5I88A

Brd4 in complex with cpd4 ((e)-3-(6-(but-2-en-1-yl)-7-oxo-6,7-dihydro-1h-pyrrolo[2,3-c]pyridin-4-yl)-n,n-dimethylbenzamide)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
126
structure length
126
Chain Sequence
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 43
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i88A01
3MB3A 5G4RA 2RNXA 4O7FA 5CRMA 3U5JA 2OUOA 5FH8A 5CUAA 5D26A 4N4GA 1WUGA 4Y03A 5D3RA 4QSRA 3G0JA 3P1DA 4TS8A 4QB3A 2DATA 5DYCA 5FE9A 4O7CA 3SVHA 5KU3A 3RCWA 5CUBA 5LVRA 5DW1A 4YYHA 5D3LA 3UW9A 4PCEA 5KHMA 5A5QA 5E9MA 4Z93A 5IBNA 3U5OA 4NR7A 5F5ZA 4QSPA 4BW4A 3MXFA 5CS8A 5I88A 4IORA 3HMFA 4YBSA 4HXPA 4O77A 5I7XA 5HQ6A 4LZ2A 4J0SA 4YAXA 1F68A 5DKCA 5DYUA 4QR3A 5H85A 5IG6A 4CUTA 5CQ3A 5D3TA 2DVQA 3UVYA 3GG3A 5A5OA 2MJVB 4UIVA 5ETBA 5HEMA 4NR5A 4ZW1A 5II2A 4HXMA 5IGLA 5FE2A 4CUQA 4QYLA 5A5PA 4XY9A 5IGMA 3U5NA 5EICA 4BW3A 3P1FA 5HCLA 3DAIA 5ENCA 4HXSA 4A9HA 5F62A 4NRAA 5FE6A 4QSVA 4QSUA 4HXOA 5CGPA 5FG4A 5EK9A 3AQAA 3IU5A 5EGUA 5F60A 4OGIA 3QZSA 4BJXA 4A9LA 3ZYUA 5AD3A 4CUSA 5FE5A 3MQMA 4ZQLA 4Q0OA 4TZ8A 2I8NA 5F2PA 4UYGA 4UYDA 5H1TA 3U5MA 4E96A 4NYVA 4O76A 4QYDA 5H1UA 4UYEA 2E7NA 5FE4A 2DVVA 4UYHA 3G0LA 2R0VA 5LJ1A 5HRXA 2L5EA 3I3JA 4O70A 3P1EA 3D7CA 4C67A 4NQMA 5KO4A 4TZ2A 4TYLA 2NXBA 3O35A 5EWWA 3U5PA 5FE1A 3SVGA 4N4IA 4ALGA 5CUDA 5E7DA 4MR4A 5E9YA 5EWDA 3JVJA 4BHWA 5DLZA 2YYNA 4NUCA 4O7EA 4J3IA 4LYWA 4CUUA 5D24A 3UVWA 5LKUA 5E9KA 4CFKA 5C8GA 3LQHA 5A82A 5C4QA 5HJCA 3TLPA 3K2JA 4MENA 4MEOA 4YH4A 5D3NA 5HELA 5D3SA 3LQJA 2RNWA 5LKXA 5DBMA 5AD2A 4UIWA 3UVDA 4YBMA 5FE8A 3JVLA 3HMHA 3O37A 4O74A 2E3KA 4BW2A 4QEVA 5ENIA 5CFWA 5FFWA 5ETDA 4PTBA 4CL9A 3QZVA 4QSSA 5I80A 5D25A 3UV4A 3IU6A 4QC1A 2YEKA 5E9LA 5ENHA 4MR5A 4QC3A 5IGKA 5HQ7A 4O72A 5A83A 5L8UA 4NR6A 5CQAA 4NUEA 4J1PA 5TB6A 5FBXA 5DLXA 5CQ8A 2YQDA 5DFDA 5F1LA 5IGNA 4PKLA 5FDZA 4LZSA 4UITA 2OO1A 2D82A 3HMEA 4IR3A 2R0SA 5F1HA 5AMEA 5LKTA 5DFCA 3O34A 3U5KA 3O36A 1JM4B 4A9KA 5HFQA 2YEMA 4YYMA 4Q0NA 5EWHA 4O7BA 5A5SA 5D3PA 5F25A 5BT5A 5CUCA 5E9VA 3MULA 2OSSA 5FB0A 4QEUA 4QNSA 5EP7A 5D3JA 2KTBB 5I40A 5DYXA 4ZC9A 5EQ1A 5L8TA 4Z6IA 5ENEA 4IR5A 4LC2A 5JWMA 4HBVA 2DWWA 4QZSA 1E6IA 4KCXA 3ONIA 4PY6A 5LUUA 4AKNA 4IOQA 4A9OA 4YYJA 5FH7A 2H60A 4NR9A 4QUTA 4TU6A 4YABA 4YYNA 4LYSA 3SVFA 1WUMA 4YYGA 4MR3A 4HBWA 4N4FA 4PCIA 5KTUA 5H1VA 4A9NA 4WHUA 4RVRA 5EWCA 5E0RA 5COIA 4YC9A 4OUFA 3S92A 5LKZA 4TTEA 3U5LA 4ALHA 5C89A 2RS9B 2R10A 5CU8A 5FB1A 5EV9A 5A85A 4QSQA 4FLPA 2RO1A 4HXRA 5IIDA 3UV5A 4HBXA 4YADA 4TQNA 5CPEA 5CRZA 2D9EA 4A9JA 5E9IA 5EPRA 5D0CA 2G4AA 4QY4A 4YATA 5LJ2A 3JVMA 5KTXA 4TT2A 5FE7A 5TCMA 4HXLA 4LR6A 4NR4A 5DFBA 5FE3A 4LYIA 5EM3A 5CY9A 4C66A 4PS5A 5I7YA 1ZS5A 3LXJA 4NQNA 5K29A 4GPJA 4OGJA 4YY6A 4LZRA 1JSPB 4HXNA 2L85A 2YW5A 5I86A 5BT3A 5FE0A 4Z6HA 5L97A 4KV1A 4Z1QA 1X0JA 5A5RA 3MB4A 4QSWA 4TT6A 2RNYA 4J0RA 5EU1A 4CLBA 4QR5A 5EPBA 2RI7A 4YYDA 5FG5A 4QSXA 3LQIA 5FFYA 2GRCA 2N9GA 4NR8A 4QEWA 5D3HA 4HXKA 5F36A 4F3IA 4CURA 4NRCA 2L84A 2F6NA 4IR4A 5EISA 5DKHA 5AMFA 5HFRA 5ENFA 3UV2A 3FKMX 5HLSA 5HRWA 5ENJA 5CTLA 2DVRA 4UIXA 4YYIA 2DKWA 4NS5A 5E3GA 3P5OA 5CZGA 1N72A 4UIUA 4IOOA 5CQ6A 5CQ5A 5I83A 4TU4A 5DKDA 2FSAA 4XY8A 3Q2FA 5CP5A 4BW1A 4XUAA 4MR6A 5I1QA 4YBTA 4QSTA 5L99A 5LVQA 5FH6A 5J0DA 3AADA 5CQTA 5ENGA 5L96A 2DVSA 4UYFA 4MEPA 2WP2A 4NRBA 5C85A 5II1A 5CUEA 4O75A 5KTWA 4UIZA 5F61A 5EWVA 2R0YA 4KV4A 5DX4A 5HRVA 4LRGA 5DY7A 5FG6A 3DWYA 5E74A 4QUUA 5ACYA 5E3DA 5A81A 4X2IA 4LDFA 4NYWA 5F3AA 5C7NA 4DONA 4CFLA 4NYXA 4O71A 3NXBA 4MEQA 3Q2EA 5ENBA 4QBMA 5A7CA 4IR6A 5JI8A 4N4HA 2LSPB 4UIYA 4YYKA 5LJ0A 3LJWA 2RFJA 4NUDA 3UVXA 5HM0A 4NXJA 2WP1A 5EA1A 5EPSA 2E7OA 2F6JA 5D7XA 5C87A 5I29A 4CUPA 4A9MA 5F63A 4YY4A 3JVKA 4N3WA 5E73A 4QR4A 5I89A 2YELA 5HENA 4XYAA 3P1CA 5EI4A 3O33A 5BT4A 1EQFA 4O78A 5DW2A 4WHWA 4Z1SA 4TT4A 5CQ4A 4A9EA 4XUBA 3QZTA 4A9IA 4YH3A 5EVAA 5G4SA 5FFVA 4WIVA 4HBYA 4O7AA 4UYFB 5CQ7A 5CUGA 4A9FA 3S91A 2YDWA 2I7KA 3MUKA 4YK0A 5A5NA 5DYAA 5HQ5A 5L98A
chains in the Genus database with same CATH superfamily
3MB3A 5G4RA 2RNXA 4O7FA 5CRMA 3U5JA 2OUOA 5FH8A 5CUAA 5D26A 4N4GA 1WUGA 4Y03A 5D3RA 4QSRA 3G0JA 3P1DA 4TS8A 4QB3A 2DATA 5DYCA 5FE9A 4O7CA 3SVHA 5KU3A 3RCWA 5CUBA 5LVRA 5DW1A 4YYHA 5D3LA 3UW9A 4PCEA 5KHMA 5A5QA 5E9MA 4Z93A 5IBNA 3U5OA 4NR7A 5F5ZA 4QSPA 4BW4A 3MXFA 5CS8A 5I88A 2EJNA 4IORA 3HMFA 4YBSA 4HXPA 4O77A 5I7XA 5HQ6A 4LZ2A 4J0SA 4YAXA 1F68A 5DKCA 5DYUA 4QR3A 5H85A 5IG6A 4CUTA 5CQ3A 5D3TA 2DVQA 3UVYA 3VKGA 3GG3A 5A5OA 2MJVB 4UIVA 5ETBA 5HEMA 4NR5A 4ZW1A 5II2A 4HXMA 5IGLA 5FE2A 4CUQA 4QYLA 5A5PA 4XY9A 5IGMA 3U5NA 5EICA 4BW3A 3P1FA 5HCLA 3DAIA 5ENCA 4HXSA 4A9HA 5F62A 4NRAA 5FE6A 4QSVA 4QSUA 4HXOA 5CGPA 5FG4A 5EK9A 3AQAA 3IU5A 5EGUA 5F60A 4OGIA 3QZSA 4BJXA 4A9LA 1PUOA 3ZYUA 5AD3A 4CUSA 5FE5A 3MQMA 4ZQLA 4Q0OA 4TZ8A 2I8NA 5F2PA 4UYGA 4UYDA 5H1TA 3U5MA 4E96A 4NYVA 4O76A 4QYDA 5H1UA 4UYEA 2E7NA 5FE4A 2DVVA 4UYHA 3G0LA 2R0VA 5LJ1A 5HRXA 2L5EA 3I3JA 4O70A 3P1EA 3D7CA 4C67A 4NQMA 5KO4A 4TZ2A 4TYLA 2NXBA 3O35A 5EWWA 3U5PA 5FE1A 3SVGA 4N4IA 4ALGA 5CUDA 5E7DA 4MR4A 5E9YA 5EWDA 3JVJA 4BHWA 5DLZA 2YYNA 4NUCA 4O7EA 4J3IA 4LYWA 4CUUA 5D24A 3UVWA 5LKUA 5E9KA 4CFKA 5C8GA 3LQHA 5A82A 5C4QA 5HJCA 3TLPA 3K2JA 4MENA 4MEOA 4YH4A 5D3NA 5HELA 5D3SA 3LQJA 2RNWA 5LKXA 5DBMA 5AD2A 4UIWA 3UVDA 4YBMA 5FE8A 3JVLA 3HMHA 3O37A 4O74A 2E3KA 4BW2A 4QEVA 5ENIA 5CFWA 5FFWA 5ETDA 4PTBA 4CL9A 3QZVA 4QSSA 5I80A 5D25A 3UV4A 3IU6A 4QC1A 2YEKA 5E9LA 5ENHA 4MR5A 4QC3A 5IGKA 5HQ7A 4O72A 5A83A 5L8UA 4NR6A 5CQAA 4NUEA 4J1PA 5TB6A 3D1DA 5FBXA 5DLXA 5CQ8A 2YQDA 5DFDA 5F1LA 3ERRA 5IGNA 4PKLA 5FDZA 4LZSA 4UITA 2OO1A 2D82A 3HMEA 4IR3A 2R0SA 4AI6A 5F1HA 5AMEA 5LKTA 5DFCA 3O34A 3U5KA 3O36A 1JM4B 4A9KA 5HFQA 2YEMA 4YYMA 4Q0NA 5EWHA 4O7BA 5A5SA 5D3PA 5F25A 5BT5A 5CUCA 5E9VA 3MULA 2OSSA 5FB0A 4QEUA 4QNSA 5EP7A 5D3JA 2KTBB 5I40A 5DYXA 4ZC9A 5EQ1A 5L8TA 4Z6IA 5ENEA 4AKHA 4IR5A 4LC2A 5JWMA 4HBVA 2DWWA 4QZSA 1E6IA 4KCXA 3ONIA 4PY6A 5LUUA 4AKNA 4IOQA 4A9OA 4YYJA 5FH7A 2H60A 4NR9A 4QUTA 4TU6A 4YABA 4YYNA 4LYSA 3SVFA 1WUMA 4YYGA 4MR3A 4HBWA 4N4FA 4PCIA 5KTUA 5H1VA 4A9NA 4WHUA 4RVRA 5EWCA 5E0RA 5COIA 4YC9A 4OUFA 3S92A 5LKZA 4TTEA 3U5LA 4ALHA 5C89A 2RS9B 2R10A 5CU8A 5FB1A 5EV9A 5A85A 4QSQA 4FLPA 2RO1A 4HXRA 5IIDA 3UV5A 4HBXA 4YADA 4TQNA 5CPEA 5CRZA 2D9EA 4A9JA 5E9IA 5EPRA 5D0CA 2G4AA 4QY4A 4YATA 5LJ2A 3JVMA 5KTXA 4TT2A 5FE7A 5TCMA 4HXLA 4LR6A 4NR4A 5DFBA 5FE3A 4LYIA 5EM3A 5CY9A 4C66A 4PS5A 5I7YA 1ZS5A 3LXJA 4NQNA 5K29A 4GPJA 4OGJA 4YY6A 4LZRA 1JSPB 4HXNA 2L85A 2YW5A 5I86A 5BT3A 5FE0A 4Z6HA 5L97A 4KV1A 4Z1QA 1ZKRA 1X0JA 5A5RA 3MB4A 4QSWA 4TT6A 2RNYA 4AKIA 4J0RA 5EU1A 4CLBA 4QR5A 5EPBA 2RI7A 4YYDA 5FG5A 4QSXA 3LQIA 5FFYA 2GRCA 2N9GA 4NR8A 4QEWA 5D3HA 4HXKA 5F36A 4F3IA 4CURA 4NRCA 2L84A 2F6NA 4IR4A 5EISA 5DKHA 5AMFA 5HFRA 5ENFA 3UV2A 3FKMX 5HLSA 5HRWA 3D1BA 5ENJA 5CTLA 2DVRA 4UIXA 4YYIA 2DKWA 4NS5A 5E3GA 3P5OA 5CZGA 1N72A 4UIUA 4IOOA 5CQ6A 5CQ5A 5I83A 4AKGA 4TU4A 5DKDA 2FSAA 4XY8A 3Q2FA 5CP5A 4BW1A 4XUAA 4MR6A 5I1QA 4YBTA 4QSTA 5L99A 5LVQA 5FH6A 5J0DA 3AADA 5CQTA 5ENGA 5L96A 2DVSA 4UYFA 4MEPA 2WP2A 4NRBA 5C85A 5II1A 5CUEA 4O75A 5KTWA 4UIZA 5F61A 5EWVA 2R0YA 4KV4A 5DX4A 5HRVA 4LRGA 5DY7A 5FG6A 3DWYA 5E74A 4QUUA 5ACYA 5E3DA 5A81A 4X2IA 4LDFA 4NYWA 5F3AA 5C7NA 4DONA 4CFLA 4NYXA 4O71A 3NXBA 4MEQA 3Q2EA 5ENBA 4QBMA 5A7CA 4IR6A 5JI8A 4N4HA 2LSPB 4UIYA 4YYKA 5LJ0A 3LJWA 2RFJA 4NUDA 3UVXA 5HM0A 4NXJA 2WP1A 5EA1A 5EPSA 2E7OA 2F6JA 5D7XA 5C87A 5I29A 4CUPA 4A9MA 3VKHA 5F63A 4YY4A 3JVKA 4N3WA 5E73A 4QR4A 5I89A 2YELA 5HENA 4XYAA 3P1CA 5EI4A 3O33A 5BT4A 1EQFA 4O78A 5DW2A 4WHWA 4Z1SA 4TT4A 5CQ4A 4A9EA 4XUBA 3QZTA 4A9IA 4YH3A 5EVAA 5G4SA 5FFVA 4WIVA 4HBYA 4O7AA 4UYFB 5CQ7A 5CUGA 4A9FA 3S91A 2YDWA 2I7KA 3MUKA 4YK0A 5A5NA 5DYAA 5HQ5A 5L98A
chains in the Genus database with same CATH topology
3MB3A 5G4RA 2RNXA 4O7FA 5CRMA 3U5JA 2OUOA 5FH8A 5CUAA 5D26A 4N4GA 1WUGA 4Y03A 5D3RA 4QSRA 3G0JA 3P1DA 4TS8A 4QB3A 2DATA 5DYCA 5FE9A 4O7CA 3SVHA 5KU3A 3RCWA 5CUBA 5LVRA 5DW1A 4YYHA 5D3LA 3UW9A 4PCEA 5KHMA 5A5QA 5E9MA 4Z93A 5IBNA 3U5OA 4NR7A 5F5ZA 4QSPA 4BW4A 3MXFA 5CS8A 5I88A 4IORA 3HMFA 4YBSA 4HXPA 4O77A 5I7XA 5HQ6A 4LZ2A 4J0SA 4YAXA 1F68A 5DKCA 5DYUA 4QR3A 5H85A 5IG6A 4CUTA 5CQ3A 5D3TA 2DVQA 3UVYA 3GG3A 5A5OA 2MJVB 4UIVA 5ETBA 5HEMA 4NR5A 4ZW1A 5II2A 4HXMA 5IGLA 5FE2A 4CUQA 4QYLA 5A5PA 4XY9A 5IGMA 3U5NA 5EICA 4BW3A 3P1FA 5HCLA 3DAIA 5ENCA 4HXSA 4A9HA 5F62A 4NRAA 5FE6A 4QSVA 4QSUA 4HXOA 5CGPA 5FG4A 5EK9A 3AQAA 3IU5A 5EGUA 5F60A 4OGIA 3QZSA 4BJXA 4A9LA 3ZYUA 5AD3A 4CUSA 5FE5A 3MQMA 4ZQLA 4Q0OA 4TZ8A 2I8NA 5F2PA 4UYGA 4UYDA 5H1TA 3U5MA 4E96A 4NYVA 4O76A 4QYDA 5H1UA 4UYEA 2E7NA 5FE4A 2DVVA 4UYHA 3G0LA 2R0VA 5LJ1A 5HRXA 2L5EA 3I3JA 4O70A 3P1EA 3D7CA 4C67A 4NQMA 5KO4A 4TZ2A 4TYLA 2NXBA 3O35A 5EWWA 3U5PA 5FE1A 3SVGA 4N4IA 4ALGA 5CUDA 5E7DA 4MR4A 5E9YA 5EWDA 3JVJA 4BHWA 5DLZA 2YYNA 4NUCA 4O7EA 4J3IA 4LYWA 4CUUA 5D24A 3UVWA 5LKUA 5E9KA 4CFKA 5C8GA 3LQHA 5A82A 5C4QA 5HJCA 3TLPA 3K2JA 4MENA 4MEOA 4YH4A 5D3NA 5HELA 5D3SA 3LQJA 2RNWA 5LKXA 5DBMA 5AD2A 4UIWA 3UVDA 4YBMA 5FE8A 3JVLA 3HMHA 3O37A 4O74A 2E3KA 4BW2A 4QEVA 5ENIA 5CFWA 5FFWA 5ETDA 4PTBA 4CL9A 3QZVA 4QSSA 5I80A 5D25A 3UV4A 3IU6A 4QC1A 2YEKA 5E9LA 5ENHA 4MR5A 4QC3A 5IGKA 5HQ7A 4O72A 5A83A 5L8UA 4NR6A 5CQAA 4NUEA 4J1PA 5TB6A 5FBXA 5DLXA 5CQ8A 2YQDA 5DFDA 5F1LA 5IGNA 4PKLA 5FDZA 4LZSA 4UITA 2OO1A 2D82A 3HMEA 4IR3A 2R0SA 5F1HA 5AMEA 5LKTA 5DFCA 3O34A 3U5KA 3O36A 1JM4B 4A9KA 5HFQA 2YEMA 4YYMA 4Q0NA 5EWHA 4O7BA 5A5SA 5D3PA 5F25A 5BT5A 5CUCA 5E9VA 3MULA 2OSSA 5FB0A 4QEUA 4QNSA 5EP7A 5D3JA 2KTBB 5I40A 5DYXA 4ZC9A 5EQ1A 5L8TA 4Z6IA 5ENEA 4IR5A 4LC2A 5JWMA 4HBVA 2DWWA 4QZSA 1E6IA 4KCXA 3ONIA 4PY6A 5LUUA 4AKNA 4IOQA 4A9OA 4YYJA 5FH7A 2H60A 4NR9A 4QUTA 4TU6A 4YABA 4YYNA 4LYSA 3SVFA 1WUMA 4YYGA 4MR3A 4HBWA 4N4FA 4PCIA 5KTUA 5H1VA 4A9NA 4WHUA 4RVRA 5EWCA 5E0RA 5COIA 4YC9A 4OUFA 3S92A 5LKZA 4TTEA 3U5LA 4ALHA 5C89A 2RS9B 2R10A 5CU8A 5FB1A 5EV9A 5A85A 4QSQA 4FLPA 2RO1A 4HXRA 5IIDA 3UV5A 4HBXA 4YADA 4TQNA 5CPEA 5CRZA 2D9EA 4A9JA 5E9IA 5EPRA 5D0CA 2G4AA 4QY4A 4YATA 5LJ2A 3JVMA 5KTXA 4TT2A 5FE7A 5TCMA 4HXLA 4LR6A 4NR4A 5DFBA 5FE3A 4LYIA 5EM3A 5CY9A 4C66A 4PS5A 5I7YA 1ZS5A 3LXJA 4NQNA 5K29A 4GPJA 4OGJA 4YY6A 4LZRA 1JSPB 4HXNA 2L85A 2YW5A 5I86A 5BT3A 5FE0A 4Z6HA 5L97A 4KV1A 4Z1QA 1X0JA 5A5RA 3MB4A 4QSWA 4TT6A 2RNYA 4J0RA 5EU1A 4CLBA 4QR5A 5EPBA 2RI7A 4YYDA 5FG5A 4QSXA 3LQIA 5FFYA 2GRCA 2N9GA 4NR8A 4QEWA 5D3HA 4HXKA 5F36A 4F3IA 4CURA 4NRCA 2L84A 2F6NA 4IR4A 5EISA 5DKHA 5AMFA 5HFRA 5ENFA 3UV2A 3FKMX 5HLSA 5HRWA 5ENJA 5CTLA 2DVRA 4UIXA 4YYIA 2DKWA 4NS5A 5E3GA 3P5OA 5CZGA 1N72A 4UIUA 4IOOA 5CQ6A 5CQ5A 5I83A 4TU4A 5DKDA 2FSAA 4XY8A 3Q2FA 5CP5A 4BW1A 4XUAA 4MR6A 5I1QA 4YBTA 4QSTA 5L99A 5LVQA 5FH6A 5J0DA 3AADA 5CQTA 5ENGA 5L96A 2DVSA 4UYFA 4MEPA 2WP2A 4NRBA 5C85A 5II1A 5CUEA 4O75A 5KTWA 4UIZA 5F61A 5EWVA 2R0YA 4KV4A 5DX4A 5HRVA 4LRGA 5DY7A 5FG6A 3DWYA 5E74A 4QUUA 5ACYA 5E3DA 5A81A 4X2IA 4LDFA 4NYWA 5F3AA 5C7NA 4DONA 4CFLA 4NYXA 4O71A 3NXBA 4MEQA 3Q2EA 5ENBA 4QBMA 5A7CA 4IR6A 5JI8A 4N4HA 2LSPB 4UIYA 4YYKA 5LJ0A 3LJWA 2RFJA 4NUDA 3UVXA 5HM0A 4NXJA 2WP1A 5EA1A 5EPSA 2E7OA 2F6JA 5D7XA 5C87A 5I29A 4CUPA 4A9MA 5F63A 4YY4A 3JVKA 4N3WA 5E73A 4QR4A 5I89A 2YELA 5HENA 4XYAA 3P1CA 5EI4A 3O33A 5BT4A 1EQFA 4O78A 5DW2A 4WHWA 4Z1SA 4TT4A 5CQ4A 4A9EA 4XUBA 3QZTA 4A9IA 4YH3A 5EVAA 5G4SA 5FFVA 4WIVA 4HBYA 4O7AA 4UYFB 5CQ7A 5CUGA 4A9FA 3S91A 2YDWA 2I7KA 3MUKA 4YK0A 5A5NA 5DYAA 5HQ5A 5L98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MB3 A;  5G4R A;  2RNX A;  4O7F A;  5CRM A;  3U5J A;  2OUO A;  5FH8 A;  5CUA A;  5D26 A;  4N4G A;  1WUG A;  4Y03 A;  5D3R A;  4QSR A;  3G0J A;  3P1D A;  4TS8 A;  4QB3 A;  2DAT A;  5DYC A;  5FE9 A;  4O7C A;  3SVH A;  5KU3 A;  3RCW A;  5CUB A;  5LVR A;  5DW1 A;  4YYH A;  5D3L A;  3UW9 A;  4PCE A;  5KHM A;  5A5Q A;  5E9M A;  4Z93 A;  5IBN A;  3U5O A;  4NR7 A;  5F5Z A;  4QSP A;  4BW4 A;  3MXF A;  5CS8 A;  5I88 A;  4IOR A;  3HMF A;  4YBS A;  4HXP A;  4O77 A;  5I7X A;  5HQ6 A;  4LZ2 A;  4J0S A;  4YAX A;  1F68 A;  5DKC A;  5DYU A;  4QR3 A;  5H85 A;  5IG6 A;  4CUT A;  5CQ3 A;  5D3T A;  2DVQ A;  3UVY A;  3GG3 A;  5A5O A;  2MJV B;  4UIV A;  5ETB A;  5HEM A;  4NR5 A;  4ZW1 A;  5II2 A;  4HXM A;  5IGL A;  5FE2 A;  4CUQ A;  4QYL A;  5A5P A;  4XY9 A;  5IGM A;  3U5N A;  5EIC A;  4BW3 A;  3P1F A;  5HCL A;  3DAI A;  5ENC A;  4HXS A;  4A9H A;  5F62 A;  4NRA A;  5FE6 A;  4QSV A;  4QSU A;  4HXO A;  5CGP A;  5FG4 A;  5EK9 A;  3AQA A;  3IU5 A;  5EGU A;  5F60 A;  4OGI A;  3QZS A;  4BJX A;  4A9L A;  3ZYU A;  5AD3 A;  4CUS A;  5FE5 A;  3MQM A;  4ZQL A;  4Q0O A;  4TZ8 A;  2I8N A;  5F2P A;  4UYG A;  4UYD A;  5H1T A;  3U5M A;  4E96 A;  4NYV A;  4O76 A;  4QYD A;  5H1U A;  4UYE A;  2E7N A;  5FE4 A;  2DVV A;  4UYH A;  3G0L A;  2R0V A;  5LJ1 A;  5HRX A;  2L5E A;  3I3J A;  4O70 A;  3P1E A;  3D7C A;  4C67 A;  4NQM A;  5KO4 A;  4TZ2 A;  4TYL A;  2NXB A;  3O35 A;  5EWW A;  3U5P A;  5FE1 A;  3SVG A;  4N4I A;  4ALG A;  5CUD A;  5E7D A;  4MR4 A;  5E9Y A;  5EWD A;  3JVJ A;  4BHW A;  5DLZ A;  2YYN A;  4NUC A;  4O7E A;  4J3I A;  4LYW A;  4CUU A;  5D24 A;  3UVW A;  5LKU A;  5E9K A;  4CFK A;  5C8G A;  3LQH A;  5A82 A;  5C4Q A;  5HJC A;  3TLP A;  3K2J A;  4MEN A;  4MEO A;  4YH4 A;  5D3N A;  5HEL A;  5D3S A;  3LQJ A;  2RNW A;  5LKX A;  5DBM A;  5AD2 A;  4UIW A;  3UVD A;  4YBM A;  5FE8 A;  3JVL A;  3HMH A;  3O37 A;  4O74 A;  2E3K A;  4BW2 A;  4QEV A;  5ENI A;  5CFW A;  5FFW A;  5ETD A;  4PTB A;  4CL9 A;  3QZV A;  4QSS A;  5I80 A;  5D25 A;  3UV4 A;  3IU6 A;  4QC1 A;  2YEK A;  5E9L A;  5ENH A;  4MR5 A;  4QC3 A;  5IGK A;  5HQ7 A;  4O72 A;  5A83 A;  5L8U A;  4NR6 A;  5CQA A;  4NUE A;  4J1P A;  5TB6 A;  5FBX A;  5DLX A;  5CQ8 A;  2YQD A;  5DFD A;  5F1L A;  5IGN A;  4PKL A;  5FDZ A;  4LZS A;  4UIT A;  2OO1 A;  2D82 A;  3HME A;  4IR3 A;  2R0S A;  5F1H A;  5AME A;  5LKT A;  5DFC A;  3O34 A;  3U5K A;  3O36 A;  1JM4 B;  4A9K A;  5HFQ A;  2YEM A;  4YYM A;  4Q0N A;  5EWH A;  4O7B A;  5A5S A;  5D3P A;  5F25 A;  5BT5 A;  5CUC A;  5E9V A;  3MUL A;  2OSS A;  5FB0 A;  4QEU A;  4QNS A;  5EP7 A;  5D3J A;  2KTB B;  5I40 A;  5DYX A;  4ZC9 A;  5EQ1 A;  5L8T A;  4Z6I A;  5ENE A;  4IR5 A;  4LC2 A;  5JWM A;  4HBV A;  2DWW A;  4QZS A;  1E6I A;  4KCX A;  3ONI A;  4PY6 A;  5LUU A;  4AKN A;  4IOQ A;  4A9O A;  4YYJ A;  5FH7 A;  2H60 A;  4NR9 A;  4QUT A;  4TU6 A;  4YAB A;  4YYN A;  4LYS A;  3SVF A;  1WUM A;  4YYG A;  4MR3 A;  4HBW A;  4N4F A;  4PCI A;  5KTU A;  5H1V A;  4A9N A;  4WHU A;  4RVR A;  5EWC A;  5E0R A;  5COI A;  4YC9 A;  4OUF A;  3S92 A;  5LKZ A;  4TTE A;  3U5L A;  4ALH A;  5C89 A;  2RS9 B;  2R10 A;  5CU8 A;  5FB1 A;  5EV9 A;  5A85 A;  4QSQ A;  4FLP A;  2RO1 A;  4HXR A;  5IID A;  3UV5 A;  4HBX A;  4YAD A;  4TQN A;  5CPE A;  5CRZ A;  2D9E A;  4A9J A;  5E9I A;  5EPR A;  5D0C A;  2G4A A;  4QY4 A;  4YAT A;  5LJ2 A;  3JVM A;  5KTX A;  4TT2 A;  5FE7 A;  5TCM A;  4HXL A;  4LR6 A;  4NR4 A;  5DFB A;  5FE3 A;  4LYI A;  5EM3 A;  5CY9 A;  4C66 A;  4PS5 A;  5I7Y A;  1ZS5 A;  3LXJ A;  4NQN A;  5K29 A;  4GPJ A;  4OGJ A;  4YY6 A;  4LZR A;  1JSP B;  4HXN A;  2L85 A;  2YW5 A;  5I86 A;  5BT3 A;  5FE0 A;  4Z6H A;  5L97 A;  4KV1 A;  4Z1Q A;  1X0J A;  5A5R A;  3MB4 A;  4QSW A;  4TT6 A;  2RNY A;  4J0R A;  5EU1 A;  4CLB A;  4QR5 A;  5EPB A;  2RI7 A;  4YYD A;  5FG5 A;  4QSX A;  3LQI A;  5FFY A;  2GRC A;  2N9G A;  4NR8 A;  4QEW A;  5D3H A;  4HXK A;  5F36 A;  4F3I A;  4CUR A;  4NRC A;  2L84 A;  2F6N A;  4IR4 A;  5EIS A;  5DKH A;  5AMF A;  5HFR A;  5ENF A;  3UV2 A;  3FKM X;  5HLS A;  5HRW A;  5ENJ A;  5CTL A;  2DVR A;  4UIX A;  4YYI A;  2DKW A;  4NS5 A;  5E3G A;  3P5O A;  5CZG A;  1N72 A;  4UIU A;  4IOO A;  5CQ6 A;  5CQ5 A;  5I83 A;  4TU4 A;  5DKD A;  2FSA A;  4XY8 A;  3Q2F A;  5CP5 A;  4BW1 A;  4XUA A;  4MR6 A;  5I1Q A;  4YBT A;  4QST A;  5L99 A;  5LVQ A;  5FH6 A;  5J0D A;  3AAD A;  5CQT A;  5ENG A;  5L96 A;  2DVS A;  4UYF A;  4MEP A;  2WP2 A;  4NRB A;  5C85 A;  5II1 A;  5CUE A;  4O75 A;  5KTW A;  4UIZ A;  5F61 A;  5EWV A;  2R0Y A;  4KV4 A;  5DX4 A;  5HRV A;  4LRG A;  5DY7 A;  5FG6 A;  3DWY A;  5E74 A;  4QUU A;  5ACY A;  5E3D A;  5A81 A;  4X2I A;  4LDF A;  4NYW A;  5F3A A;  5C7N A;  4DON A;  4CFL A;  4NYX A;  4O71 A;  3NXB A;  4MEQ A;  3Q2E A;  5ENB A;  4QBM A;  5A7C A;  4IR6 A;  5JI8 A;  4N4H A;  2LSP B;  4UIY A;  4YYK A;  5LJ0 A;  3LJW A;  2RFJ A;  4NUD A;  3UVX A;  5HM0 A;  4NXJ A;  2WP1 A;  5EA1 A;  5EPS A;  2E7O A;  2F6J A;  5D7X A;  5C87 A;  5I29 A;  4CUP A;  4A9M A;  5F63 A;  4YY4 A;  3JVK A;  4N3W A;  5E73 A;  4QR4 A;  5I89 A;  2YEL A;  5HEN A;  4XYA A;  3P1C A;  5EI4 A;  3O33 A;  5BT4 A;  1EQF A;  4O78 A;  5DW2 A;  4WHW A;  4Z1S A;  4TT4 A;  5CQ4 A;  4A9E A;  4XUB A;  3QZT A;  4A9I A;  4YH3 A;  5EVA A;  5G4S A;  5FFV A;  4WIV A;  4HBY A;  4O7A A;  4UYF B;  5CQ7 A;  5CUG A;  4A9F A;  3S91 A;  2YDW A;  2I7K A;  3MUK A;  4YK0 A;  5A5N A;  5DYA A;  5HQ5 A;  5L98 A; 
#chains in the Genus database with same CATH topology
 3MB3 A;  5G4R A;  2RNX A;  4O7F A;  5CRM A;  3U5J A;  2OUO A;  5FH8 A;  5CUA A;  5D26 A;  4N4G A;  1WUG A;  4Y03 A;  5D3R A;  4QSR A;  3G0J A;  3P1D A;  4TS8 A;  4QB3 A;  2DAT A;  5DYC A;  5FE9 A;  4O7C A;  3SVH A;  5KU3 A;  3RCW A;  5CUB A;  5LVR A;  5DW1 A;  4YYH A;  5D3L A;  3UW9 A;  4PCE A;  5KHM A;  5A5Q A;  5E9M A;  4Z93 A;  5IBN A;  3U5O A;  4NR7 A;  5F5Z A;  4QSP A;  4BW4 A;  3MXF A;  5CS8 A;  5I88 A;  2EJN A;  4IOR A;  3HMF A;  4YBS A;  4HXP A;  4O77 A;  5I7X A;  5HQ6 A;  4LZ2 A;  4J0S A;  4YAX A;  1F68 A;  5DKC A;  5DYU A;  4QR3 A;  5H85 A;  5IG6 A;  4CUT A;  5CQ3 A;  5D3T A;  2DVQ A;  3UVY A;  3VKG A;  3GG3 A;  5A5O A;  2MJV B;  4UIV A;  5ETB A;  5HEM A;  4NR5 A;  4ZW1 A;  5II2 A;  4HXM A;  5IGL A;  5FE2 A;  4CUQ A;  4QYL A;  5A5P A;  4XY9 A;  5IGM A;  3U5N A;  5EIC A;  4BW3 A;  3P1F A;  5HCL A;  3DAI A;  5ENC A;  4HXS A;  4A9H A;  5F62 A;  4NRA A;  5FE6 A;  4QSV A;  4QSU A;  4HXO A;  5CGP A;  5FG4 A;  5EK9 A;  3AQA A;  3IU5 A;  5EGU A;  5F60 A;  4OGI A;  3QZS A;  4BJX A;  4A9L A;  1PUO A;  3ZYU A;  5AD3 A;  4CUS A;  5FE5 A;  3MQM A;  4ZQL A;  4Q0O A;  4TZ8 A;  2I8N A;  5F2P A;  4UYG A;  4UYD A;  5H1T A;  3U5M A;  4E96 A;  4NYV A;  4O76 A;  4QYD A;  5H1U A;  4UYE A;  2E7N A;  5FE4 A;  2DVV A;  4UYH A;  3G0L A;  2R0V A;  5LJ1 A;  5HRX A;  2L5E A;  3I3J A;  4O70 A;  3P1E A;  3D7C A;  4C67 A;  4NQM A;  5KO4 A;  4TZ2 A;  4TYL A;  2NXB A;  3O35 A;  5EWW A;  3U5P A;  5FE1 A;  3SVG A;  4N4I A;  4ALG A;  5CUD A;  5E7D A;  4MR4 A;  5E9Y A;  5EWD A;  3JVJ A;  4BHW A;  5DLZ A;  2YYN A;  4NUC A;  4O7E A;  4J3I A;  4LYW A;  4CUU A;  5D24 A;  3UVW A;  5LKU A;  5E9K A;  4CFK A;  5C8G A;  3LQH A;  5A82 A;  5C4Q A;  5HJC A;  3TLP A;  3K2J A;  4MEN A;  4MEO A;  4YH4 A;  5D3N A;  5HEL A;  5D3S A;  3LQJ A;  2RNW A;  5LKX A;  5DBM A;  5AD2 A;  4UIW A;  3UVD A;  4YBM A;  5FE8 A;  3JVL A;  3HMH A;  3O37 A;  4O74 A;  2E3K A;  4BW2 A;  4QEV A;  5ENI A;  5CFW A;  5FFW A;  5ETD A;  4PTB A;  4CL9 A;  3QZV A;  4QSS A;  5I80 A;  5D25 A;  3UV4 A;  3IU6 A;  4QC1 A;  2YEK A;  5E9L A;  5ENH A;  4MR5 A;  4QC3 A;  5IGK A;  5HQ7 A;  4O72 A;  5A83 A;  5L8U A;  4NR6 A;  5CQA A;  4NUE A;  4J1P A;  5TB6 A;  3D1D A;  5FBX A;  5DLX A;  5CQ8 A;  2YQD A;  5DFD A;  5F1L A;  3ERR A;  5IGN A;  4PKL A;  5FDZ A;  4LZS A;  4UIT A;  2OO1 A;  2D82 A;  3HME A;  4IR3 A;  2R0S A;  4AI6 A;  5F1H A;  5AME A;  5LKT A;  5DFC A;  3O34 A;  3U5K A;  3O36 A;  1JM4 B;  4A9K A;  5HFQ A;  2YEM A;  4YYM A;  4Q0N A;  5EWH A;  4O7B A;  5A5S A;  5D3P A;  5F25 A;  5BT5 A;  5CUC A;  5E9V A;  3MUL A;  2OSS A;  5FB0 A;  4QEU A;  4QNS A;  5EP7 A;  5D3J A;  2KTB B;  5I40 A;  5DYX A;  4ZC9 A;  5EQ1 A;  5L8T A;  4Z6I A;  5ENE A;  4AKH A;  4IR5 A;  4LC2 A;  5JWM A;  4HBV A;  2DWW A;  4QZS A;  1E6I A;  4KCX A;  3ONI A;  4PY6 A;  5LUU A;  4AKN A;  4IOQ A;  4A9O A;  4YYJ A;  5FH7 A;  2H60 A;  4NR9 A;  4QUT A;  4TU6 A;  4YAB A;  4YYN A;  4LYS A;  3SVF A;  1WUM A;  4YYG A;  4MR3 A;  4HBW A;  4N4F A;  4PCI A;  5KTU A;  5H1V A;  4A9N A;  4WHU A;  4RVR A;  5EWC A;  5E0R A;  5COI A;  4YC9 A;  4OUF A;  3S92 A;  5LKZ A;  4TTE A;  3U5L A;  4ALH A;  5C89 A;  2RS9 B;  2R10 A;  5CU8 A;  5FB1 A;  5EV9 A;  5A85 A;  4QSQ A;  4FLP A;  2RO1 A;  4HXR A;  5IID A;  3UV5 A;  4HBX A;  4YAD A;  4TQN A;  5CPE A;  5CRZ A;  2D9E A;  4A9J A;  5E9I A;  5EPR A;  5D0C A;  2G4A A;  4QY4 A;  4YAT A;  5LJ2 A;  3JVM A;  5KTX A;  4TT2 A;  5FE7 A;  5TCM A;  4HXL A;  4LR6 A;  4NR4 A;  5DFB A;  5FE3 A;  4LYI A;  5EM3 A;  5CY9 A;  4C66 A;  4PS5 A;  5I7Y A;  1ZS5 A;  3LXJ A;  4NQN A;  5K29 A;  4GPJ A;  4OGJ A;  4YY6 A;  4LZR A;  1JSP B;  4HXN A;  2L85 A;  2YW5 A;  5I86 A;  5BT3 A;  5FE0 A;  4Z6H A;  5L97 A;  4KV1 A;  4Z1Q A;  1ZKR A;  1X0J A;  5A5R A;  3MB4 A;  4QSW A;  4TT6 A;  2RNY A;  4AKI A;  4J0R A;  5EU1 A;  4CLB A;  4QR5 A;  5EPB A;  2RI7 A;  4YYD A;  5FG5 A;  4QSX A;  3LQI A;  5FFY A;  2GRC A;  2N9G A;  4NR8 A;  4QEW A;  5D3H A;  4HXK A;  5F36 A;  4F3I A;  4CUR A;  4NRC A;  2L84 A;  2F6N A;  4IR4 A;  5EIS A;  5DKH A;  5AMF A;  5HFR A;  5ENF A;  3UV2 A;  3FKM X;  5HLS A;  5HRW A;  3D1B A;  5ENJ A;  5CTL A;  2DVR A;  4UIX A;  4YYI A;  2DKW A;  4NS5 A;  5E3G A;  3P5O A;  5CZG A;  1N72 A;  4UIU A;  4IOO A;  5CQ6 A;  5CQ5 A;  5I83 A;  4AKG A;  4TU4 A;  5DKD A;  2FSA A;  4XY8 A;  3Q2F A;  5CP5 A;  4BW1 A;  4XUA A;  4MR6 A;  5I1Q A;  4YBT A;  4QST A;  5L99 A;  5LVQ A;  5FH6 A;  5J0D A;  3AAD A;  5CQT A;  5ENG A;  5L96 A;  2DVS A;  4UYF A;  4MEP A;  2WP2 A;  4NRB A;  5C85 A;  5II1 A;  5CUE A;  4O75 A;  5KTW A;  4UIZ A;  5F61 A;  5EWV A;  2R0Y A;  4KV4 A;  5DX4 A;  5HRV A;  4LRG A;  5DY7 A;  5FG6 A;  3DWY A;  5E74 A;  4QUU A;  5ACY A;  5E3D A;  5A81 A;  4X2I A;  4LDF A;  4NYW A;  5F3A A;  5C7N A;  4DON A;  4CFL A;  4NYX A;  4O71 A;  3NXB A;  4MEQ A;  3Q2E A;  5ENB A;  4QBM A;  5A7C A;  4IR6 A;  5JI8 A;  4N4H A;  2LSP B;  4UIY A;  4YYK A;  5LJ0 A;  3LJW A;  2RFJ A;  4NUD A;  3UVX A;  5HM0 A;  4NXJ A;  2WP1 A;  5EA1 A;  5EPS A;  2E7O A;  2F6J A;  5D7X A;  5C87 A;  5I29 A;  4CUP A;  4A9M A;  3VKH A;  5F63 A;  4YY4 A;  3JVK A;  4N3W A;  5E73 A;  4QR4 A;  5I89 A;  2YEL A;  5HEN A;  4XYA A;  3P1C A;  5EI4 A;  3O33 A;  5BT4 A;  1EQF A;  4O78 A;  5DW2 A;  4WHW A;  4Z1S A;  4TT4 A;  5CQ4 A;  4A9E A;  4XUB A;  3QZT A;  4A9I A;  4YH3 A;  5EVA A;  5G4S A;  5FFV A;  4WIV A;  4HBY A;  4O7A A;  4UYF B;  5CQ7 A;  5CUG A;  4A9F A;  3S91 A;  2YDW A;  2I7K A;  3MUK A;  4YK0 A;  5A5N A;  5DYA A;  5HQ5 A;  5L98 A; 
#chains in the Genus database with same CATH homology
 3MB3 A;  5G4R A;  2RNX A;  4O7F A;  5CRM A;  3U5J A;  2OUO A;  5FH8 A;  5CUA A;  5D26 A;  4N4G A;  1WUG A;  4Y03 A;  5D3R A;  4QSR A;  3G0J A;  3P1D A;  4TS8 A;  4QB3 A;  2DAT A;  5DYC A;  5FE9 A;  4O7C A;  3SVH A;  5KU3 A;  3RCW A;  5CUB A;  5LVR A;  5DW1 A;  4YYH A;  5D3L A;  3UW9 A;  4PCE A;  5KHM A;  5A5Q A;  5E9M A;  4Z93 A;  5IBN A;  3U5O A;  4NR7 A;  5F5Z A;  4QSP A;  4BW4 A;  3MXF A;  5CS8 A;  5I88 A;  4IOR A;  3HMF A;  4YBS A;  4HXP A;  4O77 A;  5I7X A;  5HQ6 A;  4LZ2 A;  4J0S A;  4YAX A;  1F68 A;  5DKC A;  5DYU A;  4QR3 A;  5H85 A;  5IG6 A;  4CUT A;  5CQ3 A;  5D3T A;  2DVQ A;  3UVY A;  3GG3 A;  5A5O A;  2MJV B;  4UIV A;  5ETB A;  5HEM A;  4NR5 A;  4ZW1 A;  5II2 A;  4HXM A;  5IGL A;  5FE2 A;  4CUQ A;  4QYL A;  5A5P A;  4XY9 A;  5IGM A;  3U5N A;  5EIC A;  4BW3 A;  3P1F A;  5HCL A;  3DAI A;  5ENC A;  4HXS A;  4A9H A;  5F62 A;  4NRA A;  5FE6 A;  4QSV A;  4QSU A;  4HXO A;  5CGP A;  5FG4 A;  5EK9 A;  3AQA A;  3IU5 A;  5EGU A;  5F60 A;  4OGI A;  3QZS A;  4BJX A;  4A9L A;  3ZYU A;  5AD3 A;  4CUS A;  5FE5 A;  3MQM A;  4ZQL A;  4Q0O A;  4TZ8 A;  2I8N A;  5F2P A;  4UYG A;  4UYD A;  5H1T A;  3U5M A;  4E96 A;  4NYV A;  4O76 A;  4QYD A;  5H1U A;  4UYE A;  2E7N A;  5FE4 A;  2DVV A;  4UYH A;  3G0L A;  2R0V A;  5LJ1 A;  5HRX A;  2L5E A;  3I3J A;  4O70 A;  3P1E A;  3D7C A;  4C67 A;  4NQM A;  5KO4 A;  4TZ2 A;  4TYL A;  2NXB A;  3O35 A;  5EWW A;  3U5P A;  5FE1 A;  3SVG A;  4N4I A;  4ALG A;  5CUD A;  5E7D A;  4MR4 A;  5E9Y A;  5EWD A;  3JVJ A;  4BHW A;  5DLZ A;  2YYN A;  4NUC A;  4O7E A;  4J3I A;  4LYW A;  4CUU A;  5D24 A;  3UVW A;  5LKU A;  5E9K A;  4CFK A;  5C8G A;  3LQH A;  5A82 A;  5C4Q A;  5HJC A;  3TLP A;  3K2J A;  4MEN A;  4MEO A;  4YH4 A;  5D3N A;  5HEL A;  5D3S A;  3LQJ A;  2RNW A;  5LKX A;  5DBM A;  5AD2 A;  4UIW A;  3UVD A;  4YBM A;  5FE8 A;  3JVL A;  3HMH A;  3O37 A;  4O74 A;  2E3K A;  4BW2 A;  4QEV A;  5ENI A;  5CFW A;  5FFW A;  5ETD A;  4PTB A;  4CL9 A;  3QZV A;  4QSS A;  5I80 A;  5D25 A;  3UV4 A;  3IU6 A;  4QC1 A;  2YEK A;  5E9L A;  5ENH A;  4MR5 A;  4QC3 A;  5IGK A;  5HQ7 A;  4O72 A;  5A83 A;  5L8U A;  4NR6 A;  5CQA A;  4NUE A;  4J1P A;  5TB6 A;  5FBX A;  5DLX A;  5CQ8 A;  2YQD A;  5DFD A;  5F1L A;  5IGN A;  4PKL A;  5FDZ A;  4LZS A;  4UIT A;  2OO1 A;  2D82 A;  3HME A;  4IR3 A;  2R0S A;  5F1H A;  5AME A;  5LKT A;  5DFC A;  3O34 A;  3U5K A;  3O36 A;  1JM4 B;  4A9K A;  5HFQ A;  2YEM A;  4YYM A;  4Q0N A;  5EWH A;  4O7B A;  5A5S A;  5D3P A;  5F25 A;  5BT5 A;  5CUC A;  5E9V A;  3MUL A;  2OSS A;  5FB0 A;  4QEU A;  4QNS A;  5EP7 A;  5D3J A;  2KTB B;  5I40 A;  5DYX A;  4ZC9 A;  5EQ1 A;  5L8T A;  4Z6I A;  5ENE A;  4IR5 A;  4LC2 A;  5JWM A;  4HBV A;  2DWW A;  4QZS A;  1E6I A;  4KCX A;  3ONI A;  4PY6 A;  5LUU A;  4AKN A;  4IOQ A;  4A9O A;  4YYJ A;  5FH7 A;  2H60 A;  4NR9 A;  4QUT A;  4TU6 A;  4YAB A;  4YYN A;  4LYS A;  3SVF A;  1WUM A;  4YYG A;  4MR3 A;  4HBW A;  4N4F A;  4PCI A;  5KTU A;  5H1V A;  4A9N A;  4WHU A;  4RVR A;  5EWC A;  5E0R A;  5COI A;  4YC9 A;  4OUF A;  3S92 A;  5LKZ A;  4TTE A;  3U5L A;  4ALH A;  5C89 A;  2RS9 B;  2R10 A;  5CU8 A;  5FB1 A;  5EV9 A;  5A85 A;  4QSQ A;  4FLP A;  2RO1 A;  4HXR A;  5IID A;  3UV5 A;  4HBX A;  4YAD A;  4TQN A;  5CPE A;  5CRZ A;  2D9E A;  4A9J A;  5E9I A;  5EPR A;  5D0C A;  2G4A A;  4QY4 A;  4YAT A;  5LJ2 A;  3JVM A;  5KTX A;  4TT2 A;  5FE7 A;  5TCM A;  4HXL A;  4LR6 A;  4NR4 A;  5DFB A;  5FE3 A;  4LYI A;  5EM3 A;  5CY9 A;  4C66 A;  4PS5 A;  5I7Y A;  1ZS5 A;  3LXJ A;  4NQN A;  5K29 A;  4GPJ A;  4OGJ A;  4YY6 A;  4LZR A;  1JSP B;  4HXN A;  2L85 A;  2YW5 A;  5I86 A;  5BT3 A;  5FE0 A;  4Z6H A;  5L97 A;  4KV1 A;  4Z1Q A;  1X0J A;  5A5R A;  3MB4 A;  4QSW A;  4TT6 A;  2RNY A;  4J0R A;  5EU1 A;  4CLB A;  4QR5 A;  5EPB A;  2RI7 A;  4YYD A;  5FG5 A;  4QSX A;  3LQI A;  5FFY A;  2GRC A;  2N9G A;  4NR8 A;  4QEW A;  5D3H A;  4HXK A;  5F36 A;  4F3I A;  4CUR A;  4NRC A;  2L84 A;  2F6N A;  4IR4 A;  5EIS A;  5DKH A;  5AMF A;  5HFR A;  5ENF A;  3UV2 A;  3FKM X;  5HLS A;  5HRW A;  5ENJ A;  5CTL A;  2DVR A;  4UIX A;  4YYI A;  2DKW A;  4NS5 A;  5E3G A;  3P5O A;  5CZG A;  1N72 A;  4UIU A;  4IOO A;  5CQ6 A;  5CQ5 A;  5I83 A;  4TU4 A;  5DKD A;  2FSA A;  4XY8 A;  3Q2F A;  5CP5 A;  4BW1 A;  4XUA A;  4MR6 A;  5I1Q A;  4YBT A;  4QST A;  5L99 A;  5LVQ A;  5FH6 A;  5J0D A;  3AAD A;  5CQT A;  5ENG A;  5L96 A;  2DVS A;  4UYF A;  4MEP A;  2WP2 A;  4NRB A;  5C85 A;  5II1 A;  5CUE A;  4O75 A;  5KTW A;  4UIZ A;  5F61 A;  5EWV A;  2R0Y A;  4KV4 A;  5DX4 A;  5HRV A;  4LRG A;  5DY7 A;  5FG6 A;  3DWY A;  5E74 A;  4QUU A;  5ACY A;  5E3D A;  5A81 A;  4X2I A;  4LDF A;  4NYW A;  5F3A A;  5C7N A;  4DON A;  4CFL A;  4NYX A;  4O71 A;  3NXB A;  4MEQ A;  3Q2E A;  5ENB A;  4QBM A;  5A7C A;  4IR6 A;  5JI8 A;  4N4H A;  2LSP B;  4UIY A;  4YYK A;  5LJ0 A;  3LJW A;  2RFJ A;  4NUD A;  3UVX A;  5HM0 A;  4NXJ A;  2WP1 A;  5EA1 A;  5EPS A;  2E7O A;  2F6J A;  5D7X A;  5C87 A;  5I29 A;  4CUP A;  4A9M A;  5F63 A;  4YY4 A;  3JVK A;  4N3W A;  5E73 A;  4QR4 A;  5I89 A;  2YEL A;  5HEN A;  4XYA A;  3P1C A;  5EI4 A;  3O33 A;  5BT4 A;  1EQF A;  4O78 A;  5DW2 A;  4WHW A;  4Z1S A;  4TT4 A;  5CQ4 A;  4A9E A;  4XUB A;  3QZT A;  4A9I A;  4YH3 A;  5EVA A;  5G4S A;  5FFV A;  4WIV A;  4HBY A;  4O7A A;  4UYF B;  5CQ7 A;  5CUG A;  4A9F A;  3S91 A;  2YDW A;  2I7K A;  3MUK A;  4YK0 A;  5A5N A;  5DYA A;  5HQ5 A;  5L98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...