  3U5O A;  4Z1S A;  5H1T A;  3S92 A;  3VKH A;  2NXB A;  5C7N A;  5E9L A;  5L8U A;  2WP2 A;  5G4R A;  1WUM A;  4IR5 A;  3Q2E A;  4QB3 A;  2G4A A;  5D3L A;  4HXS A;  4PY6 A;  3G0J A;  4UYE A;  4NQM A;  4HBV A;  4N3W A;  4Z1Q A;  4UIX A;  4CFL A;  5AMF A;  4IOO A;  5EPR A;  3AQA A;  5ACY A;  4Q0O A;  5EIS A;  3ONI A;  5HQ6 A;  2RNW A;  5CQA A;  2F6N A;  4FLP A;  4BJX A;  5JWM A;  5C87 A;  5LJ0 A;  5LVR A;  2OSS A;  4UYF B;  4QZS A;  4WIV A;  4LZ2 A;  4C67 A;  3LXJ A;  4UIZ A;  4MR5 A;  1E6I A;  3IU5 A;  5CQT A;  5CRM A;  4QR4 A;  4QEV A;  5EWW A;  3QZT A;  4PKL A;  5F3A A;  4NYX A;  5AD2 A;  5HFR A;  5ETD A;  3HMH A;  4TU4 A;  4GPJ A;  5BT5 A;  1JM4 B;  4QR3 A;  5I1Q A;  4ALH A;  4MR4 A;  4LZR A;  5L98 A;  5CZG A;  5EIC A;  5BT3 A;  2F6J A;  4QSS A;  5E9V A;  5LJ1 A;  2H60 A;  1X0J A;  5L96 A;  2R10 A;  5FH8 A;  4UYG A;  5F63 A;  5FFW A;  5D24 A;  5F62 A;  2YEK A;  2YEM A;  5I89 A;  3UVD A;  2L5E A;  3D7C A;  5FDZ A;  3JVK A;  5E9M A;  5CPE A;  5EM3 A;  4HXO A;  4UIU A;  5FB1 A;  4QBM A;  3P1F A;  4UIV A;  4YC9 A;  5FE3 A;  3MXF A;  5I7X A;  4KV1 A;  5KTU A;  5E3G A;  5DKC A;  5CQ7 A;  4XYA A;  5IGM A;  4LRG A;  5I86 A;  5I88 A;  4QSU A;  4YBS A;  4J0R A;  5D7X A;  5F5Z A;  4NUC A;  5DYU A;  4XY8 A;  4XY9 A;  4TQN A;  3GG3 A;  4O75 A;  3D1D A;  4NUE A;  5A5O A;  4J1P A;  2YQD A;  5FB0 A;  3P5O A;  2YEL A;  4OGI A;  4QSW A;  4A9I A;  4NXJ A;  2DAT A;  5KTW A;  4PCI A;  4KCX A;  2I8N A;  1N72 A;  5HRX A;  3MUK A;  4MEN A;  4A9K A;  5DFC A;  4IR3 A;  4YYN A;  5E7D A;  5FE6 A;  5CRZ A;  4HXR A;  4NR4 A;  5CUC A;  5F2P A;  2RFJ A;  3UW9 A;  5I83 A;  4NR7 A;  5EQ1 A;  4CFK A;  2E7O A;  4WHW A;  3D1B A;  5DLZ A;  4CUP A;  3U5P A;  5LKU A;  1WUG A;  4LR6 A;  4LZS A;  5HEN A;  4QNS A;  4J3I A;  5IG6 A;  5HJC A;  5FH6 A;  5HCL A;  4NYW A;  2RI7 A;  3HME A;  5A82 A;  4CL9 A;  5F25 A;  4LYW A;  5ENF A;  5D25 A;  5KU3 A;  4O78 A;  4CUR A;  3SVG A;  3S91 A;  5LUU A;  4MR6 A;  2WP1 A;  4IOQ A;  5G4S A;  5AD3 A;  2DKW A;  5A5R A;  5A5Q A;  5HRV A;  5CUD A;  4O71 A;  3TLP A;  1PUO A;  4MEP A;  5CQ4 A;  4N4H A;  5D3N A;  4LYI A;  5CY9 A;  4Z6H A;  4QSP A;  5CU8 A;  5D3T A;  4A9E A;  3UVW A;  5C89 A;  4LC2 A;  4A9M A;  4MEQ A;  3O36 A;  5FE0 A;  5E73 A;  5FE5 A;  5L8T A;  3JVL A;  5A5P A;  5EV9 A;  5DW1 A;  5EI4 A;  5KTX A;  5H1U A;  4NRA A;  5FFV A;  4N4F A;  4TTE A;  2OO1 A;  2EJN A;  3MB3 A;  5LVQ A;  4QUT A;  5DYC A;  3UVY A;  4NUD A;  4O7B A;  4F3I A;  5DX4 A;  5CQ3 A;  5E3D A;  5DKD A;  4HXN A;  2L84 A;  4OUF A;  5FG6 A;  3UV4 A;  3DAI A;  4YYG A;  3JVJ A;  1JSP B;  5E9I A;  5ENG A;  3AAD A;  5LKT A;  5D0C A;  4N4I A;  4AKG A;  4CUS A;  4QY4 A;  2GRC A;  5EP7 A;  4BW3 A;  3VKG A;  4HXP A;  4QYD A;  2N9G A;  4YYH A;  4NYV A;  4QSX A;  5CGP A;  5IID A;  2OUO A;  5H85 A;  5K29 A;  4TT4 A;  4DON A;  4O72 A;  2DVR A;  4NQN A;  4QST A;  4YBM A;  5IBN A;  4BW1 A;  5DFD A;  5F36 A;  5HM0 A;  5F1L A;  4Y03 A;  5C85 A;  5LKX A;  5E9Y A;  5E9K A;  4AI6 A;  4O77 A;  4QSV A;  3IU6 A;  4HXK A;  4QSQ A;  2R0S A;  5EK9 A;  4CLB A;  4TZ2 A;  5A5S A;  5LKZ A;  5EA1 A;  5D26 A;  4HXM A;  4YYJ A;  4NR6 A;  1ZKR A;  5COI A;  4LDF A;  4MR3 A;  5CQ6 A;  4QSR A;  2L85 A;  4PS5 A;  4TU6 A;  5I29 A;  3P1D A;  5HEM A;  4CUQ A;  4ALG A;  5DYX A;  3LJW A;  5CQ5 A;  5ENI A;  3JVM A;  4TS8 A;  5ENB A;  5HQ7 A;  4YK0 A;  2KTB B;  2R0Y A;  4QUU A;  5L99 A;  4UYH A;  2YYN A;  3O34 A;  5DFB A;  4C66 A;  3LQI A;  2DWW A;  4HBY A;  3P1E A;  4N4G A;  4PCE A;  3U5K A;  2DVQ A;  5J0D A;  5D3J A;  5C8G A;  4X2I A;  4A9F A;  5EVA A;  4AKH A;  4XUA A;  4NR5 A;  4YAX A;  4YY4 A;  1ZS5 A;  5EU1 A;  2E7N A;  4O74 A;  5FG4 A;  4LYS A;  4ZW1 A;  5BT4 A;  3RCW A;  5DBM A;  5AME A;  3UV5 A;  4HXL A;  4TZ8 A;  5HEL A;  2RNX A;  4KV4 A;  4NRC A;  5FE9 A;  5LJ2 A;  5HQ5 A;  4HBX A;  4UYF A;  3DWY A;  5DKH A;  3I3J A;  4QYL A;  2D82 A;  5ENE A;  4NR8 A;  4OGJ A;  4A9J A;  4O76 A;  4CUU A;  4O7A A;  4UIW A;  5CUA A;  5EPB A;  5I7Y A;  5CQ8 A;  4QR5 A;  5FG5 A;  4YAT A;  1F68 A;  5HLS A;  5A5N A;  5CTL A;  3UV2 A;  4QC3 A;  4ZQL A;  3U5J A;  3ERR A;  5C4Q A;  3U5M A;  5L97 A;  5IGN A;  3ZYU A;  4IR6 A;  5F61 A;  5EWV A;  4E96 A;  5EWD A;  4UIT A;  4ZC9 A;  5DY7 A;  3O37 A;  4PTB A;  4J0S A;  5EGU A;  5D3S A;  4YAD A;  1EQF A;  4UYD A;  2MJV B;  5F1H A;  3SVH A;  4BW2 A;  3O35 A;  5FH7 A;  5D3R A;  4BW4 A;  3QZS A;  5KO4 A;  4NRB A;  4O7C A;  2FSA A;  3UVX A;  4BHW A;  5ENH A;  5DYA A;  2YW5 A;  4RVR A;  5DW2 A;  5E74 A;  5FE8 A;  5TCM A;  3MUL A;  5II2 A;  3MB4 A;  2RNY A;  5FFY A;  5D3H A;  3LQH A;  5CFW A;  4AKN A;  4A9N A;  5ENJ A;  3MQM A;  5EWC A;  3HMF A;  3NXB A;  4TT2 A;  4A9L A;  4YYD A;  5EPS A;  4NS5 A;  5HFQ A;  5CP5 A;  2LSP B;  5FE2 A;  5IGL A;  3QZV A;  3LQJ A;  4NR9 A;  3U5N A;  4O7E A;  2YDW A;  4CUT A;  4AKI A;  5KHM A;  3O33 A;  5CS8 A;  5A81 A;  5A85 A;  5CUE A;  5FE4 A;  4XUB A;  5D3P A; 
#chains in the Genus database with same CATH homology
 5DLX A;  5E0R A;  5ENC A;  4UIY A;  5CUG A;  4QC1 A;  2DVS A;  3SVF A;  5I40 A;  2R0V A;  3FKM X;  3Q2F A;  4YBT A;  5A7C A;  5FE1 A;  4YAB A;  5H1V A;  3P1C A;  2DVV A;  4MEO A;  4IOR A;  3G0L A;  4YH3 A;  4O7F A;  3K2J A;  4Q0N A;  4IR4 A;  4TYL A;  5II1 A;  4YYM A;  5HRW A;  5IGK A;  3U5L A;  4WHU A;  5ETB A;  4A9O A;  4Z6I A;  2E3K A;  4YYI A;  4YY6 A;  5EWH A;  4TT6 A;  5FE7 A;  4QEW A;  5A83 A;  5F60 A;  5FBX A;  4HBW A;  4YH4 A;  5I80 A;  5CUB A;  4Z93 A;  4O70 A;  5JI8 A;  4A9H A;  2RO1 A;  2RS9 B;  5TB6 A;  4YYK A;  2I7K A;  2D9E A;  4QEU A;  3U5O A;  4Z1S A;  5H1T A;  3S92 A;  2NXB A;  5C7N A;  5E9L A;  5L8U A;  2WP2 A;  5G4R A;  1WUM A;  4IR5 A;  3Q2E A;  4QB3 A;  2G4A A;  5D3L A;  4HXS A;  4PY6 A;  3G0J A;  4UYE A;  4NQM A;  4HBV A;  4N3W A;  4Z1Q A;  4UIX A;  4CFL A;  5AMF A;  4IOO A;  5EPR A;  3AQA A;  5ACY A;  4Q0O A;  5EIS A;  3ONI A;  5HQ6 A;  2RNW A;  5CQA A;  2F6N A;  4FLP A;  4BJX A;  5JWM A;  5C87 A;  5LJ0 A;  5LVR A;  2OSS A;  4UYF B;  4QZS A;  4WIV A;  4LZ2 A;  4C67 A;  3LXJ A;  4UIZ A;  4MR5 A;  1E6I A;  3IU5 A;  5CQT A;  5CRM A;  4QR4 A;  4QEV A;  5EWW A;  3QZT A;  4PKL A;  5F3A A;  4NYX A;  5AD2 A;  5HFR A;  5ETD A;  3HMH A;  4TU4 A;  4GPJ A;  5BT5 A;  1JM4 B;  4QR3 A;  5I1Q A;  4ALH A;  4MR4 A;  4LZR A;  5L98 A;  5CZG A;  5EIC A;  5BT3 A;  2F6J A;  4QSS A;  5E9V A;  5LJ1 A;  2H60 A;  1X0J A;  5L96 A;  2R10 A;  5FH8 A;  4UYG A;  5F63 A;  5FFW A;  5D24 A;  5F62 A;  2YEK A;  2YEM A;  5I89 A;  3UVD A;  2L5E A;  3D7C A;  5FDZ A;  3JVK A;  5E9M A;  5CPE A;  5EM3 A;  4HXO A;  4UIU A;  5FB1 A;  4QBM A;  3P1F A;  4UIV A;  4YC9 A;  5FE3 A;  3MXF A;  5I7X A;  4KV1 A;  5KTU A;  5E3G A;  5DKC A;  5CQ7 A;  4XYA A;  5IGM A;  4LRG A;  5I86 A;  5I88 A;  4QSU A;  4YBS A;  4J0R A;  5D7X A;  5F5Z A;  4NUC A;  5DYU A;  4XY8 A;  4XY9 A;  4TQN A;  3GG3 A;  4O75 A;  4NUE A;  5A5O A;  4J1P A;  2YQD A;  5FB0 A;  3P5O A;  2YEL A;  4OGI A;  4QSW A;  4A9I A;  4NXJ A;  2DAT A;  5KTW A;  4PCI A;  4KCX A;  2I8N A;  1N72 A;  5HRX A;  3MUK A;  4MEN A;  4A9K A;  5DFC A;  4IR3 A;  4YYN A;  5E7D A;  5FE6 A;  5CRZ A;  4HXR A;  4NR4 A;  5CUC A;  5F2P A;  2RFJ A;  3UW9 A;  5I83 A;  4NR7 A;  5EQ1 A;  4CFK A;  2E7O A;  4WHW A;  4CUP A;  5DLZ A;  3U5P A;  5LKU A;  1WUG A;  4LR6 A;  4LZS A;  5HEN A;  4QNS A;  4J3I A;  5IG6 A;  5HJC A;  5FH6 A;  5HCL A;  4NYW A;  2RI7 A;  3HME A;  5A82 A;  4CL9 A;  5F25 A;  4LYW A;  5ENF A;  5D25 A;  5KU3 A;  4O78 A;  4CUR A;  3SVG A;  3S91 A;  5LUU A;  4MR6 A;  2WP1 A;  4IOQ A;  5G4S A;  5AD3 A;  2DKW A;  5A5R A;  5A5Q A;  5HRV A;  5CUD A;  4O71 A;  3TLP A;  4MEP A;  5CQ4 A;  4N4H A;  5D3N A;  4LYI A;  5CY9 A;  4Z6H A;  4QSP A;  5CU8 A;  5D3T A;  4A9E A;  3UVW A;  5C89 A;  4LC2 A;  4A9M A;  4MEQ A;  3O36 A;  5FE0 A;  5E73 A;  5FE5 A;  5L8T A;  3JVL A;  5A5P A;  5EV9 A;  5DW1 A;  5EI4 A;  5KTX A;  5H1U A;  4NRA A;  5FFV A;  4N4F A;  4TTE A;  2OO1 A;  3MB3 A;  5LVQ A;  4QUT A;  5DYC A;  3UVY A;  4NUD A;  4O7B A;  4F3I A;  5DX4 A;  5CQ3 A;  5E3D A;  5DKD A;  4HXN A;  2L84 A;  4OUF A;  5FG6 A;  3UV4 A;  3DAI A;  4YYG A;  3JVJ A;  1JSP B;  5E9I A;  5ENG A;  3AAD A;  5LKT A;  5D0C A;  4N4I A;  4CUS A;  4QY4 A;  2GRC A;  5EP7 A;  4BW3 A;  4HXP A;  4QYD A;  2N9G A;  4YYH A;  4NYV A;  4QSX A;  5CGP A;  5IID A;  2OUO A;  5H85 A;  5K29 A;  4TT4 A;  4DON A;  4O72 A;  2DVR A;  4NQN A;  4QST A;  4YBM A;  5IBN A;  4BW1 A;  5DFD A;  5F36 A;  5HM0 A;  5F1L A;  4Y03 A;  5C85 A;  5LKX A;  5E9Y A;  5E9K A;  4O77 A;  4QSV A;  3IU6 A;  4HXK A;  4QSQ A;  2R0S A;  5EK9 A;  4CLB A;  4TZ2 A;  5A5S A;  5LKZ A;  5EA1 A;  5D26 A;  4HXM A;  4YYJ A;  4NR6 A;  5COI A;  4LDF A;  4MR3 A;  5CQ6 A;  4QSR A;  2L85 A;  4PS5 A;  4TU6 A;  5I29 A;  3P1D A;  5HEM A;  4CUQ A;  4ALG A;  5DYX A;  3LJW A;  5CQ5 A;  5ENI A;  3JVM A;  4TS8 A;  5ENB A;  5HQ7 A;  4YK0 A;  2KTB B;  2R0Y A;  4QUU A;  5L99 A;  4UYH A;  2YYN A;  3O34 A;  5DFB A;  4C66 A;  3LQI A;  2DWW A;  4HBY A;  3P1E A;  4N4G A;  4PCE A;  3U5K A;  2DVQ A;  5J0D A;  5D3J A;  5C8G A;  4X2I A;  4A9F A;  5EVA A;  4XUA A;  4NR5 A;  4YAX A;  4YY4 A;  1ZS5 A;  5EU1 A;  2E7N A;  4O74 A;  5FG4 A;  4LYS A;  4ZW1 A;  5BT4 A;  3RCW A;  5DBM A;  5AME A;  3UV5 A;  4HXL A;  4TZ8 A;  5HEL A;  2RNX A;  4KV4 A;  4NRC A;  5FE9 A;  5LJ2 A;  5HQ5 A;  4HBX A;  4UYF A;  3DWY A;  5DKH A;  3I3J A;  4QYL A;  2D82 A;  5ENE A;  4NR8 A;  4OGJ A;  4A9J A;  4O76 A;  4CUU A;  4O7A A;  4UIW A;  5CUA A;  5EPB A;  5I7Y A;  5CQ8 A;  4QR5 A;  5FG5 A;  4YAT A;  1F68 A;  5HLS A;  5A5N A;  5CTL A;  3UV2 A;  4QC3 A;  4ZQL A;  3U5J A;  5C4Q A;  3U5M A;  5L97 A;  5IGN A;  3ZYU A;  4IR6 A;  5F61 A;  5EWV A;  4E96 A;  5EWD A;  4UIT A;  4ZC9 A;  5DY7 A;  3O37 A;  4PTB A;  4J0S A;  5EGU A;  5D3S A;  4YAD A;  1EQF A;  4UYD A;  2MJV B;  5F1H A;  3SVH A;  4BW2 A;  3O35 A;  5FH7 A;  5D3R A;  4BW4 A;  3QZS A;  5KO4 A;  4NRB A;  4O7C A;  2FSA A;  3UVX A;  4BHW A;  5ENH A;  5DYA A;  2YW5 A;  4RVR A;  5DW2 A;  5E74 A;  5FE8 A;  5TCM A;  3MUL A;  5II2 A;  3MB4 A;  2RNY A;  5FFY A;  5D3H A;  3LQH A;  5CFW A;  4AKN A;  4A9N A;  5ENJ A;  3MQM A;  5EWC A;  3HMF A;  3NXB A;  4TT2 A;  4A9L A;  4YYD A;  5EPS A;  4NS5 A;  5HFQ A;  5CP5 A;  2LSP B;  5FE2 A;  5IGL A;  3QZV A;  3LQJ A;  4NR9 A;  3U5N A;  4O7E A;  2YDW A;  4CUT A;  5KHM A;  3O33 A;  5CS8 A;  5A81 A;  5A85 A;  5CUE A;  5FE4 A;  4XUB A;  5D3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...