2RNXA

The structural basis for site-specific lysine-acetylated histone recognition by the bromodomains of the human transcriptional co-activators pcaf and cbp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
GSHMSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/nuclear protein
molecule keywords Histone acetyltransferase PCAF
publication title Structural Basis of Site-Specific Histone Recognition by the Bromodomains of Human Coactivators PCAF and CBP/p300
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 118
sequence length 118
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2008-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2rnxA00
4KV4A 4TT2A 5D3JA 4N4GA 5IGNA 4O76A 5A81A 5DFDA 3U5MA 3UV2A 5G4SA 3MULA 4A9JA 5HQ7A 5LKZA 5EA1A 5KHMA 4A9LA 5JI8A 4QSVA 4MEQA 5I29A 5LKXA 3JVKA 4QYDA 5E9MA 4YK0A 3O33A 4HXSA 4IOQA 5EPSA 5DW2A 5EU1A 3K2JA 4LRGA 4J1PA 2R0VA 5H1VA 4NRAA 4QSXA 4MEPA 5CUAA 5E3DA 4CLBA 5ENJA 5I86A 3MXFA 4YC9A 5CUGA 4YYMA 5C89A 4X2IA 4A9NA 3HMHA 3O35A 5CQTA 3U5NA 5L97A 5I89A 4NR6A 5EPBA 4WHWA 4NQMA 5DY7A 4ALHA 4HXPA 4UIVA 5AD2A 4ZW1A 5HFQA 5CS8A 5I88A 2DKWA 4QSQA 4A9IA 4YY4A 5LJ0A 4OGIA 2D9EA 5L99A 4IR3A 3LQHA 5EVAA 4QUTA 4UYDA 4C67A 3U5JA 4J3IA 5EWDA 4A9EA 3MQMA 3AQAA 2RFJA 5FH6A 3GG3A 4NYVA 3SVGA 2E3KA 4QSWA 5CQ4A 2GRCA 4QSPA 5CQ7A 5G4RA 3LJWA 5D0CA 5LVQA 5H1UA 4IR6A 5F60A 5F36A 4O7AA 4TQNA 4LZRA 4N4HA 2RS9B 4CURA 4N4IA 4PTBA 4MEOA 3IU6A 4UIYA 4YADA 5E9KA 5II1A 5TCMA 5EGUA 5H85A 5A7CA 5DYUA 5AMFA 5FE4A 4O70A 2G4AA 3UVDA 4MR5A 5ENBA 4ALGA 4QNSA 3I3JA 5CRMA 5DLZA 5FE3A 5CZGA 5FFWA 5ENCA 5KTUA 5FFYA 5CPEA 5BT4A 5F1HA 4PCIA 4YABA 5FG4A 4YYJA 2WP1A 3D7CA 5CFWA 2L5EA 4TU6A 4UYGA 5I7YA 5D3SA 4NS5A 2MJVB 5D3TA 2RI7A 4KCXA 2OSSA 3S91A 2L84A 5CTLA 5LKUA 5EQ1A 5F5ZA 5IGLA 3UV5A 4UIXA 4J0RA 5ENHA 4O78A 4YATA 5BT3A 5KO4A 5DFCA 4QR3A 5D3NA 4HXNA 4TZ8A 5L96A 5DYXA 2DVSA 4NYWA 4XUBA 3RCWA 4O71A 5A5NA 4NR5A 4HXLA 4OGJA 4QSTA 4WIVA 5HCLA 4UIWA 5E9YA 5EWHA 5D3HA 4QYLA 4YYDA 3LQIA 2R10A 4MR4A 2N9GA 5E73A 4Z1SA 5L8UA 5E3GA 2KTBB 4Q0NA 5I1QA 5E0RA 5EP7A 5ETDA 5J0DA 3LQJA 2I7KA 4BW2A 4PKLA 5CP5A 5D25A 4O77A 3O37A 1JSPB 5E74A 5HQ5A 1JM4B 5CUCA 3AADA 5A85A 5A83A 5I40A 5ENGA 4N4FA 5IBNA 2DVRA 3U5LA 4MR3A 5IGMA 5F61A 5ENIA 4LC2A 5IGKA 2H60A 4TT6A 4O7FA 4NR8A 4HXMA 4TZ2A 2R0YA 3MB4A 4Z1QA 5F2PA 5FDZA 4LR6A 4Z6HA 2E7NA 5AD3A 3ZYUA 5DFBA 5I80A 4AKNA 4BJXA 2YYNA 5A5RA 5FBXA 4Z93A 5HQ6A 5DKHA 4UYFB 4CFLA 5C7NA 5CUBA 4PCEA 4C66A 4QEWA 4HXKA 4A9KA 5CQAA 5EWCA 5FB1A 4YYHA 3P1EA 2YEKA 3G0JA 4NRBA 3QZTA 5FFVA 4BW4A 4O7BA 2DVQA 3P5OA 5HM0A 4YH4A 5HENA 1N72A 4TTEA 4UITA 4YYIA 4LZSA 5FE0A 4PS5A 1ZS5A 2RNYA 5HRWA 5KTWA 4IR5A 5FE7A 5EICA 5EWWA 5A5QA 3S92A 5H1TA 4LZ2A 1E6IA 3P1FA 4HXRA 4YH3A 5FE6A 4KV1A 5DKCA 4E96A 4YAXA 4YYNA 5L8TA 4NXJA 4RVRA 4J0SA 4NUCA 5E9IA 4UYFA 3DAIA 5LVRA 5CQ5A 5EWVA 4IR4A 4LYSA 4NR4A 3IU5A 5II2A 5FE9A 2RO1A 4NYXA 4A9HA 4YBSA 5TB6A 4TT4A 2FSAA 4LYIA 4YBMA 2OUOA 5E9VA 4QZSA 5F25A 2DVVA 5F3AA 3O36A 4QSUA 3Q2FA 5F63A 5C87A 5FH8A 5LJ1A 1F68A 2WP2A 3JVJA 5ENEA 5FE2A 5HLSA 2NXBA 5DW1A 4XUAA 4CL9A 3U5OA 2RNXA 2F6JA 2I8NA 4NUDA 5K29A 3LXJA 5IG6A 5FE8A 5D7XA 5F1LA 4IORA 4BHWA 4HBYA 3UVXA 5DX4A 5I83A 4CUQA 5EISA 4CFKA 5DYAA 4YYGA 4QEUA 5COIA 4XYAA 4N3WA 4UYEA 5E9LA 4TYLA 5ACYA 2OO1A 5HFRA 5DLXA 5EV9A 5LJ2A 5KTXA 4ZC9A 5AMEA 5HRVA 5FB0A 5FG5A 3JVMA 5F62A 4IOOA 5CQ6A 5CUDA 4Y03A 3ONIA 4DONA 4F3IA 5CGPA 4A9OA 5DYCA 5A5SA 4LDFA 5A5PA 3UV4A 3DWYA 4QR5A 3SVHA 4BW1A 2YEMA 3P1DA 4O72A 5FG6A 5I7XA 5EK9A 4XY9A 4QY4A 4QC1A 3G0LA 3QZSA 5CU8A 4A9FA 4O7EA 5LKTA 4MENA 5D3LA 2YDWA 5C85A 4NQNA 5C4QA 5FH7A 5A82A 5D3RA 5KU3A 5HEMA 4CUUA 5HRXA 3UW9A 5EI4A 3U5PA 4NR9A 4HBWA 4QB3A 4TU4A 4HXOA 1X0JA 5ENFA 2YW5A 1EQFA 3MB3A 4O74A 4TS8A 5C8GA 5CQ8A 5DKDA 4HBVA 2D82A 3HMEA 4O7CA 2YELA 5A5OA 4UYHA 4QBMA 5E7DA 4GPJA 5JWMA 4QR4A 4XY8A 4A9MA 4MR6A 5EM3A 5CRZA 4QC3A 4QEVA 2R0SA 4NR7A 3SVFA 2L85A 4ZQLA 5CUEA 5IIDA 5D26A 4YY6A 4UIUA 5CQ3A 4O75A 4UIZA 3JVLA 4Z6IA 2RNWA 3NXBA 4FLPA 3Q2EA 3FKMX 3MUKA 4HBXA 5ETBA 5HELA 3U5KA 2DATA 4OUFA 4CUTA 3TLPA 5HJCA 5L98A 4Q0OA 4NRCA 3UVWA 5FE1A 3QZVA 4CUSA 4LYWA 4PY6A 5CY9A 5D3PA 5EPRA 4NUEA 4BW3A 3HMFA 4QUUA 5LUUA 4YBTA 1WUMA 5DBMA 5D24A 4WHUA 4CUPA 2E7OA 3UVYA 1WUGA 2YQDA 3P1CA 5BT5A 4QSSA 4YYKA 3O34A 2F6NA 2LSPB 4QSRA 5FE5A 2DWWA
chains in the Genus database with same CATH superfamily
4KV4A 4TT2A 5D3JA 4N4GA 5IGNA 4O76A 5A81A 5DFDA 3U5MA 3UV2A 5G4SA 3MULA 4A9JA 5HQ7A 5LKZA 5EA1A 5KHMA 4A9LA 5JI8A 4QSVA 4MEQA 5I29A 5LKXA 3JVKA 4QYDA 5E9MA 4YK0A 3O33A 4HXSA 4IOQA 5EPSA 5DW2A 5EU1A 3K2JA 4LRGA 4J1PA 2R0VA 5H1VA 4NRAA 4QSXA 4MEPA 5CUAA 5E3DA 4CLBA 5ENJA 5I86A 3MXFA 4YC9A 5CUGA 4YYMA 5C89A 4X2IA 4A9NA 3HMHA 3O35A 5CQTA 3U5NA 5L97A 5I89A 4NR6A 5EPBA 4WHWA 4NQMA 5DY7A 4ALHA 4HXPA 4UIVA 5AD2A 4ZW1A 5HFQA 5CS8A 5I88A 2DKWA 4QSQA 4A9IA 4YY4A 5LJ0A 4OGIA 2D9EA 5L99A 4IR3A 3LQHA 5EVAA 4QUTA 4UYDA 4C67A 3U5JA 4J3IA 5EWDA 3ERRA 4A9EA 3MQMA 3AQAA 2RFJA 5FH6A 3GG3A 4NYVA 3SVGA 2E3KA 4QSWA 5CQ4A 2GRCA 4QSPA 5CQ7A 5G4RA 3LJWA 5D0CA 5LVQA 4AKGA 4AKHA 5H1UA 2EJNA 4IR6A 5F60A 5F36A 4O7AA 4TQNA 4LZRA 4N4HA 2RS9B 4CURA 4N4IA 4PTBA 4MEOA 3IU6A 4UIYA 4YADA 5E9KA 5II1A 5TCMA 5EGUA 5H85A 5A7CA 5DYUA 5AMFA 5FE4A 4O70A 2G4AA 3UVDA 4MR5A 5ENBA 4ALGA 4QNSA 3I3JA 5CRMA 5DLZA 5FE3A 5CZGA 5FFWA 5ENCA 5KTUA 5FFYA 5CPEA 5BT4A 5F1HA 4PCIA 4YABA 5FG4A 4YYJA 2WP1A 3D7CA 5CFWA 2L5EA 4TU6A 4UYGA 5I7YA 5D3SA 4NS5A 2MJVB 5D3TA 2RI7A 4KCXA 2OSSA 3S91A 2L84A 5CTLA 5LKUA 5EQ1A 1ZKRA 5F5ZA 5IGLA 3UV5A 4UIXA 4J0RA 5ENHA 4O78A 4YATA 5BT3A 5KO4A 5DFCA 4QR3A 5D3NA 4HXNA 4TZ8A 5L96A 3VKHA 5DYXA 2DVSA 4NYWA 4XUBA 3RCWA 4O71A 5A5NA 4NR5A 4HXLA 4OGJA 4QSTA 4WIVA 5HCLA 4UIWA 5E9YA 3VKGA 5EWHA 5D3HA 4QYLA 4YYDA 3LQIA 2R10A 4MR4A 2N9GA 5E73A 4Z1SA 5L8UA 5E3GA 4AKIA 2KTBB 4Q0NA 5I1QA 5E0RA 5EP7A 5ETDA 5J0DA 3LQJA 2I7KA 4BW2A 4PKLA 5CP5A 5D25A 4O77A 3O37A 1JSPB 5E74A 5HQ5A 1JM4B 5CUCA 3AADA 3D1BA 5A85A 5A83A 5I40A 5ENGA 4N4FA 5IBNA 2DVRA 3U5LA 4MR3A 5IGMA 5F61A 5ENIA 4LC2A 5IGKA 2H60A 4TT6A 4O7FA 4NR8A 4HXMA 4TZ2A 2R0YA 3MB4A 4Z1QA 5F2PA 5FDZA 4LR6A 4Z6HA 2E7NA 5AD3A 3ZYUA 5DFBA 5I80A 4AKNA 4BJXA 2YYNA 5A5RA 5FBXA 4Z93A 5HQ6A 5DKHA 4UYFB 4CFLA 5C7NA 5CUBA 4PCEA 4C66A 4QEWA 4HXKA 4A9KA 5CQAA 5EWCA 5FB1A 4YYHA 3P1EA 2YEKA 3G0JA 4NRBA 3QZTA 5FFVA 4BW4A 4O7BA 2DVQA 3P5OA 5HM0A 4YH4A 5HENA 1N72A 4TTEA 4UITA 4YYIA 4LZSA 5FE0A 4PS5A 1ZS5A 2RNYA 5HRWA 5KTWA 4IR5A 5FE7A 5EICA 5EWWA 5A5QA 3S92A 5H1TA 4LZ2A 1E6IA 3P1FA 4HXRA 4YH3A 5FE6A 4KV1A 5DKCA 4E96A 4YAXA 4YYNA 5L8TA 4NXJA 4RVRA 4J0SA 4NUCA 5E9IA 4UYFA 3DAIA 5LVRA 5CQ5A 5EWVA 4IR4A 4LYSA 4NR4A 3IU5A 5II2A 5FE9A 2RO1A 4NYXA 4A9HA 4YBSA 5TB6A 4TT4A 2FSAA 4LYIA 4YBMA 2OUOA 5E9VA 4QZSA 5F25A 2DVVA 5F3AA 3O36A 4QSUA 3Q2FA 5F63A 5C87A 5FH8A 5LJ1A 1F68A 2WP2A 3JVJA 5ENEA 5FE2A 5HLSA 2NXBA 5DW1A 4XUAA 4CL9A 3U5OA 2RNXA 2F6JA 2I8NA 4NUDA 5K29A 3LXJA 5IG6A 5FE8A 5D7XA 5F1LA 4IORA 4BHWA 4HBYA 3UVXA 5DX4A 5I83A 4CUQA 5EISA 4CFKA 5DYAA 4YYGA 4QEUA 5COIA 4AI6A 4XYAA 4N3WA 4UYEA 5E9LA 4TYLA 5ACYA 2OO1A 5HFRA 5DLXA 5EV9A 5LJ2A 5KTXA 4ZC9A 5AMEA 5HRVA 5FB0A 5FG5A 3JVMA 5F62A 4IOOA 5CQ6A 5CUDA 4Y03A 3ONIA 4DONA 4F3IA 5CGPA 4A9OA 5DYCA 5A5SA 4LDFA 5A5PA 3UV4A 3DWYA 4QR5A 3SVHA 4BW1A 2YEMA 3P1DA 4O72A 5FG6A 5I7XA 5EK9A 4XY9A 4QY4A 4QC1A 3G0LA 3QZSA 5CU8A 4A9FA 4O7EA 5LKTA 4MENA 5D3LA 2YDWA 5C85A 4NQNA 5C4QA 5FH7A 5A82A 5D3RA 5KU3A 5HEMA 4CUUA 5HRXA 3UW9A 5EI4A 3U5PA 4NR9A 4HBWA 4QB3A 4TU4A 4HXOA 1X0JA 5ENFA 2YW5A 1EQFA 3MB3A 4O74A 4TS8A 5C8GA 5CQ8A 5DKDA 4HBVA 2D82A 3HMEA 4O7CA 2YELA 5A5OA 4UYHA 4QBMA 5E7DA 4GPJA 5JWMA 4QR4A 4XY8A 4A9MA 4MR6A 5EM3A 5CRZA 4QC3A 4QEVA 2R0SA 4NR7A 3SVFA 2L85A 4ZQLA 5CUEA 5IIDA 5D26A 4YY6A 4UIUA 5CQ3A 4O75A 4UIZA 3JVLA 4Z6IA 2RNWA 3NXBA 4FLPA 3Q2EA 3FKMX 3MUKA 4HBXA 5ETBA 5HELA 3U5KA 2DATA 1PUOA 4OUFA 3D1DA 4CUTA 3TLPA 5HJCA 5L98A 4Q0OA 4NRCA 3UVWA 5FE1A 3QZVA 4CUSA 4LYWA 4PY6A 5CY9A 5D3PA 5EPRA 4NUEA 4BW3A 3HMFA 4QUUA 5LUUA 4YBTA 1WUMA 5DBMA 5D24A 4WHUA 4CUPA 2E7OA 3UVYA 1WUGA 2YQDA 3P1CA 5BT5A 4QSSA 4YYKA 3O34A 2F6NA 2LSPB 4QSRA 5FE5A 2DWWA
chains in the Genus database with same CATH topology
4KV4A 4TT2A 5D3JA 4N4GA 5IGNA 4O76A 5A81A 5DFDA 3U5MA 3UV2A 5G4SA 3MULA 4A9JA 5HQ7A 5LKZA 5EA1A 5KHMA 4A9LA 5JI8A 4QSVA 4MEQA 5I29A 5LKXA 3JVKA 4QYDA 5E9MA 4YK0A 3O33A 4HXSA 4IOQA 5EPSA 5DW2A 5EU1A 3K2JA 4LRGA 4J1PA 2R0VA 5H1VA 4NRAA 4QSXA 4MEPA 5CUAA 5E3DA 4CLBA 5ENJA 5I86A 3MXFA 4YC9A 5CUGA 4YYMA 5C89A 4X2IA 4A9NA 3HMHA 3O35A 5CQTA 3U5NA 5L97A 5I89A 4NR6A 5EPBA 4WHWA 4NQMA 5DY7A 4ALHA 4HXPA 4UIVA 5AD2A 4ZW1A 5HFQA 5CS8A 5I88A 2DKWA 4QSQA 4A9IA 4YY4A 5LJ0A 4OGIA 2D9EA 5L99A 4IR3A 3LQHA 5EVAA 4QUTA 4UYDA 4C67A 3U5JA 4J3IA 5EWDA 4A9EA 3MQMA 3AQAA 2RFJA 5FH6A 3GG3A 4NYVA 3SVGA 2E3KA 4QSWA 5CQ4A 2GRCA 4QSPA 5CQ7A 5G4RA 3LJWA 5D0CA 5LVQA 5H1UA 4IR6A 5F60A 5F36A 4O7AA 4TQNA 4LZRA 4N4HA 2RS9B 4CURA 4N4IA 4PTBA 4MEOA 3IU6A 4UIYA 4YADA 5E9KA 5II1A 5TCMA 5EGUA 5H85A 5A7CA 5DYUA 5AMFA 5FE4A 4O70A 2G4AA 3UVDA 4MR5A 5ENBA 4ALGA 4QNSA 3I3JA 5CRMA 5DLZA 5FE3A 5CZGA 5FFWA 5ENCA 5KTUA 5FFYA 5CPEA 5BT4A 5F1HA 4PCIA 4YABA 5FG4A 4YYJA 2WP1A 3D7CA 5CFWA 2L5EA 4TU6A 4UYGA 5I7YA 5D3SA 4NS5A 2MJVB 5D3TA 2RI7A 4KCXA 2OSSA 3S91A 2L84A 5CTLA 5LKUA 5EQ1A 5F5ZA 5IGLA 3UV5A 4UIXA 4J0RA 5ENHA 4O78A 4YATA 5BT3A 5KO4A 5DFCA 4QR3A 5D3NA 4HXNA 4TZ8A 5L96A 5DYXA 2DVSA 4NYWA 4XUBA 3RCWA 4O71A 5A5NA 4NR5A 4HXLA 4OGJA 4QSTA 4WIVA 5HCLA 4UIWA 5E9YA 5EWHA 5D3HA 4QYLA 4YYDA 3LQIA 2R10A 4MR4A 2N9GA 5E73A 4Z1SA 5L8UA 5E3GA 2KTBB 4Q0NA 5I1QA 5E0RA 5EP7A 5ETDA 5J0DA 3LQJA 2I7KA 4BW2A 4PKLA 5CP5A 5D25A 4O77A 3O37A 1JSPB 5E74A 5HQ5A 1JM4B 5CUCA 3AADA 5A85A 5A83A 5I40A 5ENGA 4N4FA 5IBNA 2DVRA 3U5LA 4MR3A 5IGMA 5F61A 5ENIA 4LC2A 5IGKA 2H60A 4TT6A 4O7FA 4NR8A 4HXMA 4TZ2A 2R0YA 3MB4A 4Z1QA 5F2PA 5FDZA 4LR6A 4Z6HA 2E7NA 5AD3A 3ZYUA 5DFBA 5I80A 4AKNA 4BJXA 2YYNA 5A5RA 5FBXA 4Z93A 5HQ6A 5DKHA 4UYFB 4CFLA 5C7NA 5CUBA 4PCEA 4C66A 4QEWA 4HXKA 4A9KA 5CQAA 5EWCA 5FB1A 4YYHA 3P1EA 2YEKA 3G0JA 4NRBA 3QZTA 5FFVA 4BW4A 4O7BA 2DVQA 3P5OA 5HM0A 4YH4A 5HENA 1N72A 4TTEA 4UITA 4YYIA 4LZSA 5FE0A 4PS5A 1ZS5A 2RNYA 5HRWA 5KTWA 4IR5A 5FE7A 5EICA 5EWWA 5A5QA 3S92A 5H1TA 4LZ2A 1E6IA 3P1FA 4HXRA 4YH3A 5FE6A 4KV1A 5DKCA 4E96A 4YAXA 4YYNA 5L8TA 4NXJA 4RVRA 4J0SA 4NUCA 5E9IA 4UYFA 3DAIA 5LVRA 5CQ5A 5EWVA 4IR4A 4LYSA 4NR4A 3IU5A 5II2A 5FE9A 2RO1A 4NYXA 4A9HA 4YBSA 5TB6A 4TT4A 2FSAA 4LYIA 4YBMA 2OUOA 5E9VA 4QZSA 5F25A 2DVVA 5F3AA 3O36A 4QSUA 3Q2FA 5F63A 5C87A 5FH8A 5LJ1A 1F68A 2WP2A 3JVJA 5ENEA 5FE2A 5HLSA 2NXBA 5DW1A 4XUAA 4CL9A 3U5OA 2RNXA 2F6JA 2I8NA 4NUDA 5K29A 3LXJA 5IG6A 5FE8A 5D7XA 5F1LA 4IORA 4BHWA 4HBYA 3UVXA 5DX4A 5I83A 4CUQA 5EISA 4CFKA 5DYAA 4YYGA 4QEUA 5COIA 4XYAA 4N3WA 4UYEA 5E9LA 4TYLA 5ACYA 2OO1A 5HFRA 5DLXA 5EV9A 5LJ2A 5KTXA 4ZC9A 5AMEA 5HRVA 5FB0A 5FG5A 3JVMA 5F62A 4IOOA 5CQ6A 5CUDA 4Y03A 3ONIA 4DONA 4F3IA 5CGPA 4A9OA 5DYCA 5A5SA 4LDFA 5A5PA 3UV4A 3DWYA 4QR5A 3SVHA 4BW1A 2YEMA 3P1DA 4O72A 5FG6A 5I7XA 5EK9A 4XY9A 4QY4A 4QC1A 3G0LA 3QZSA 5CU8A 4A9FA 4O7EA 5LKTA 4MENA 5D3LA 2YDWA 5C85A 4NQNA 5C4QA 5FH7A 5A82A 5D3RA 5KU3A 5HEMA 4CUUA 5HRXA 3UW9A 5EI4A 3U5PA 4NR9A 4HBWA 4QB3A 4TU4A 4HXOA 1X0JA 5ENFA 2YW5A 1EQFA 3MB3A 4O74A 4TS8A 5C8GA 5CQ8A 5DKDA 4HBVA 2D82A 3HMEA 4O7CA 2YELA 5A5OA 4UYHA 4QBMA 5E7DA 4GPJA 5JWMA 4QR4A 4XY8A 4A9MA 4MR6A 5EM3A 5CRZA 4QC3A 4QEVA 2R0SA 4NR7A 3SVFA 2L85A 4ZQLA 5CUEA 5IIDA 5D26A 4YY6A 4UIUA 5CQ3A 4O75A 4UIZA 3JVLA 4Z6IA 2RNWA 3NXBA 4FLPA 3Q2EA 3FKMX 3MUKA 4HBXA 5ETBA 5HELA 3U5KA 2DATA 4OUFA 4CUTA 3TLPA 5HJCA 5L98A 4Q0OA 4NRCA 3UVWA 5FE1A 3QZVA 4CUSA 4LYWA 4PY6A 5CY9A 5D3PA 5EPRA 4NUEA 4BW3A 3HMFA 4QUUA 5LUUA 4YBTA 1WUMA 5DBMA 5D24A 4WHUA 4CUPA 2E7OA 3UVYA 1WUGA 2YQDA 3P1CA 5BT5A 4QSSA 4YYKA 3O34A 2F6NA 2LSPB 4QSRA 5FE5A 2DWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KV4 A;  4TT2 A;  5D3J A;  4N4G A;  5IGN A;  4O76 A;  5A81 A;  5DFD A;  3U5M A;  3UV2 A;  5G4S A;  3MUL A;  4A9J A;  5HQ7 A;  5LKZ A;  5EA1 A;  5KHM A;  4A9L A;  5JI8 A;  4QSV A;  4MEQ A;  5I29 A;  5LKX A;  3JVK A;  4QYD A;  5E9M A;  4YK0 A;  3O33 A;  4HXS A;  4IOQ A;  5EPS A;  5DW2 A;  5EU1 A;  3K2J A;  4LRG A;  4J1P A;  2R0V A;  5H1V A;  4NRA A;  4QSX A;  4MEP A;  5CUA A;  5E3D A;  4CLB A;  5ENJ A;  5I86 A;  3MXF A;  4YC9 A;  5CUG A;  4YYM A;  5C89 A;  4X2I A;  4A9N A;  3HMH A;  3O35 A;  5CQT A;  3U5N A;  5L97 A;  5I89 A;  4NR6 A;  5EPB A;  4WHW A;  4NQM A;  5DY7 A;  4ALH A;  4HXP A;  4UIV A;  5AD2 A;  4ZW1 A;  5HFQ A;  5CS8 A;  5I88 A;  2DKW A;  4QSQ A;  4A9I A;  4YY4 A;  5LJ0 A;  4OGI A;  2D9E A;  5L99 A;  4IR3 A;  3LQH A;  5EVA A;  4QUT A;  4UYD A;  4C67 A;  3U5J A;  4J3I A;  5EWD A;  4A9E A;  3MQM A;  3AQA A;  2RFJ A;  5FH6 A;  3GG3 A;  4NYV A;  3SVG A;  2E3K A;  4QSW A;  5CQ4 A;  2GRC A;  4QSP A;  5CQ7 A;  5G4R A;  3LJW A;  5D0C A;  5LVQ A;  5H1U A;  4IR6 A;  5F60 A;  5F36 A;  4O7A A;  4TQN A;  4LZR A;  4N4H A;  2RS9 B;  4CUR A;  4N4I A;  4PTB A;  4MEO A;  3IU6 A;  4UIY A;  4YAD A;  5E9K A;  5II1 A;  5TCM A;  5EGU A;  5H85 A;  5A7C A;  5DYU A;  5AMF A;  5FE4 A;  4O70 A;  2G4A A;  3UVD A;  4MR5 A;  5ENB A;  4ALG A;  4QNS A;  3I3J A;  5CRM A;  5DLZ A;  5FE3 A;  5CZG A;  5FFW A;  5ENC A;  5KTU A;  5FFY A;  5CPE A;  5BT4 A;  5F1H A;  4PCI A;  4YAB A;  5FG4 A;  4YYJ A;  2WP1 A;  3D7C A;  5CFW A;  2L5E A;  4TU6 A;  4UYG A;  5I7Y A;  5D3S A;  4NS5 A;  2MJV B;  5D3T A;  2RI7 A;  4KCX A;  2OSS A;  3S91 A;  2L84 A;  5CTL A;  5LKU A;  5EQ1 A;  5F5Z A;  5IGL A;  3UV5 A;  4UIX A;  4J0R A;  5ENH A;  4O78 A;  4YAT A;  5BT3 A;  5KO4 A;  5DFC A;  4QR3 A;  5D3N A;  4HXN A;  4TZ8 A;  5L96 A;  5DYX A;  2DVS A;  4NYW A;  4XUB A;  3RCW A;  4O71 A;  5A5N A;  4NR5 A;  4HXL A;  4OGJ A;  4QST A;  4WIV A;  5HCL A;  4UIW A;  5E9Y A;  5EWH A;  5D3H A;  4QYL A;  4YYD A;  3LQI A;  2R10 A;  4MR4 A;  2N9G A;  5E73 A;  4Z1S A;  5L8U A;  5E3G A;  2KTB B;  4Q0N A;  5I1Q A;  5E0R A;  5EP7 A;  5ETD A;  5J0D A;  3LQJ A;  2I7K A;  4BW2 A;  4PKL A;  5CP5 A;  5D25 A;  4O77 A;  3O37 A;  1JSP B;  5E74 A;  5HQ5 A;  1JM4 B;  5CUC A;  3AAD A;  5A85 A;  5A83 A;  5I40 A;  5ENG A;  4N4F A;  5IBN A;  2DVR A;  3U5L A;  4MR3 A;  5IGM A;  5F61 A;  5ENI A;  4LC2 A;  5IGK A;  2H60 A;  4TT6 A;  4O7F A;  4NR8 A;  4HXM A;  4TZ2 A;  2R0Y A;  3MB4 A;  4Z1Q A;  5F2P A;  5FDZ A;  4LR6 A;  4Z6H A;  2E7N A;  5AD3 A;  3ZYU A;  5DFB A;  5I80 A;  4AKN A;  4BJX A;  2YYN A;  5A5R A;  5FBX A;  4Z93 A;  5HQ6 A;  5DKH A;  4UYF B;  4CFL A;  5C7N A;  5CUB A;  4PCE A;  4C66 A;  4QEW A;  4HXK A;  4A9K A;  5CQA A;  5EWC A;  5FB1 A;  4YYH A;  3P1E A;  2YEK A;  3G0J A;  4NRB A;  3QZT A;  5FFV A;  4BW4 A;  4O7B A;  2DVQ A;  3P5O A;  5HM0 A;  4YH4 A;  5HEN A;  1N72 A;  4TTE A;  4UIT A;  4YYI A;  4LZS A;  5FE0 A;  4PS5 A;  1ZS5 A;  2RNY A;  5HRW A;  5KTW A;  4IR5 A;  5FE7 A;  5EIC A;  5EWW A;  5A5Q A;  3S92 A;  5H1T A;  4LZ2 A;  1E6I A;  3P1F A;  4HXR A;  4YH3 A;  5FE6 A;  4KV1 A;  5DKC A;  4E96 A;  4YAX A;  4YYN A;  5L8T A;  4NXJ A;  4RVR A;  4J0S A;  4NUC A;  5E9I A;  4UYF A;  3DAI A;  5LVR A;  5CQ5 A;  5EWV A;  4IR4 A;  4LYS A;  4NR4 A;  3IU5 A;  5II2 A;  5FE9 A;  2RO1 A;  4NYX A;  4A9H A;  4YBS A;  5TB6 A;  4TT4 A;  2FSA A;  4LYI A;  4YBM A;  2OUO A;  5E9V A;  4QZS A;  5F25 A;  2DVV A;  5F3A A;  3O36 A;  4QSU A;  3Q2F A;  5F63 A;  5C87 A;  5FH8 A;  5LJ1 A;  1F68 A;  2WP2 A;  3JVJ A;  5ENE A;  5FE2 A;  5HLS A;  2NXB A;  5DW1 A;  4XUA A;  4CL9 A;  3U5O A;  2RNX A;  2F6J A;  2I8N A;  4NUD A;  5K29 A;  3LXJ A;  5IG6 A;  5FE8 A;  5D7X A;  5F1L A;  4IOR A;  4BHW A;  4HBY A;  3UVX A;  5DX4 A;  5I83 A;  4CUQ A;  5EIS A;  4CFK A;  5DYA A;  4YYG A;  4QEU A;  5COI A;  4XYA A;  4N3W A;  4UYE A;  5E9L A;  4TYL A;  5ACY A;  2OO1 A;  5HFR A;  5DLX A;  5EV9 A;  5LJ2 A;  5KTX A;  4ZC9 A;  5AME A;  5HRV A;  5FB0 A;  5FG5 A;  3JVM A;  5F62 A;  4IOO A;  5CQ6 A;  5CUD A;  4Y03 A;  3ONI A;  4DON A;  4F3I A;  5CGP A;  4A9O A;  5DYC A;  5A5S A;  4LDF A;  5A5P A;  3UV4 A;  3DWY A;  4QR5 A;  3SVH A;  4BW1 A;  2YEM A;  3P1D A;  4O72 A;  5FG6 A;  5I7X A;  5EK9 A;  4XY9 A;  4QY4 A;  4QC1 A;  3G0L A;  3QZS A;  5CU8 A;  4A9F A;  4O7E A;  5LKT A;  4MEN A;  5D3L A;  2YDW A;  5C85 A;  4NQN A;  5C4Q A;  5FH7 A;  5A82 A;  5D3R A;  5KU3 A;  5HEM A;  4CUU A;  5HRX A;  3UW9 A;  5EI4 A;  3U5P A;  4NR9 A;  4HBW A;  4QB3 A;  4TU4 A;  4HXO A;  1X0J A;  5ENF A;  2YW5 A;  1EQF A;  3MB3 A;  4O74 A;  4TS8 A;  5C8G A;  5CQ8 A;  5DKD A;  4HBV A;  2D82 A;  3HME A;  4O7C A;  2YEL A;  5A5O A;  4UYH A;  4QBM A;  5E7D A;  4GPJ A;  5JWM A;  4QR4 A;  4XY8 A;  4A9M A;  4MR6 A;  5EM3 A;  5CRZ A;  4QC3 A;  4QEV A;  2R0S A;  4NR7 A;  3SVF A;  2L85 A;  4ZQL A;  5CUE A;  5IID A;  5D26 A;  4YY6 A;  4UIU A;  5CQ3 A;  4O75 A;  4UIZ A;  3JVL A;  4Z6I A;  2RNW A;  3NXB A;  4FLP A;  3Q2E A;  3FKM X;  3MUK A;  4HBX A;  5ETB A;  5HEL A;  3U5K A;  2DAT A;  4OUF A;  4CUT A;  3TLP A;  5HJC A;  5L98 A;  4Q0O A;  4NRC A;  3UVW A;  5FE1 A;  3QZV A;  4CUS A;  4LYW A;  4PY6 A;  5CY9 A;  5D3P A;  5EPR A;  4NUE A;  4BW3 A;  3HMF A;  4QUU A;  5LUU A;  4YBT A;  1WUM A;  5DBM A;  5D24 A;  4WHU A;  4CUP A;  2E7O A;  3UVY A;  1WUG A;  2YQD A;  3P1C A;  5BT5 A;  4QSS A;  4YYK A;  3O34 A;  2F6N A;  2LSP B;  4QSR A;  5FE5 A;  2DWW A; 
#chains in the Genus database with same CATH topology
 4KV4 A;  4TT2 A;  5D3J A;  4N4G A;  5IGN A;  4O76 A;  5A81 A;  5DFD A;  3U5M A;  3UV2 A;  5G4S A;  3MUL A;  4A9J A;  5HQ7 A;  5LKZ A;  5EA1 A;  5KHM A;  4A9L A;  5JI8 A;  4QSV A;  4MEQ A;  5I29 A;  5LKX A;  3JVK A;  4QYD A;  5E9M A;  4YK0 A;  3O33 A;  4HXS A;  4IOQ A;  5EPS A;  5DW2 A;  5EU1 A;  3K2J A;  4LRG A;  4J1P A;  2R0V A;  5H1V A;  4NRA A;  4QSX A;  4MEP A;  5CUA A;  5E3D A;  4CLB A;  5ENJ A;  5I86 A;  3MXF A;  4YC9 A;  5CUG A;  4YYM A;  5C89 A;  4X2I A;  4A9N A;  3HMH A;  3O35 A;  5CQT A;  3U5N A;  5L97 A;  5I89 A;  4NR6 A;  5EPB A;  4WHW A;  4NQM A;  5DY7 A;  4ALH A;  4HXP A;  4UIV A;  5AD2 A;  4ZW1 A;  5HFQ A;  5CS8 A;  5I88 A;  2DKW A;  4QSQ A;  4A9I A;  4YY4 A;  5LJ0 A;  4OGI A;  2D9E A;  5L99 A;  4IR3 A;  3LQH A;  5EVA A;  4QUT A;  4UYD A;  4C67 A;  3U5J A;  4J3I A;  5EWD A;  3ERR A;  4A9E A;  3MQM A;  3AQA A;  2RFJ A;  5FH6 A;  3GG3 A;  4NYV A;  3SVG A;  2E3K A;  4QSW A;  5CQ4 A;  2GRC A;  4QSP A;  5CQ7 A;  5G4R A;  3LJW A;  5D0C A;  5LVQ A;  4AKG A;  4AKH A;  5H1U A;  2EJN A;  4IR6 A;  5F60 A;  5F36 A;  4O7A A;  4TQN A;  4LZR A;  4N4H A;  2RS9 B;  4CUR A;  4N4I A;  4PTB A;  4MEO A;  3IU6 A;  4UIY A;  4YAD A;  5E9K A;  5II1 A;  5TCM A;  5EGU A;  5H85 A;  5A7C A;  5DYU A;  5AMF A;  5FE4 A;  4O70 A;  2G4A A;  3UVD A;  4MR5 A;  5ENB A;  4ALG A;  4QNS A;  3I3J A;  5CRM A;  5DLZ A;  5FE3 A;  5CZG A;  5FFW A;  5ENC A;  5KTU A;  5FFY A;  5CPE A;  5BT4 A;  5F1H A;  4PCI A;  4YAB A;  5FG4 A;  4YYJ A;  2WP1 A;  3D7C A;  5CFW A;  2L5E A;  4TU6 A;  4UYG A;  5I7Y A;  5D3S A;  4NS5 A;  2MJV B;  5D3T A;  2RI7 A;  4KCX A;  2OSS A;  3S91 A;  2L84 A;  5CTL A;  5LKU A;  5EQ1 A;  1ZKR A;  5F5Z A;  5IGL A;  3UV5 A;  4UIX A;  4J0R A;  5ENH A;  4O78 A;  4YAT A;  5BT3 A;  5KO4 A;  5DFC A;  4QR3 A;  5D3N A;  4HXN A;  4TZ8 A;  5L96 A;  3VKH A;  5DYX A;  2DVS A;  4NYW A;  4XUB A;  3RCW A;  4O71 A;  5A5N A;  4NR5 A;  4HXL A;  4OGJ A;  4QST A;  4WIV A;  5HCL A;  4UIW A;  5E9Y A;  3VKG A;  5EWH A;  5D3H A;  4QYL A;  4YYD A;  3LQI A;  2R10 A;  4MR4 A;  2N9G A;  5E73 A;  4Z1S A;  5L8U A;  5E3G A;  4AKI A;  2KTB B;  4Q0N A;  5I1Q A;  5E0R A;  5EP7 A;  5ETD A;  5J0D A;  3LQJ A;  2I7K A;  4BW2 A;  4PKL A;  5CP5 A;  5D25 A;  4O77 A;  3O37 A;  1JSP B;  5E74 A;  5HQ5 A;  1JM4 B;  5CUC A;  3AAD A;  3D1B A;  5A85 A;  5A83 A;  5I40 A;  5ENG A;  4N4F A;  5IBN A;  2DVR A;  3U5L A;  4MR3 A;  5IGM A;  5F61 A;  5ENI A;  4LC2 A;  5IGK A;  2H60 A;  4TT6 A;  4O7F A;  4NR8 A;  4HXM A;  4TZ2 A;  2R0Y A;  3MB4 A;  4Z1Q A;  5F2P A;  5FDZ A;  4LR6 A;  4Z6H A;  2E7N A;  5AD3 A;  3ZYU A;  5DFB A;  5I80 A;  4AKN A;  4BJX A;  2YYN A;  5A5R A;  5FBX A;  4Z93 A;  5HQ6 A;  5DKH A;  4UYF B;  4CFL A;  5C7N A;  5CUB A;  4PCE A;  4C66 A;  4QEW A;  4HXK A;  4A9K A;  5CQA A;  5EWC A;  5FB1 A;  4YYH A;  3P1E A;  2YEK A;  3G0J A;  4NRB A;  3QZT A;  5FFV A;  4BW4 A;  4O7B A;  2DVQ A;  3P5O A;  5HM0 A;  4YH4 A;  5HEN A;  1N72 A;  4TTE A;  4UIT A;  4YYI A;  4LZS A;  5FE0 A;  4PS5 A;  1ZS5 A;  2RNY A;  5HRW A;  5KTW A;  4IR5 A;  5FE7 A;  5EIC A;  5EWW A;  5A5Q A;  3S92 A;  5H1T A;  4LZ2 A;  1E6I A;  3P1F A;  4HXR A;  4YH3 A;  5FE6 A;  4KV1 A;  5DKC A;  4E96 A;  4YAX A;  4YYN A;  5L8T A;  4NXJ A;  4RVR A;  4J0S A;  4NUC A;  5E9I A;  4UYF A;  3DAI A;  5LVR A;  5CQ5 A;  5EWV A;  4IR4 A;  4LYS A;  4NR4 A;  3IU5 A;  5II2 A;  5FE9 A;  2RO1 A;  4NYX A;  4A9H A;  4YBS A;  5TB6 A;  4TT4 A;  2FSA A;  4LYI A;  4YBM A;  2OUO A;  5E9V A;  4QZS A;  5F25 A;  2DVV A;  5F3A A;  3O36 A;  4QSU A;  3Q2F A;  5F63 A;  5C87 A;  5FH8 A;  5LJ1 A;  1F68 A;  2WP2 A;  3JVJ A;  5ENE A;  5FE2 A;  5HLS A;  2NXB A;  5DW1 A;  4XUA A;  4CL9 A;  3U5O A;  2RNX A;  2F6J A;  2I8N A;  4NUD A;  5K29 A;  3LXJ A;  5IG6 A;  5FE8 A;  5D7X A;  5F1L A;  4IOR A;  4BHW A;  4HBY A;  3UVX A;  5DX4 A;  5I83 A;  4CUQ A;  5EIS A;  4CFK A;  5DYA A;  4YYG A;  4QEU A;  5COI A;  4AI6 A;  4XYA A;  4N3W A;  4UYE A;  5E9L A;  4TYL A;  5ACY A;  2OO1 A;  5HFR A;  5DLX A;  5EV9 A;  5LJ2 A;  5KTX A;  4ZC9 A;  5AME A;  5HRV A;  5FB0 A;  5FG5 A;  3JVM A;  5F62 A;  4IOO A;  5CQ6 A;  5CUD A;  4Y03 A;  3ONI A;  4DON A;  4F3I A;  5CGP A;  4A9O A;  5DYC A;  5A5S A;  4LDF A;  5A5P A;  3UV4 A;  3DWY A;  4QR5 A;  3SVH A;  4BW1 A;  2YEM A;  3P1D A;  4O72 A;  5FG6 A;  5I7X A;  5EK9 A;  4XY9 A;  4QY4 A;  4QC1 A;  3G0L A;  3QZS A;  5CU8 A;  4A9F A;  4O7E A;  5LKT A;  4MEN A;  5D3L A;  2YDW A;  5C85 A;  4NQN A;  5C4Q A;  5FH7 A;  5A82 A;  5D3R A;  5KU3 A;  5HEM A;  4CUU A;  5HRX A;  3UW9 A;  5EI4 A;  3U5P A;  4NR9 A;  4HBW A;  4QB3 A;  4TU4 A;  4HXO A;  1X0J A;  5ENF A;  2YW5 A;  1EQF A;  3MB3 A;  4O74 A;  4TS8 A;  5C8G A;  5CQ8 A;  5DKD A;  4HBV A;  2D82 A;  3HME A;  4O7C A;  2YEL A;  5A5O A;  4UYH A;  4QBM A;  5E7D A;  4GPJ A;  5JWM A;  4QR4 A;  4XY8 A;  4A9M A;  4MR6 A;  5EM3 A;  5CRZ A;  4QC3 A;  4QEV A;  2R0S A;  4NR7 A;  3SVF A;  2L85 A;  4ZQL A;  5CUE A;  5IID A;  5D26 A;  4YY6 A;  4UIU A;  5CQ3 A;  4O75 A;  4UIZ A;  3JVL A;  4Z6I A;  2RNW A;  3NXB A;  4FLP A;  3Q2E A;  3FKM X;  3MUK A;  4HBX A;  5ETB A;  5HEL A;  3U5K A;  2DAT A;  1PUO A;  4OUF A;  3D1D A;  4CUT A;  3TLP A;  5HJC A;  5L98 A;  4Q0O A;  4NRC A;  3UVW A;  5FE1 A;  3QZV A;  4CUS A;  4LYW A;  4PY6 A;  5CY9 A;  5D3P A;  5EPR A;  4NUE A;  4BW3 A;  3HMF A;  4QUU A;  5LUU A;  4YBT A;  1WUM A;  5DBM A;  5D24 A;  4WHU A;  4CUP A;  2E7O A;  3UVY A;  1WUG A;  2YQD A;  3P1C A;  5BT5 A;  4QSS A;  4YYK A;  3O34 A;  2F6N A;  2LSP B;  4QSR A;  5FE5 A;  2DWW A; 
#chains in the Genus database with same CATH homology
 4KV4 A;  4TT2 A;  5D3J A;  4N4G A;  5IGN A;  4O76 A;  5A81 A;  5DFD A;  3U5M A;  3UV2 A;  5G4S A;  3MUL A;  4A9J A;  5HQ7 A;  5LKZ A;  5EA1 A;  5KHM A;  4A9L A;  5JI8 A;  4QSV A;  4MEQ A;  5I29 A;  5LKX A;  3JVK A;  4QYD A;  5E9M A;  4YK0 A;  3O33 A;  4HXS A;  4IOQ A;  5EPS A;  5DW2 A;  5EU1 A;  3K2J A;  4LRG A;  4J1P A;  2R0V A;  5H1V A;  4NRA A;  4QSX A;  4MEP A;  5CUA A;  5E3D A;  4CLB A;  5ENJ A;  5I86 A;  3MXF A;  4YC9 A;  5CUG A;  4YYM A;  5C89 A;  4X2I A;  4A9N A;  3HMH A;  3O35 A;  5CQT A;  3U5N A;  5L97 A;  5I89 A;  4NR6 A;  5EPB A;  4WHW A;  4NQM A;  5DY7 A;  4ALH A;  4HXP A;  4UIV A;  5AD2 A;  4ZW1 A;  5HFQ A;  5CS8 A;  5I88 A;  2DKW A;  4QSQ A;  4A9I A;  4YY4 A;  5LJ0 A;  4OGI A;  2D9E A;  5L99 A;  4IR3 A;  3LQH A;  5EVA A;  4QUT A;  4UYD A;  4C67 A;  3U5J A;  4J3I A;  5EWD A;  4A9E A;  3MQM A;  3AQA A;  2RFJ A;  5FH6 A;  3GG3 A;  4NYV A;  3SVG A;  2E3K A;  4QSW A;  5CQ4 A;  2GRC A;  4QSP A;  5CQ7 A;  5G4R A;  3LJW A;  5D0C A;  5LVQ A;  5H1U A;  4IR6 A;  5F60 A;  5F36 A;  4O7A A;  4TQN A;  4LZR A;  4N4H A;  2RS9 B;  4CUR A;  4N4I A;  4PTB A;  4MEO A;  3IU6 A;  4UIY A;  4YAD A;  5E9K A;  5II1 A;  5TCM A;  5EGU A;  5H85 A;  5A7C A;  5DYU A;  5AMF A;  5FE4 A;  4O70 A;  2G4A A;  3UVD A;  4MR5 A;  5ENB A;  4ALG A;  4QNS A;  3I3J A;  5CRM A;  5DLZ A;  5FE3 A;  5CZG A;  5FFW A;  5ENC A;  5KTU A;  5FFY A;  5CPE A;  5BT4 A;  5F1H A;  4PCI A;  4YAB A;  5FG4 A;  4YYJ A;  2WP1 A;  3D7C A;  5CFW A;  2L5E A;  4TU6 A;  4UYG A;  5I7Y A;  5D3S A;  4NS5 A;  2MJV B;  5D3T A;  2RI7 A;  4KCX A;  2OSS A;  3S91 A;  2L84 A;  5CTL A;  5LKU A;  5EQ1 A;  5F5Z A;  5IGL A;  3UV5 A;  4UIX A;  4J0R A;  5ENH A;  4O78 A;  4YAT A;  5BT3 A;  5KO4 A;  5DFC A;  4QR3 A;  5D3N A;  4HXN A;  4TZ8 A;  5L96 A;  5DYX A;  2DVS A;  4NYW A;  4XUB A;  3RCW A;  4O71 A;  5A5N A;  4NR5 A;  4HXL A;  4OGJ A;  4QST A;  4WIV A;  5HCL A;  4UIW A;  5E9Y A;  5EWH A;  5D3H A;  4QYL A;  4YYD A;  3LQI A;  2R10 A;  4MR4 A;  2N9G A;  5E73 A;  4Z1S A;  5L8U A;  5E3G A;  2KTB B;  4Q0N A;  5I1Q A;  5E0R A;  5EP7 A;  5ETD A;  5J0D A;  3LQJ A;  2I7K A;  4BW2 A;  4PKL A;  5CP5 A;  5D25 A;  4O77 A;  3O37 A;  1JSP B;  5E74 A;  5HQ5 A;  1JM4 B;  5CUC A;  3AAD A;  5A85 A;  5A83 A;  5I40 A;  5ENG A;  4N4F A;  5IBN A;  2DVR A;  3U5L A;  4MR3 A;  5IGM A;  5F61 A;  5ENI A;  4LC2 A;  5IGK A;  2H60 A;  4TT6 A;  4O7F A;  4NR8 A;  4HXM A;  4TZ2 A;  2R0Y A;  3MB4 A;  4Z1Q A;  5F2P A;  5FDZ A;  4LR6 A;  4Z6H A;  2E7N A;  5AD3 A;  3ZYU A;  5DFB A;  5I80 A;  4AKN A;  4BJX A;  2YYN A;  5A5R A;  5FBX A;  4Z93 A;  5HQ6 A;  5DKH A;  4UYF B;  4CFL A;  5C7N A;  5CUB A;  4PCE A;  4C66 A;  4QEW A;  4HXK A;  4A9K A;  5CQA A;  5EWC A;  5FB1 A;  4YYH A;  3P1E A;  2YEK A;  3G0J A;  4NRB A;  3QZT A;  5FFV A;  4BW4 A;  4O7B A;  2DVQ A;  3P5O A;  5HM0 A;  4YH4 A;  5HEN A;  1N72 A;  4TTE A;  4UIT A;  4YYI A;  4LZS A;  5FE0 A;  4PS5 A;  1ZS5 A;  2RNY A;  5HRW A;  5KTW A;  4IR5 A;  5FE7 A;  5EIC A;  5EWW A;  5A5Q A;  3S92 A;  5H1T A;  4LZ2 A;  1E6I A;  3P1F A;  4HXR A;  4YH3 A;  5FE6 A;  4KV1 A;  5DKC A;  4E96 A;  4YAX A;  4YYN A;  5L8T A;  4NXJ A;  4RVR A;  4J0S A;  4NUC A;  5E9I A;  4UYF A;  3DAI A;  5LVR A;  5CQ5 A;  5EWV A;  4IR4 A;  4LYS A;  4NR4 A;  3IU5 A;  5II2 A;  5FE9 A;  2RO1 A;  4NYX A;  4A9H A;  4YBS A;  5TB6 A;  4TT4 A;  2FSA A;  4LYI A;  4YBM A;  2OUO A;  5E9V A;  4QZS A;  5F25 A;  2DVV A;  5F3A A;  3O36 A;  4QSU A;  3Q2F A;  5F63 A;  5C87 A;  5FH8 A;  5LJ1 A;  1F68 A;  2WP2 A;  3JVJ A;  5ENE A;  5FE2 A;  5HLS A;  2NXB A;  5DW1 A;  4XUA A;  4CL9 A;  3U5O A;  2RNX A;  2F6J A;  2I8N A;  4NUD A;  5K29 A;  3LXJ A;  5IG6 A;  5FE8 A;  5D7X A;  5F1L A;  4IOR A;  4BHW A;  4HBY A;  3UVX A;  5DX4 A;  5I83 A;  4CUQ A;  5EIS A;  4CFK A;  5DYA A;  4YYG A;  4QEU A;  5COI A;  4XYA A;  4N3W A;  4UYE A;  5E9L A;  4TYL A;  5ACY A;  2OO1 A;  5HFR A;  5DLX A;  5EV9 A;  5LJ2 A;  5KTX A;  4ZC9 A;  5AME A;  5HRV A;  5FB0 A;  5FG5 A;  3JVM A;  5F62 A;  4IOO A;  5CQ6 A;  5CUD A;  4Y03 A;  3ONI A;  4DON A;  4F3I A;  5CGP A;  4A9O A;  5DYC A;  5A5S A;  4LDF A;  5A5P A;  3UV4 A;  3DWY A;  4QR5 A;  3SVH A;  4BW1 A;  2YEM A;  3P1D A;  4O72 A;  5FG6 A;  5I7X A;  5EK9 A;  4XY9 A;  4QY4 A;  4QC1 A;  3G0L A;  3QZS A;  5CU8 A;  4A9F A;  4O7E A;  5LKT A;  4MEN A;  5D3L A;  2YDW A;  5C85 A;  4NQN A;  5C4Q A;  5FH7 A;  5A82 A;  5D3R A;  5KU3 A;  5HEM A;  4CUU A;  5HRX A;  3UW9 A;  5EI4 A;  3U5P A;  4NR9 A;  4HBW A;  4QB3 A;  4TU4 A;  4HXO A;  1X0J A;  5ENF A;  2YW5 A;  1EQF A;  3MB3 A;  4O74 A;  4TS8 A;  5C8G A;  5CQ8 A;  5DKD A;  4HBV A;  2D82 A;  3HME A;  4O7C A;  2YEL A;  5A5O A;  4UYH A;  4QBM A;  5E7D A;  4GPJ A;  5JWM A;  4QR4 A;  4XY8 A;  4A9M A;  4MR6 A;  5EM3 A;  5CRZ A;  4QC3 A;  4QEV A;  2R0S A;  4NR7 A;  3SVF A;  2L85 A;  4ZQL A;  5CUE A;  5IID A;  5D26 A;  4YY6 A;  4UIU A;  5CQ3 A;  4O75 A;  4UIZ A;  3JVL A;  4Z6I A;  2RNW A;  3NXB A;  4FLP A;  3Q2E A;  3FKM X;  3MUK A;  4HBX A;  5ETB A;  5HEL A;  3U5K A;  2DAT A;  4OUF A;  4CUT A;  3TLP A;  5HJC A;  5L98 A;  4Q0O A;  4NRC A;  3UVW A;  5FE1 A;  3QZV A;  4CUS A;  4LYW A;  4PY6 A;  5CY9 A;  5D3P A;  5EPR A;  4NUE A;  4BW3 A;  3HMF A;  4QUU A;  5LUU A;  4YBT A;  1WUM A;  5DBM A;  5D24 A;  4WHU A;  4CUP A;  2E7O A;  3UVY A;  1WUG A;  2YQD A;  3P1C A;  5BT5 A;  4QSS A;  4YYK A;  3O34 A;  2F6N A;  2LSP B;  4QSR A;  5FE5 A;  2DWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...