5FFYA

Crystal structure of the bromodomain of human brpf1 in complex with a benzimidazole ligand
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
QLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Peregrin
publication title Crystal structure of the bromodomain of human BRPF1 in complex with a benzimidazole ligand
rcsb
source organism Homo sapiens
total genus 39
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2015-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ffyA00
4NYVA 5D3RA 4LDFA 3O35A 4LYWA 3Q2EA 5IIDA 5KTXA 5DLXA 4PKLA 2I7KA 2N9GA 5FH6A 5II1A 5HQ6A 3IU6A 4MEOA 5FG5A 5HM0A 5EICA 5HJCA 5FE0A 4MEPA 4NYWA 5CRMA 5A5QA 4QSQA 4WIVA 4ALHA 5EQ1A 4QEUA 5EWHA 3GG3A 4Z1QA 5G4SA 2NXBA 2DWWA 4TS8A 5E9VA 4O7BA 4A9JA 5H1TA 5EP7A 4YBTA 4IR4A 4J0RA 4O74A 5EWWA 2OUOA 4KV4A 3UV5A 5F60A 5DYXA 1ZS5A 4UYFA 4O78A 5H1UA 4IR3A 3UVDA 4LYIA 4LZSA 4DONA 3DWYA 4QUTA 1WUGA 3S91A 4MEQA 5CRZA 5D3HA 3P1DA 4LR6A 2F6JA 5E9IA 1F68A 4YY4A 5AD2A 4UIWA 5DYAA 2YELA 4QSRA 5LJ1A 5J0DA 4WHWA 5IGMA 2YEMA 4IORA 4XY9A 4NYXA 3LXJA 5DFCA 5HLSA 2F6NA 4N4HA 5FBXA 4UIVA 5I88A 2DATA 4LRGA 2DVQA 4YADA 5D3JA 5A5OA 4X2IA 2L84A 4O7CA 5L96A 5H85A 3TLPA 2MJVB 4A9FA 5FFYA 3U5LA 4QSVA 4Y03A 5CQ7A 5KTUA 4CUQA 4QYDA 5LUUA 3P1CA 3DAIA 5D25A 4KCXA 4HXSA 4XYAA 5D0CA 3SVGA 3LQJA 5CUDA 3AADA 3Q2FA 2YQDA 5ENJA 4YYHA 5HRWA 5EPSA 4IOQA 3JVMA 2E3KA 2G4AA 4PY6A 5FH8A 4N3WA 4O72A 4A9MA 4O7AA 2RNYA 4CFKA 3QZSA 4HXPA 4IR6A 4YH4A 5CTLA 4QZSA 5FE9A 4LYSA 2RO1A 2OSSA 4HXNA 5HELA 5EVAA 5CZGA 5HEMA 5DY7A 4QEVA 5L8UA 5FFVA 4HBVA 4QSWA 5D26A 5C89A 5IG6A 3IU5A 5EI4A 4A9LA 4Z6HA 2RNWA 2L85A 5F63A 5TB6A 5HFQA 5F3AA 5LJ2A 5D3NA 5CQ3A 3P5OA 3QZTA 4YYMA 4QC1A 2YYNA 3LQIA 4O7EA 4A9OA 1JSPB 2RS9B 4A9KA 5AMFA 4YAXA 5KU3A 5FE3A 4N4IA 4QSXA 5KO4A 5KTWA 5C7NA 4BW3A 5CFWA 5FE1A 3MB3A 5D3PA 4QB3A 4N4GA 5FH7A 5EPRA 5LKTA 4TT6A 4QEWA 4TT4A 4ALGA 5IGKA 4NRBA 4IOOA 4PCEA 5HFRA 5CGPA 4HXKA 5FE6A 5E3DA 4QSUA 2WP2A 5A5NA 2GRCA 5FE4A 3HMEA 4O7FA 4J3IA 5FFWA 1WUMA 5IGNA 4PS5A 5DKCA 3U5JA 5F62A 4YK0A 4ZQLA 2RFJA 5HENA 4O71A 4AKNA 4YYDA 5EV9A 5BT3A 5CQAA 3JVKA 4PTBA 4KV1A 2R0VA 2D9EA 4NUDA 5CQTA 2RNXA 4CL9A 2YEKA 5G4RA 4TTEA 5LKXA 5FE8A 4F3IA 5ENGA 3JVLA 3UVYA 3K2JA 4NQNA 4TYLA 5CS8A 4A9NA 5FE5A 4C67A 4YYGA 4CUUA 1JM4B 4MR5A 5A82A 4BW2A 5LKZA 5E73A 5ENCA 5K29A 5LVRA 5I7YA 5A81A 5ETBA 3QZVA 3JVJA 5E9LA 5CQ6A 5CU8A 4XUAA 4YC9A 4TU4A 5ENEA 4Z93A 4UYHA 4LC2A 5CQ5A 5EGUA 2L5EA 2R10A 4UYEA 4NR7A 5L97A 5CP5A 4OGIA 3UVXA 4QYLA 5FB1A 5E74A 4HXRA 5DW2A 3UW9A 3HMFA 3O37A 5DYUA 5LKUA 5DYCA 2YDWA 5CUGA 5ENFA 5AD3A 2OO1A 5HRXA 5A5RA 3UV2A 5HQ7A 5FB0A 4BW1A 4IR5A 5CQ4A 2LSPB 5HCLA 3ONIA 4UYGA 4YABA 4YH3A 5BT5A 5F1HA 4Z1SA 3U5PA 4ZW1A 4BJXA 5A83A 5DFDA 3HMHA 5D7XA 4NUCA 3P1EA 5D3TA 2DKWA 5I86A 1X0JA 5ACYA 5C85A 4CURA 4QSSA 1E6IA 5EU1A 4YYJA 2I8NA 5EWVA 5FDZA 4YBSA 4NQMA 5ENHA 3LJWA 4YYNA 3P1FA 4RVRA 4TZ2A 4MENA 4CUTA 4TZ8A 3MQMA 5CUEA 5I80A 1EQFA 4QNSA 5A5PA 4XY8A 4HXMA 5AMEA 3ZYUA 4GPJA 4CFLA 5EPBA 2DVSA 4XUBA 4A9IA 3UVWA 3MB4A 5I89A 5EK9A 3SVHA 4YY6A 4MR4A 3MUKA 4A9HA 3G0LA 4YBMA 3UV4A 5EWDA 5DLZA 3O33A 4PCIA 3LQHA 5FG6A 4QC3A 4O77A 5IGLA 5JI8A 5ENIA 5C87A 3AQAA 5LVQA 1N72A 5A85A 3MXFA 4C66A 4CUPA 4QR5A 3U5MA 4HBXA 5KHMA 4OGJA 5CUCA 4LZRA 5FG4A 4NRCA 4NR4A 3RCWA 3U5NA 4NS5A 5TCMA 4UIUA 4UIZA 4QY4A 4YATA 4NR9A 4UIYA 3SVFA 5D3LA 5FE2A 4QBMA 5E9KA 5C4QA 4BHWA 5E0RA 3U5KA 5DFBA 4YYIA 2E7NA 4OUFA 5HRVA 2KTBB 4FLPA 5DKHA 4J1PA 5DBMA 4NRAA 5F2PA 4QR3A 2FSAA 5F36A 4HXLA 5F1LA 5E9YA 5I40A 5BT4A 4QR4A 3S92A 4CLBA 4CUSA 5DKDA 3O34A 4J0SA 2R0YA 3I3JA 4O70A 3MULA 5EISA 2YW5A 4BW4A 3NXBA 5L98A 4MR6A 4E96A 5FE7A 5LJ0A 4QSPA 5COIA 5ENBA 5EM3A 5IBNA 3G0JA 4NR8A 2DVRA 5CUBA 5CUAA 5L8TA 5DX4A 2RI7A 4NXJA 5E7DA 4ZC9A 4UYFB 5EWCA 5A7CA 5I1QA 4HBYA 4Q0OA 4A9EA 2WP1A 4HXOA 5HQ5A 5C8GA 4UITA 5L99A 5I83A 4NR6A 4QSTA 4UYDA 5CQ8A 5ETDA 5CY9A 5F61A 5II2A 3O36A 4MR3A 3U5OA 4NUEA 4N4FA 5I29A 2H60A 4TU6A 4Q0NA 5CPEA 4Z6IA 4YYKA 5A5SA 4TQNA 2R0SA 5F5ZA 3FKMX 5EA1A 5I7XA 4O75A 5E9MA 4QUUA 4O76A 5F25A 2D82A 5DW1A 4NR5A 4TT2A 5D24A 5JWMA 4WHUA 5E3GA 5H1VA 2DVVA 2E7OA 5D3SA 3D7CA 4UIXA 4LZ2A 4HBWA
chains in the Genus database with same CATH superfamily
4NYVA 5D3RA 4AI6A 4LDFA 3O35A 4LYWA 3Q2EA 5IIDA 4AKGA 5KTXA 5DLXA 4PKLA 2I7KA 2N9GA 5FH6A 5II1A 5HQ6A 3IU6A 4MEOA 5FG5A 5HM0A 5EICA 5HJCA 5FE0A 4MEPA 4NYWA 5CRMA 5A5QA 4QSQA 4WIVA 4ALHA 5EQ1A 4QEUA 5EWHA 3GG3A 4Z1QA 5G4SA 2NXBA 2DWWA 4TS8A 5E9VA 4O7BA 4A9JA 5H1TA 5EP7A 4YBTA 4IR4A 4J0RA 4O74A 5EWWA 2OUOA 4KV4A 3UV5A 5F60A 5DYXA 1ZS5A 4UYFA 4O78A 5H1UA 4IR3A 3UVDA 4LYIA 4LZSA 4DONA 3DWYA 4QUTA 1WUGA 3S91A 4MEQA 5CRZA 5D3HA 3P1DA 4LR6A 2F6JA 5E9IA 1F68A 4YY4A 5AD2A 4UIWA 5DYAA 2YELA 4QSRA 5LJ1A 5J0DA 4WHWA 5IGMA 2YEMA 4IORA 4XY9A 4NYXA 3LXJA 5DFCA 5HLSA 2F6NA 4N4HA 5FBXA 4UIVA 5I88A 2DATA 4LRGA 2DVQA 4YADA 5D3JA 5A5OA 3D1DA 4X2IA 2L84A 4O7CA 5L96A 5H85A 3TLPA 2MJVB 4A9FA 5FFYA 3U5LA 4QSVA 4Y03A 5CQ7A 5KTUA 4CUQA 4QYDA 5LUUA 3P1CA 1PUOA 3DAIA 5D25A 4KCXA 4HXSA 4XYAA 5D0CA 3SVGA 3VKHA 3LQJA 5CUDA 3AADA 3Q2FA 2YQDA 5ENJA 4YYHA 5HRWA 5EPSA 4IOQA 3JVMA 2E3KA 2G4AA 4PY6A 5FH8A 4N3WA 4O72A 3VKGA 1ZKRA 4A9MA 4O7AA 2RNYA 4CFKA 3QZSA 4HXPA 4IR6A 4YH4A 5CTLA 2EJNA 4QZSA 5FE9A 4LYSA 2RO1A 2OSSA 4HXNA 5HELA 5EVAA 5CZGA 5HEMA 5DY7A 4QEVA 5L8UA 5FFVA 4HBVA 4QSWA 5D26A 5C89A 5IG6A 3IU5A 5EI4A 4A9LA 4Z6HA 2RNWA 2L85A 5F63A 5TB6A 5HFQA 5F3AA 5LJ2A 5D3NA 5CQ3A 3P5OA 3QZTA 4YYMA 4QC1A 2YYNA 3LQIA 4O7EA 4A9OA 1JSPB 2RS9B 4A9KA 5AMFA 4YAXA 5KU3A 5FE3A 4N4IA 4QSXA 5KO4A 5KTWA 5C7NA 4BW3A 5CFWA 5FE1A 3MB3A 5D3PA 4QB3A 4N4GA 5FH7A 5EPRA 5LKTA 4TT6A 4QEWA 4TT4A 4ALGA 5IGKA 4NRBA 4IOOA 4PCEA 5HFRA 5CGPA 4HXKA 5FE6A 5E3DA 4QSUA 2WP2A 5A5NA 2GRCA 5FE4A 3HMEA 4O7FA 4J3IA 5FFWA 1WUMA 5IGNA 4PS5A 5DKCA 3U5JA 5F62A 4YK0A 4ZQLA 2RFJA 5HENA 4O71A 4AKNA 4YYDA 5EV9A 5BT3A 5CQAA 3JVKA 4PTBA 4KV1A 2R0VA 2D9EA 4NUDA 5CQTA 2RNXA 4CL9A 2YEKA 5G4RA 4TTEA 5LKXA 5FE8A 4F3IA 5ENGA 3JVLA 3UVYA 3K2JA 4NQNA 4TYLA 5CS8A 4A9NA 5FE5A 4C67A 4YYGA 4CUUA 1JM4B 4MR5A 5A82A 4BW2A 5LKZA 5E73A 5ENCA 5K29A 5LVRA 5I7YA 5A81A 5ETBA 3QZVA 3JVJA 5E9LA 5CQ6A 5CU8A 4XUAA 4YC9A 4TU4A 5ENEA 4Z93A 4UYHA 4LC2A 5CQ5A 5EGUA 2L5EA 2R10A 4UYEA 4NR7A 5L97A 5CP5A 4OGIA 3UVXA 4QYLA 5FB1A 5E74A 4HXRA 5DW2A 3UW9A 3HMFA 3O37A 5DYUA 5LKUA 5DYCA 2YDWA 5CUGA 5ENFA 5AD3A 2OO1A 5HRXA 5A5RA 3UV2A 5HQ7A 5FB0A 4BW1A 4IR5A 5CQ4A 2LSPB 5HCLA 3ONIA 4UYGA 4YABA 4YH3A 5BT5A 5F1HA 4Z1SA 3U5PA 4ZW1A 4BJXA 5A83A 5DFDA 3HMHA 5D7XA 4NUCA 3P1EA 5D3TA 2DKWA 5I86A 1X0JA 4AKIA 5ACYA 5C85A 4CURA 4QSSA 1E6IA 5EU1A 4YYJA 2I8NA 5EWVA 5FDZA 4YBSA 4NQMA 5ENHA 3LJWA 4YYNA 3P1FA 4RVRA 4TZ2A 4MENA 4CUTA 4TZ8A 3MQMA 5CUEA 5I80A 1EQFA 4QNSA 5A5PA 4XY8A 4HXMA 5AMEA 3ZYUA 4GPJA 4CFLA 5EPBA 2DVSA 4XUBA 4A9IA 3UVWA 3MB4A 5I89A 5EK9A 3SVHA 4YY6A 4MR4A 3MUKA 4A9HA 3G0LA 4YBMA 3UV4A 5EWDA 5DLZA 3O33A 4PCIA 3LQHA 5FG6A 4QC3A 4O77A 4AKHA 5IGLA 5JI8A 5ENIA 5C87A 3AQAA 5LVQA 1N72A 5A85A 3ERRA 3MXFA 4C66A 4CUPA 4QR5A 3U5MA 4HBXA 5KHMA 4OGJA 5CUCA 4LZRA 5FG4A 4NRCA 4NR4A 3RCWA 3U5NA 4NS5A 5TCMA 4UIUA 4UIZA 4QY4A 4YATA 4NR9A 4UIYA 3SVFA 5D3LA 5FE2A 4QBMA 5E9KA 5C4QA 4BHWA 5E0RA 3U5KA 5DFBA 4YYIA 2E7NA 4OUFA 5HRVA 2KTBB 4FLPA 5DKHA 4J1PA 5DBMA 4NRAA 5F2PA 4QR3A 2FSAA 5F36A 4HXLA 5F1LA 5E9YA 5I40A 5BT4A 4QR4A 3S92A 4CLBA 4CUSA 5DKDA 3O34A 4J0SA 2R0YA 3I3JA 4O70A 3MULA 5EISA 2YW5A 4BW4A 3NXBA 5L98A 4MR6A 4E96A 5FE7A 5LJ0A 4QSPA 5COIA 5ENBA 5EM3A 5IBNA 3G0JA 3D1BA 4NR8A 2DVRA 5CUBA 5CUAA 5L8TA 5DX4A 2RI7A 4NXJA 5E7DA 4ZC9A 4UYFB 5EWCA 5A7CA 5I1QA 4HBYA 4Q0OA 4A9EA 2WP1A 4HXOA 5HQ5A 5C8GA 4UITA 5L99A 5I83A 4NR6A 4QSTA 4UYDA 5CQ8A 5ETDA 5CY9A 5F61A 5II2A 3O36A 4MR3A 3U5OA 4NUEA 4N4FA 5I29A 2H60A 4TU6A 4Q0NA 5CPEA 4Z6IA 4YYKA 5A5SA 4TQNA 2R0SA 5F5ZA 3FKMX 5EA1A 5I7XA 4O75A 5E9MA 4QUUA 4O76A 5F25A 2D82A 5DW1A 4NR5A 4TT2A 5D24A 5JWMA 4WHUA 5E3GA 5H1VA 2DVVA 2E7OA 5D3SA 3D7CA 4UIXA 4LZ2A 4HBWA
chains in the Genus database with same CATH topology
4NYVA 5D3RA 4LDFA 3O35A 4LYWA 3Q2EA 5IIDA 5KTXA 5DLXA 4PKLA 2I7KA 2N9GA 5FH6A 5II1A 5HQ6A 3IU6A 4MEOA 5FG5A 5HM0A 5EICA 5HJCA 5FE0A 4MEPA 4NYWA 5CRMA 5A5QA 4QSQA 4WIVA 4ALHA 5EQ1A 4QEUA 5EWHA 3GG3A 4Z1QA 5G4SA 2NXBA 2DWWA 4TS8A 5E9VA 4O7BA 4A9JA 5H1TA 5EP7A 4YBTA 4IR4A 4J0RA 4O74A 5EWWA 2OUOA 4KV4A 3UV5A 5F60A 5DYXA 1ZS5A 4UYFA 4O78A 5H1UA 4IR3A 3UVDA 4LYIA 4LZSA 4DONA 3DWYA 4QUTA 1WUGA 3S91A 4MEQA 5CRZA 5D3HA 3P1DA 4LR6A 2F6JA 5E9IA 1F68A 4YY4A 5AD2A 4UIWA 5DYAA 2YELA 4QSRA 5LJ1A 5J0DA 4WHWA 5IGMA 2YEMA 4IORA 4XY9A 4NYXA 3LXJA 5DFCA 5HLSA 2F6NA 4N4HA 5FBXA 4UIVA 5I88A 2DATA 4LRGA 2DVQA 4YADA 5D3JA 5A5OA 4X2IA 2L84A 4O7CA 5L96A 5H85A 3TLPA 2MJVB 4A9FA 5FFYA 3U5LA 4QSVA 4Y03A 5CQ7A 5KTUA 4CUQA 4QYDA 5LUUA 3P1CA 3DAIA 5D25A 4KCXA 4HXSA 4XYAA 5D0CA 3SVGA 3LQJA 5CUDA 3AADA 3Q2FA 2YQDA 5ENJA 4YYHA 5HRWA 5EPSA 4IOQA 3JVMA 2E3KA 2G4AA 4PY6A 5FH8A 4N3WA 4O72A 4A9MA 4O7AA 2RNYA 4CFKA 3QZSA 4HXPA 4IR6A 4YH4A 5CTLA 4QZSA 5FE9A 4LYSA 2RO1A 2OSSA 4HXNA 5HELA 5EVAA 5CZGA 5HEMA 5DY7A 4QEVA 5L8UA 5FFVA 4HBVA 4QSWA 5D26A 5C89A 5IG6A 3IU5A 5EI4A 4A9LA 4Z6HA 2RNWA 2L85A 5F63A 5TB6A 5HFQA 5F3AA 5LJ2A 5D3NA 5CQ3A 3P5OA 3QZTA 4YYMA 4QC1A 2YYNA 3LQIA 4O7EA 4A9OA 1JSPB 2RS9B 4A9KA 5AMFA 4YAXA 5KU3A 5FE3A 4N4IA 4QSXA 5KO4A 5KTWA 5C7NA 4BW3A 5CFWA 5FE1A 3MB3A 5D3PA 4QB3A 4N4GA 5FH7A 5EPRA 5LKTA 4TT6A 4QEWA 4TT4A 4ALGA 5IGKA 4NRBA 4IOOA 4PCEA 5HFRA 5CGPA 4HXKA 5FE6A 5E3DA 4QSUA 2WP2A 5A5NA 2GRCA 5FE4A 3HMEA 4O7FA 4J3IA 5FFWA 1WUMA 5IGNA 4PS5A 5DKCA 3U5JA 5F62A 4YK0A 4ZQLA 2RFJA 5HENA 4O71A 4AKNA 4YYDA 5EV9A 5BT3A 5CQAA 3JVKA 4PTBA 4KV1A 2R0VA 2D9EA 4NUDA 5CQTA 2RNXA 4CL9A 2YEKA 5G4RA 4TTEA 5LKXA 5FE8A 4F3IA 5ENGA 3JVLA 3UVYA 3K2JA 4NQNA 4TYLA 5CS8A 4A9NA 5FE5A 4C67A 4YYGA 4CUUA 1JM4B 4MR5A 5A82A 4BW2A 5LKZA 5E73A 5ENCA 5K29A 5LVRA 5I7YA 5A81A 5ETBA 3QZVA 3JVJA 5E9LA 5CQ6A 5CU8A 4XUAA 4YC9A 4TU4A 5ENEA 4Z93A 4UYHA 4LC2A 5CQ5A 5EGUA 2L5EA 2R10A 4UYEA 4NR7A 5L97A 5CP5A 4OGIA 3UVXA 4QYLA 5FB1A 5E74A 4HXRA 5DW2A 3UW9A 3HMFA 3O37A 5DYUA 5LKUA 5DYCA 2YDWA 5CUGA 5ENFA 5AD3A 2OO1A 5HRXA 5A5RA 3UV2A 5HQ7A 5FB0A 4BW1A 4IR5A 5CQ4A 2LSPB 5HCLA 3ONIA 4UYGA 4YABA 4YH3A 5BT5A 5F1HA 4Z1SA 3U5PA 4ZW1A 4BJXA 5A83A 5DFDA 3HMHA 5D7XA 4NUCA 3P1EA 5D3TA 2DKWA 5I86A 1X0JA 5ACYA 5C85A 4CURA 4QSSA 1E6IA 5EU1A 4YYJA 2I8NA 5EWVA 5FDZA 4YBSA 4NQMA 5ENHA 3LJWA 4YYNA 3P1FA 4RVRA 4TZ2A 4MENA 4CUTA 4TZ8A 3MQMA 5CUEA 5I80A 1EQFA 4QNSA 5A5PA 4XY8A 4HXMA 5AMEA 3ZYUA 4GPJA 4CFLA 5EPBA 2DVSA 4XUBA 4A9IA 3UVWA 3MB4A 5I89A 5EK9A 3SVHA 4YY6A 4MR4A 3MUKA 4A9HA 3G0LA 4YBMA 3UV4A 5EWDA 5DLZA 3O33A 4PCIA 3LQHA 5FG6A 4QC3A 4O77A 5IGLA 5JI8A 5ENIA 5C87A 3AQAA 5LVQA 1N72A 5A85A 3MXFA 4C66A 4CUPA 4QR5A 3U5MA 4HBXA 5KHMA 4OGJA 5CUCA 4LZRA 5FG4A 4NRCA 4NR4A 3RCWA 3U5NA 4NS5A 5TCMA 4UIUA 4UIZA 4QY4A 4YATA 4NR9A 4UIYA 3SVFA 5D3LA 5FE2A 4QBMA 5E9KA 5C4QA 4BHWA 5E0RA 3U5KA 5DFBA 4YYIA 2E7NA 4OUFA 5HRVA 2KTBB 4FLPA 5DKHA 4J1PA 5DBMA 4NRAA 5F2PA 4QR3A 2FSAA 5F36A 4HXLA 5F1LA 5E9YA 5I40A 5BT4A 4QR4A 3S92A 4CLBA 4CUSA 5DKDA 3O34A 4J0SA 2R0YA 3I3JA 4O70A 3MULA 5EISA 2YW5A 4BW4A 3NXBA 5L98A 4MR6A 4E96A 5FE7A 5LJ0A 4QSPA 5COIA 5ENBA 5EM3A 5IBNA 3G0JA 4NR8A 2DVRA 5CUBA 5CUAA 5L8TA 5DX4A 2RI7A 4NXJA 5E7DA 4ZC9A 4UYFB 5EWCA 5A7CA 5I1QA 4HBYA 4Q0OA 4A9EA 2WP1A 4HXOA 5HQ5A 5C8GA 4UITA 5L99A 5I83A 4NR6A 4QSTA 4UYDA 5CQ8A 5ETDA 5CY9A 5F61A 5II2A 3O36A 4MR3A 3U5OA 4NUEA 4N4FA 5I29A 2H60A 4TU6A 4Q0NA 5CPEA 4Z6IA 4YYKA 5A5SA 4TQNA 2R0SA 5F5ZA 3FKMX 5EA1A 5I7XA 4O75A 5E9MA 4QUUA 4O76A 5F25A 2D82A 5DW1A 4NR5A 4TT2A 5D24A 5JWMA 4WHUA 5E3GA 5H1VA 2DVVA 2E7OA 5D3SA 3D7CA 4UIXA 4LZ2A 4HBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NYV A;  5D3R A;  4LDF A;  3O35 A;  4LYW A;  3Q2E A;  5IID A;  5KTX A;  5DLX A;  4PKL A;  2I7K A;  2N9G A;  5FH6 A;  5II1 A;  5HQ6 A;  3IU6 A;  4MEO A;  5FG5 A;  5HM0 A;  5EIC A;  5HJC A;  5FE0 A;  4MEP A;  4NYW A;  5CRM A;  5A5Q A;  4QSQ A;  4WIV A;  4ALH A;  5EQ1 A;  4QEU A;  5EWH A;  3GG3 A;  4Z1Q A;  5G4S A;  2NXB A;  2DWW A;  4TS8 A;  5E9V A;  4O7B A;  4A9J A;  5H1T A;  5EP7 A;  4YBT A;  4IR4 A;  4J0R A;  4O74 A;  5EWW A;  2OUO A;  4KV4 A;  3UV5 A;  5F60 A;  5DYX A;  1ZS5 A;  4UYF A;  4O78 A;  5H1U A;  4IR3 A;  3UVD A;  4LYI A;  4LZS A;  4DON A;  3DWY A;  4QUT A;  1WUG A;  3S91 A;  4MEQ A;  5CRZ A;  5D3H A;  3P1D A;  4LR6 A;  2F6J A;  5E9I A;  1F68 A;  4YY4 A;  5AD2 A;  4UIW A;  5DYA A;  2YEL A;  4QSR A;  5LJ1 A;  5J0D A;  4WHW A;  5IGM A;  2YEM A;  4IOR A;  4XY9 A;  4NYX A;  3LXJ A;  5DFC A;  5HLS A;  2F6N A;  4N4H A;  5FBX A;  4UIV A;  5I88 A;  2DAT A;  4LRG A;  2DVQ A;  4YAD A;  5D3J A;  5A5O A;  4X2I A;  2L84 A;  4O7C A;  5L96 A;  5H85 A;  3TLP A;  2MJV B;  4A9F A;  5FFY A;  3U5L A;  4QSV A;  4Y03 A;  5CQ7 A;  5KTU A;  4CUQ A;  4QYD A;  5LUU A;  3P1C A;  3DAI A;  5D25 A;  4KCX A;  4HXS A;  4XYA A;  5D0C A;  3SVG A;  3LQJ A;  5CUD A;  3AAD A;  3Q2F A;  2YQD A;  5ENJ A;  4YYH A;  5HRW A;  5EPS A;  4IOQ A;  3JVM A;  2E3K A;  2G4A A;  4PY6 A;  5FH8 A;  4N3W A;  4O72 A;  4A9M A;  4O7A A;  2RNY A;  4CFK A;  3QZS A;  4HXP A;  4IR6 A;  4YH4 A;  5CTL A;  4QZS A;  5FE9 A;  4LYS A;  2RO1 A;  2OSS A;  4HXN A;  5HEL A;  5EVA A;  5CZG A;  5HEM A;  5DY7 A;  4QEV A;  5L8U A;  5FFV A;  4HBV A;  4QSW A;  5D26 A;  5C89 A;  5IG6 A;  3IU5 A;  5EI4 A;  4A9L A;  4Z6H A;  2RNW A;  2L85 A;  5F63 A;  5TB6 A;  5HFQ A;  5F3A A;  5LJ2 A;  5D3N A;  5CQ3 A;  3P5O A;  3QZT A;  4YYM A;  4QC1 A;  2YYN A;  3LQI A;  4O7E A;  4A9O A;  1JSP B;  2RS9 B;  4A9K A;  5AMF A;  4YAX A;  5KU3 A;  5FE3 A;  4N4I A;  4QSX A;  5KO4 A;  5KTW A;  5C7N A;  4BW3 A;  5CFW A;  5FE1 A;  3MB3 A;  5D3P A;  4QB3 A;  4N4G A;  5FH7 A;  5EPR A;  5LKT A;  4TT6 A;  4QEW A;  4TT4 A;  4ALG A;  5IGK A;  4NRB A;  4IOO A;  4PCE A;  5HFR A;  5CGP A;  4HXK A;  5FE6 A;  5E3D A;  4QSU A;  2WP2 A;  5A5N A;  2GRC A;  5FE4 A;  3HME A;  4O7F A;  4J3I A;  5FFW A;  1WUM A;  5IGN A;  4PS5 A;  5DKC A;  3U5J A;  5F62 A;  4YK0 A;  4ZQL A;  2RFJ A;  5HEN A;  4O71 A;  4AKN A;  4YYD A;  5EV9 A;  5BT3 A;  5CQA A;  3JVK A;  4PTB A;  4KV1 A;  2R0V A;  2D9E A;  4NUD A;  5CQT A;  2RNX A;  4CL9 A;  2YEK A;  5G4R A;  4TTE A;  5LKX A;  5FE8 A;  4F3I A;  5ENG A;  3JVL A;  3UVY A;  3K2J A;  4NQN A;  4TYL A;  5CS8 A;  4A9N A;  5FE5 A;  4C67 A;  4YYG A;  4CUU A;  1JM4 B;  4MR5 A;  5A82 A;  4BW2 A;  5LKZ A;  5E73 A;  5ENC A;  5K29 A;  5LVR A;  5I7Y A;  5A81 A;  5ETB A;  3QZV A;  3JVJ A;  5E9L A;  5CQ6 A;  5CU8 A;  4XUA A;  4YC9 A;  4TU4 A;  5ENE A;  4Z93 A;  4UYH A;  4LC2 A;  5CQ5 A;  5EGU A;  2L5E A;  2R10 A;  4UYE A;  4NR7 A;  5L97 A;  5CP5 A;  4OGI A;  3UVX A;  4QYL A;  5FB1 A;  5E74 A;  4HXR A;  5DW2 A;  3UW9 A;  3HMF A;  3O37 A;  5DYU A;  5LKU A;  5DYC A;  2YDW A;  5CUG A;  5ENF A;  5AD3 A;  2OO1 A;  5HRX A;  5A5R A;  3UV2 A;  5HQ7 A;  5FB0 A;  4BW1 A;  4IR5 A;  5CQ4 A;  2LSP B;  5HCL A;  3ONI A;  4UYG A;  4YAB A;  4YH3 A;  5BT5 A;  5F1H A;  4Z1S A;  3U5P A;  4ZW1 A;  4BJX A;  5A83 A;  5DFD A;  3HMH A;  5D7X A;  4NUC A;  3P1E A;  5D3T A;  2DKW A;  5I86 A;  1X0J A;  5ACY A;  5C85 A;  4CUR A;  4QSS A;  1E6I A;  5EU1 A;  4YYJ A;  2I8N A;  5EWV A;  5FDZ A;  4YBS A;  4NQM A;  5ENH A;  3LJW A;  4YYN A;  3P1F A;  4RVR A;  4TZ2 A;  4MEN A;  4CUT A;  4TZ8 A;  3MQM A;  5CUE A;  5I80 A;  1EQF A;  4QNS A;  5A5P A;  4XY8 A;  4HXM A;  5AME A;  3ZYU A;  4GPJ A;  4CFL A;  5EPB A;  2DVS A;  4XUB A;  4A9I A;  3UVW A;  3MB4 A;  5I89 A;  5EK9 A;  3SVH A;  4YY6 A;  4MR4 A;  3MUK A;  4A9H A;  3G0L A;  4YBM A;  3UV4 A;  5EWD A;  5DLZ A;  3O33 A;  4PCI A;  3LQH A;  5FG6 A;  4QC3 A;  4O77 A;  5IGL A;  5JI8 A;  5ENI A;  5C87 A;  3AQA A;  5LVQ A;  1N72 A;  5A85 A;  3MXF A;  4C66 A;  4CUP A;  4QR5 A;  3U5M A;  4HBX A;  5KHM A;  4OGJ A;  5CUC A;  4LZR A;  5FG4 A;  4NRC A;  4NR4 A;  3RCW A;  3U5N A;  4NS5 A;  5TCM A;  4UIU A;  4UIZ A;  4QY4 A;  4YAT A;  4NR9 A;  4UIY A;  3SVF A;  5D3L A;  5FE2 A;  4QBM A;  5E9K A;  5C4Q A;  4BHW A;  5E0R A;  3U5K A;  5DFB A;  4YYI A;  2E7N A;  4OUF A;  5HRV A;  2KTB B;  4FLP A;  5DKH A;  4J1P A;  5DBM A;  4NRA A;  5F2P A;  4QR3 A;  2FSA A;  5F36 A;  4HXL A;  5F1L A;  5E9Y A;  5I40 A;  5BT4 A;  4QR4 A;  3S92 A;  4CLB A;  4CUS A;  5DKD A;  3O34 A;  4J0S A;  2R0Y A;  3I3J A;  4O70 A;  3MUL A;  5EIS A;  2YW5 A;  4BW4 A;  3NXB A;  5L98 A;  4MR6 A;  4E96 A;  5FE7 A;  5LJ0 A;  4QSP A;  5COI A;  5ENB A;  5EM3 A;  5IBN A;  3G0J A;  4NR8 A;  2DVR A;  5CUB A;  5CUA A;  5L8T A;  5DX4 A;  2RI7 A;  4NXJ A;  5E7D A;  4ZC9 A;  4UYF B;  5EWC A;  5A7C A;  5I1Q A;  4HBY A;  4Q0O A;  4A9E A;  2WP1 A;  4HXO A;  5HQ5 A;  5C8G A;  4UIT A;  5L99 A;  5I83 A;  4NR6 A;  4QST A;  4UYD A;  5CQ8 A;  5ETD A;  5CY9 A;  5F61 A;  5II2 A;  3O36 A;  4MR3 A;  3U5O A;  4NUE A;  4N4F A;  5I29 A;  2H60 A;  4TU6 A;  4Q0N A;  5CPE A;  4Z6I A;  4YYK A;  5A5S A;  4TQN A;  2R0S A;  5F5Z A;  3FKM X;  5EA1 A;  5I7X A;  4O75 A;  5E9M A;  4QUU A;  4O76 A;  5F25 A;  2D82 A;  5DW1 A;  4NR5 A;  4TT2 A;  5D24 A;  5JWM A;  4WHU A;  5E3G A;  5H1V A;  2DVV A;  2E7O A;  5D3S A;  3D7C A;  4UIX A;  4LZ2 A;  4HBW A; 
#chains in the Genus database with same CATH topology
 4NYV A;  5D3R A;  4AI6 A;  4LDF A;  3O35 A;  4LYW A;  3Q2E A;  5IID A;  4AKG A;  5KTX A;  5DLX A;  4PKL A;  2I7K A;  2N9G A;  5FH6 A;  5II1 A;  5HQ6 A;  3IU6 A;  4MEO A;  5FG5 A;  5HM0 A;  5EIC A;  5HJC A;  5FE0 A;  4MEP A;  4NYW A;  5CRM A;  5A5Q A;  4QSQ A;  4WIV A;  4ALH A;  5EQ1 A;  4QEU A;  5EWH A;  3GG3 A;  4Z1Q A;  5G4S A;  2NXB A;  2DWW A;  4TS8 A;  5E9V A;  4O7B A;  4A9J A;  5H1T A;  5EP7 A;  4YBT A;  4IR4 A;  4J0R A;  4O74 A;  5EWW A;  2OUO A;  4KV4 A;  3UV5 A;  5F60 A;  5DYX A;  1ZS5 A;  4UYF A;  4O78 A;  5H1U A;  4IR3 A;  3UVD A;  4LYI A;  4LZS A;  4DON A;  3DWY A;  4QUT A;  1WUG A;  3S91 A;  4MEQ A;  5CRZ A;  5D3H A;  3P1D A;  4LR6 A;  2F6J A;  5E9I A;  1F68 A;  4YY4 A;  5AD2 A;  4UIW A;  5DYA A;  2YEL A;  4QSR A;  5LJ1 A;  5J0D A;  4WHW A;  5IGM A;  2YEM A;  4IOR A;  4XY9 A;  4NYX A;  3LXJ A;  5DFC A;  5HLS A;  2F6N A;  4N4H A;  5FBX A;  4UIV A;  5I88 A;  2DAT A;  4LRG A;  2DVQ A;  4YAD A;  5D3J A;  5A5O A;  3D1D A;  4X2I A;  2L84 A;  4O7C A;  5L96 A;  5H85 A;  3TLP A;  2MJV B;  4A9F A;  5FFY A;  3U5L A;  4QSV A;  4Y03 A;  5CQ7 A;  5KTU A;  4CUQ A;  4QYD A;  5LUU A;  3P1C A;  1PUO A;  3DAI A;  5D25 A;  4KCX A;  4HXS A;  4XYA A;  5D0C A;  3SVG A;  3VKH A;  3LQJ A;  5CUD A;  3AAD A;  3Q2F A;  2YQD A;  5ENJ A;  4YYH A;  5HRW A;  5EPS A;  4IOQ A;  3JVM A;  2E3K A;  2G4A A;  4PY6 A;  5FH8 A;  4N3W A;  4O72 A;  3VKG A;  1ZKR A;  4A9M A;  4O7A A;  2RNY A;  4CFK A;  3QZS A;  4HXP A;  4IR6 A;  4YH4 A;  5CTL A;  2EJN A;  4QZS A;  5FE9 A;  4LYS A;  2RO1 A;  2OSS A;  4HXN A;  5HEL A;  5EVA A;  5CZG A;  5HEM A;  5DY7 A;  4QEV A;  5L8U A;  5FFV A;  4HBV A;  4QSW A;  5D26 A;  5C89 A;  5IG6 A;  3IU5 A;  5EI4 A;  4A9L A;  4Z6H A;  2RNW A;  2L85 A;  5F63 A;  5TB6 A;  5HFQ A;  5F3A A;  5LJ2 A;  5D3N A;  5CQ3 A;  3P5O A;  3QZT A;  4YYM A;  4QC1 A;  2YYN A;  3LQI A;  4O7E A;  4A9O A;  1JSP B;  2RS9 B;  4A9K A;  5AMF A;  4YAX A;  5KU3 A;  5FE3 A;  4N4I A;  4QSX A;  5KO4 A;  5KTW A;  5C7N A;  4BW3 A;  5CFW A;  5FE1 A;  3MB3 A;  5D3P A;  4QB3 A;  4N4G A;  5FH7 A;  5EPR A;  5LKT A;  4TT6 A;  4QEW A;  4TT4 A;  4ALG A;  5IGK A;  4NRB A;  4IOO A;  4PCE A;  5HFR A;  5CGP A;  4HXK A;  5FE6 A;  5E3D A;  4QSU A;  2WP2 A;  5A5N A;  2GRC A;  5FE4 A;  3HME A;  4O7F A;  4J3I A;  5FFW A;  1WUM A;  5IGN A;  4PS5 A;  5DKC A;  3U5J A;  5F62 A;  4YK0 A;  4ZQL A;  2RFJ A;  5HEN A;  4O71 A;  4AKN A;  4YYD A;  5EV9 A;  5BT3 A;  5CQA A;  3JVK A;  4PTB A;  4KV1 A;  2R0V A;  2D9E A;  4NUD A;  5CQT A;  2RNX A;  4CL9 A;  2YEK A;  5G4R A;  4TTE A;  5LKX A;  5FE8 A;  4F3I A;  5ENG A;  3JVL A;  3UVY A;  3K2J A;  4NQN A;  4TYL A;  5CS8 A;  4A9N A;  5FE5 A;  4C67 A;  4YYG A;  4CUU A;  1JM4 B;  4MR5 A;  5A82 A;  4BW2 A;  5LKZ A;  5E73 A;  5ENC A;  5K29 A;  5LVR A;  5I7Y A;  5A81 A;  5ETB A;  3QZV A;  3JVJ A;  5E9L A;  5CQ6 A;  5CU8 A;  4XUA A;  4YC9 A;  4TU4 A;  5ENE A;  4Z93 A;  4UYH A;  4LC2 A;  5CQ5 A;  5EGU A;  2L5E A;  2R10 A;  4UYE A;  4NR7 A;  5L97 A;  5CP5 A;  4OGI A;  3UVX A;  4QYL A;  5FB1 A;  5E74 A;  4HXR A;  5DW2 A;  3UW9 A;  3HMF A;  3O37 A;  5DYU A;  5LKU A;  5DYC A;  2YDW A;  5CUG A;  5ENF A;  5AD3 A;  2OO1 A;  5HRX A;  5A5R A;  3UV2 A;  5HQ7 A;  5FB0 A;  4BW1 A;  4IR5 A;  5CQ4 A;  2LSP B;  5HCL A;  3ONI A;  4UYG A;  4YAB A;  4YH3 A;  5BT5 A;  5F1H A;  4Z1S A;  3U5P A;  4ZW1 A;  4BJX A;  5A83 A;  5DFD A;  3HMH A;  5D7X A;  4NUC A;  3P1E A;  5D3T A;  2DKW A;  5I86 A;  1X0J A;  4AKI A;  5ACY A;  5C85 A;  4CUR A;  4QSS A;  1E6I A;  5EU1 A;  4YYJ A;  2I8N A;  5EWV A;  5FDZ A;  4YBS A;  4NQM A;  5ENH A;  3LJW A;  4YYN A;  3P1F A;  4RVR A;  4TZ2 A;  4MEN A;  4CUT A;  4TZ8 A;  3MQM A;  5CUE A;  5I80 A;  1EQF A;  4QNS A;  5A5P A;  4XY8 A;  4HXM A;  5AME A;  3ZYU A;  4GPJ A;  4CFL A;  5EPB A;  2DVS A;  4XUB A;  4A9I A;  3UVW A;  3MB4 A;  5I89 A;  5EK9 A;  3SVH A;  4YY6 A;  4MR4 A;  3MUK A;  4A9H A;  3G0L A;  4YBM A;  3UV4 A;  5EWD A;  5DLZ A;  3O33 A;  4PCI A;  3LQH A;  5FG6 A;  4QC3 A;  4O77 A;  4AKH A;  5IGL A;  5JI8 A;  5ENI A;  5C87 A;  3AQA A;  5LVQ A;  1N72 A;  5A85 A;  3ERR A;  3MXF A;  4C66 A;  4CUP A;  4QR5 A;  3U5M A;  4HBX A;  5KHM A;  4OGJ A;  5CUC A;  4LZR A;  5FG4 A;  4NRC A;  4NR4 A;  3RCW A;  3U5N A;  4NS5 A;  5TCM A;  4UIU A;  4UIZ A;  4QY4 A;  4YAT A;  4NR9 A;  4UIY A;  3SVF A;  5D3L A;  5FE2 A;  4QBM A;  5E9K A;  5C4Q A;  4BHW A;  5E0R A;  3U5K A;  5DFB A;  4YYI A;  2E7N A;  4OUF A;  5HRV A;  2KTB B;  4FLP A;  5DKH A;  4J1P A;  5DBM A;  4NRA A;  5F2P A;  4QR3 A;  2FSA A;  5F36 A;  4HXL A;  5F1L A;  5E9Y A;  5I40 A;  5BT4 A;  4QR4 A;  3S92 A;  4CLB A;  4CUS A;  5DKD A;  3O34 A;  4J0S A;  2R0Y A;  3I3J A;  4O70 A;  3MUL A;  5EIS A;  2YW5 A;  4BW4 A;  3NXB A;  5L98 A;  4MR6 A;  4E96 A;  5FE7 A;  5LJ0 A;  4QSP A;  5COI A;  5ENB A;  5EM3 A;  5IBN A;  3G0J A;  3D1B A;  4NR8 A;  2DVR A;  5CUB A;  5CUA A;  5L8T A;  5DX4 A;  2RI7 A;  4NXJ A;  5E7D A;  4ZC9 A;  4UYF B;  5EWC A;  5A7C A;  5I1Q A;  4HBY A;  4Q0O A;  4A9E A;  2WP1 A;  4HXO A;  5HQ5 A;  5C8G A;  4UIT A;  5L99 A;  5I83 A;  4NR6 A;  4QST A;  4UYD A;  5CQ8 A;  5ETD A;  5CY9 A;  5F61 A;  5II2 A;  3O36 A;  4MR3 A;  3U5O A;  4NUE A;  4N4F A;  5I29 A;  2H60 A;  4TU6 A;  4Q0N A;  5CPE A;  4Z6I A;  4YYK A;  5A5S A;  4TQN A;  2R0S A;  5F5Z A;  3FKM X;  5EA1 A;  5I7X A;  4O75 A;  5E9M A;  4QUU A;  4O76 A;  5F25 A;  2D82 A;  5DW1 A;  4NR5 A;  4TT2 A;  5D24 A;  5JWM A;  4WHU A;  5E3G A;  5H1V A;  2DVV A;  2E7O A;  5D3S A;  3D7C A;  4UIX A;  4LZ2 A;  4HBW A; 
#chains in the Genus database with same CATH homology
 4NYV A;  5D3R A;  4LDF A;  3O35 A;  4LYW A;  3Q2E A;  5IID A;  5KTX A;  5DLX A;  4PKL A;  2I7K A;  2N9G A;  5FH6 A;  5II1 A;  5HQ6 A;  3IU6 A;  4MEO A;  5FG5 A;  5HM0 A;  5EIC A;  5HJC A;  5FE0 A;  4MEP A;  4NYW A;  5CRM A;  5A5Q A;  4QSQ A;  4WIV A;  4ALH A;  5EQ1 A;  4QEU A;  5EWH A;  3GG3 A;  4Z1Q A;  5G4S A;  2NXB A;  2DWW A;  4TS8 A;  5E9V A;  4O7B A;  4A9J A;  5H1T A;  5EP7 A;  4YBT A;  4IR4 A;  4J0R A;  4O74 A;  5EWW A;  2OUO A;  4KV4 A;  3UV5 A;  5F60 A;  5DYX A;  1ZS5 A;  4UYF A;  4O78 A;  5H1U A;  4IR3 A;  3UVD A;  4LYI A;  4LZS A;  4DON A;  3DWY A;  4QUT A;  1WUG A;  3S91 A;  4MEQ A;  5CRZ A;  5D3H A;  3P1D A;  4LR6 A;  2F6J A;  5E9I A;  1F68 A;  4YY4 A;  5AD2 A;  4UIW A;  5DYA A;  2YEL A;  4QSR A;  5LJ1 A;  5J0D A;  4WHW A;  5IGM A;  2YEM A;  4IOR A;  4XY9 A;  4NYX A;  3LXJ A;  5DFC A;  5HLS A;  2F6N A;  4N4H A;  5FBX A;  4UIV A;  5I88 A;  2DAT A;  4LRG A;  2DVQ A;  4YAD A;  5D3J A;  5A5O A;  4X2I A;  2L84 A;  4O7C A;  5L96 A;  5H85 A;  3TLP A;  2MJV B;  4A9F A;  5FFY A;  3U5L A;  4QSV A;  4Y03 A;  5CQ7 A;  5KTU A;  4CUQ A;  4QYD A;  5LUU A;  3P1C A;  3DAI A;  5D25 A;  4KCX A;  4HXS A;  4XYA A;  5D0C A;  3SVG A;  3LQJ A;  5CUD A;  3AAD A;  3Q2F A;  2YQD A;  5ENJ A;  4YYH A;  5HRW A;  5EPS A;  4IOQ A;  3JVM A;  2E3K A;  2G4A A;  4PY6 A;  5FH8 A;  4N3W A;  4O72 A;  4A9M A;  4O7A A;  2RNY A;  4CFK A;  3QZS A;  4HXP A;  4IR6 A;  4YH4 A;  5CTL A;  4QZS A;  5FE9 A;  4LYS A;  2RO1 A;  2OSS A;  4HXN A;  5HEL A;  5EVA A;  5CZG A;  5HEM A;  5DY7 A;  4QEV A;  5L8U A;  5FFV A;  4HBV A;  4QSW A;  5D26 A;  5C89 A;  5IG6 A;  3IU5 A;  5EI4 A;  4A9L A;  4Z6H A;  2RNW A;  2L85 A;  5F63 A;  5TB6 A;  5HFQ A;  5F3A A;  5LJ2 A;  5D3N A;  5CQ3 A;  3P5O A;  3QZT A;  4YYM A;  4QC1 A;  2YYN A;  3LQI A;  4O7E A;  4A9O A;  1JSP B;  2RS9 B;  4A9K A;  5AMF A;  4YAX A;  5KU3 A;  5FE3 A;  4N4I A;  4QSX A;  5KO4 A;  5KTW A;  5C7N A;  4BW3 A;  5CFW A;  5FE1 A;  3MB3 A;  5D3P A;  4QB3 A;  4N4G A;  5FH7 A;  5EPR A;  5LKT A;  4TT6 A;  4QEW A;  4TT4 A;  4ALG A;  5IGK A;  4NRB A;  4IOO A;  4PCE A;  5HFR A;  5CGP A;  4HXK A;  5FE6 A;  5E3D A;  4QSU A;  2WP2 A;  5A5N A;  2GRC A;  5FE4 A;  3HME A;  4O7F A;  4J3I A;  5FFW A;  1WUM A;  5IGN A;  4PS5 A;  5DKC A;  3U5J A;  5F62 A;  4YK0 A;  4ZQL A;  2RFJ A;  5HEN A;  4O71 A;  4AKN A;  4YYD A;  5EV9 A;  5BT3 A;  5CQA A;  3JVK A;  4PTB A;  4KV1 A;  2R0V A;  2D9E A;  4NUD A;  5CQT A;  2RNX A;  4CL9 A;  2YEK A;  5G4R A;  4TTE A;  5LKX A;  5FE8 A;  4F3I A;  5ENG A;  3JVL A;  3UVY A;  3K2J A;  4NQN A;  4TYL A;  5CS8 A;  4A9N A;  5FE5 A;  4C67 A;  4YYG A;  4CUU A;  1JM4 B;  4MR5 A;  5A82 A;  4BW2 A;  5LKZ A;  5E73 A;  5ENC A;  5K29 A;  5LVR A;  5I7Y A;  5A81 A;  5ETB A;  3QZV A;  3JVJ A;  5E9L A;  5CQ6 A;  5CU8 A;  4XUA A;  4YC9 A;  4TU4 A;  5ENE A;  4Z93 A;  4UYH A;  4LC2 A;  5CQ5 A;  5EGU A;  2L5E A;  2R10 A;  4UYE A;  4NR7 A;  5L97 A;  5CP5 A;  4OGI A;  3UVX A;  4QYL A;  5FB1 A;  5E74 A;  4HXR A;  5DW2 A;  3UW9 A;  3HMF A;  3O37 A;  5DYU A;  5LKU A;  5DYC A;  2YDW A;  5CUG A;  5ENF A;  5AD3 A;  2OO1 A;  5HRX A;  5A5R A;  3UV2 A;  5HQ7 A;  5FB0 A;  4BW1 A;  4IR5 A;  5CQ4 A;  2LSP B;  5HCL A;  3ONI A;  4UYG A;  4YAB A;  4YH3 A;  5BT5 A;  5F1H A;  4Z1S A;  3U5P A;  4ZW1 A;  4BJX A;  5A83 A;  5DFD A;  3HMH A;  5D7X A;  4NUC A;  3P1E A;  5D3T A;  2DKW A;  5I86 A;  1X0J A;  5ACY A;  5C85 A;  4CUR A;  4QSS A;  1E6I A;  5EU1 A;  4YYJ A;  2I8N A;  5EWV A;  5FDZ A;  4YBS A;  4NQM A;  5ENH A;  3LJW A;  4YYN A;  3P1F A;  4RVR A;  4TZ2 A;  4MEN A;  4CUT A;  4TZ8 A;  3MQM A;  5CUE A;  5I80 A;  1EQF A;  4QNS A;  5A5P A;  4XY8 A;  4HXM A;  5AME A;  3ZYU A;  4GPJ A;  4CFL A;  5EPB A;  2DVS A;  4XUB A;  4A9I A;  3UVW A;  3MB4 A;  5I89 A;  5EK9 A;  3SVH A;  4YY6 A;  4MR4 A;  3MUK A;  4A9H A;  3G0L A;  4YBM A;  3UV4 A;  5EWD A;  5DLZ A;  3O33 A;  4PCI A;  3LQH A;  5FG6 A;  4QC3 A;  4O77 A;  5IGL A;  5JI8 A;  5ENI A;  5C87 A;  3AQA A;  5LVQ A;  1N72 A;  5A85 A;  3MXF A;  4C66 A;  4CUP A;  4QR5 A;  3U5M A;  4HBX A;  5KHM A;  4OGJ A;  5CUC A;  4LZR A;  5FG4 A;  4NRC A;  4NR4 A;  3RCW A;  3U5N A;  4NS5 A;  5TCM A;  4UIU A;  4UIZ A;  4QY4 A;  4YAT A;  4NR9 A;  4UIY A;  3SVF A;  5D3L A;  5FE2 A;  4QBM A;  5E9K A;  5C4Q A;  4BHW A;  5E0R A;  3U5K A;  5DFB A;  4YYI A;  2E7N A;  4OUF A;  5HRV A;  2KTB B;  4FLP A;  5DKH A;  4J1P A;  5DBM A;  4NRA A;  5F2P A;  4QR3 A;  2FSA A;  5F36 A;  4HXL A;  5F1L A;  5E9Y A;  5I40 A;  5BT4 A;  4QR4 A;  3S92 A;  4CLB A;  4CUS A;  5DKD A;  3O34 A;  4J0S A;  2R0Y A;  3I3J A;  4O70 A;  3MUL A;  5EIS A;  2YW5 A;  4BW4 A;  3NXB A;  5L98 A;  4MR6 A;  4E96 A;  5FE7 A;  5LJ0 A;  4QSP A;  5COI A;  5ENB A;  5EM3 A;  5IBN A;  3G0J A;  4NR8 A;  2DVR A;  5CUB A;  5CUA A;  5L8T A;  5DX4 A;  2RI7 A;  4NXJ A;  5E7D A;  4ZC9 A;  4UYF B;  5EWC A;  5A7C A;  5I1Q A;  4HBY A;  4Q0O A;  4A9E A;  2WP1 A;  4HXO A;  5HQ5 A;  5C8G A;  4UIT A;  5L99 A;  5I83 A;  4NR6 A;  4QST A;  4UYD A;  5CQ8 A;  5ETD A;  5CY9 A;  5F61 A;  5II2 A;  3O36 A;  4MR3 A;  3U5O A;  4NUE A;  4N4F A;  5I29 A;  2H60 A;  4TU6 A;  4Q0N A;  5CPE A;  4Z6I A;  4YYK A;  5A5S A;  4TQN A;  2R0S A;  5F5Z A;  3FKM X;  5EA1 A;  5I7X A;  4O75 A;  5E9M A;  4QUU A;  4O76 A;  5F25 A;  2D82 A;  5DW1 A;  4NR5 A;  4TT2 A;  5D24 A;  5JWM A;  4WHU A;  5E3G A;  5H1V A;  2DVV A;  2E7O A;  5D3S A;  3D7C A;  4UIX A;  4LZ2 A;  4HBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...