3JVMA

Crystal structure of bromodomain 2 of mouse brd4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
116
structure length
116
Chain Sequence
GAMGSKISEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Bromodomain-containing protein 4
publication title Structures of the Dual Bromodomains of the P-TEFb-activating Protein Brd4 at Atomic Resolution
pubmed doi rcsb
source organism Mus musculus
total genus 42
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3jvmA00
4YC9A 5IGMA 4YATA 4MR3A 5CQ4A 5I7YA 4XUAA 4J1PA 5FB0A 3S92A 5G4SA 5ENGA 5EWCA 3JVLA 1JM4B 4A9JA 4YBMA 5I89A 2DVVA 5EK9A 5D3JA 5DKHA 4LRGA 4TS8A 4HXNA 4A9EA 3LQJA 5G4RA 2DWWA 5DKDA 4HBVA 5E9YA 2RFJA 5LKZA 4NXJA 5EPRA 4NYWA 5EI4A 4YYNA 3U5OA 2L84A 4HBYA 4ZC9A 4YYDA 3U5KA 5EVAA 3UVWA 5A85A 5HLSA 4NR6A 5DLZA 5EWVA 5EM3A 5TB6A 5CZGA 4Q0OA 5HRXA 2YEMA 5KTXA 4A9MA 5CUBA 2I8NA 4YYKA 5FBXA 4J3IA 5EU1A 5EGUA 5HCLA 4YYMA 4YK0A 3P1CA 5CRMA 4HXPA 4NYVA 5HQ7A 5DYXA 5D24A 2D9EA 5C7NA 3I3JA 4BJXA 5I88A 3DAIA 5KU3A 4NUDA 4Z6HA 5F61A 5D7XA 3MUKA 4KV4A 4NQMA 4UYFA 5CQ6A 1ZS5A 2RNWA 5AD3A 2R0YA 4XY8A 5II2A 4QUUA 4UIYA 4NUEA 3HMEA 3RCWA 1N72A 5DYAA 5KTUA 5E9LA 3UVDA 3LJWA 4PTBA 4TYLA 5LJ2A 5LVQA 4QSVA 5E73A 5DW2A 5FE0A 4MEOA 5CU8A 2DATA 5H1TA 4KV1A 5IGLA 5E9VA 5HM0A 5TCMA 2OSSA 2RO1A 4QY4A 3MULA 4NR4A 2R0VA 4J0SA 3Q2FA 4LR6A 5I1QA 4BW1A 3O35A 3U5JA 5DY7A 5F2PA 3P5OA 5L98A 4IR6A 4DONA 5D3PA 3UV4A 3DWYA 5FE6A 4A9LA 2WP1A 5ETDA 5F63A 5H1UA 3U5PA 5AMEA 4LYSA 4NR9A 3UV5A 4QSRA 4Y03A 5HEMA 3QZSA 5LKXA 3U5NA 2YYNA 2E3KA 4NYXA 5L96A 2DVQA 5LVRA 3MXFA 5I80A 3SVFA 5BT4A 3JVMA 5KO4A 5DYUA 3LXJA 5CQ7A 5F25A 5JI8A 5A5QA 4CUTA 1EQFA 5D3LA 3O37A 4J0RA 4Z1QA 4PCIA 4UIZA 4CURA 4QSUA 2KTBB 4NUCA 5CRZA 5A83A 4QSWA 3MB3A 5CQ8A 4QEVA 4UYGA 5E0RA 4YY4A 4HXMA 4O7CA 5A5RA 5BT3A 2RI7A 4BW3A 2GRCA 4FLPA 4O7BA 4YH3A 2I7KA 5EISA 4A9FA 5ENFA 2DVSA 4TU4A 4IOQA 4TU6A 5CUCA 5HQ5A 3MQMA 4YAXA 5CP5A 5IIDA 5ETBA 2N9GA 5DFDA 5EPSA 4CFLA 5A5NA 4NRAA 4MENA 4PCEA 5D25A 5KHMA 4XY9A 3JVJA 5E9IA 5HENA 4QR5A 3S91A 4ZQLA 5F36A 4YH4A 5F60A 5ENHA 4KCXA 4QR4A 4QSSA 4O77A 4UYHA 5FE8A 4NRBA 5F1LA 5HFRA 4UIWA 2RS9B 5ENIA 4C66A 5L8TA 2YELA 5IG6A 4IORA 5D3RA 5CFWA 4N4HA 4PS5A 4WHWA 4QB3A 4X2IA 4LYIA 3MB4A 4XUBA 4NR5A 5FB1A 5EP7A 4N4GA 4BW4A 5CGPA 4NR8A 5D3TA 5EQ1A 5ENEA 5CUGA 3UVYA 5COIA 5FE4A 5CQ5A 5E9MA 4QSTA 5HJCA 4Q0NA 3U5LA 4LC2A 4C67A 5FE2A 2RNYA 5L99A 5A7CA 3SVHA 4HXKA 5C87A 5LJ1A 4HXOA 4QR3A 5E3DA 4GPJA 3UVXA 3P1DA 4O7AA 5DFCA 5A81A 5KTWA 5C8GA 4Z6IA 2H60A 4N4FA 4QYDA 4N3WA 4YABA 2DKWA 4TTEA 3U5MA 4TQNA 3ONIA 3ZYUA 4IR3A 4CUUA 5FDZA 4LDFA 5EPBA 5F3AA 2RNXA 5HRWA 5DX4A 4LZ2A 2LSPB 4QC1A 5EICA 4AKNA 4YADA 4YYJA 4CUQA 5C89A 5C85A 4PKLA 4WIVA 4HXRA 5CQTA 4LZSA 2OUOA 5CPEA 2E7OA 5CTLA 1F68A 3O34A 4UYEA 5A5SA 5ENJA 4OGIA 5FFVA 3G0LA 3QZVA 3AADA 5FE9A 1E6IA 3SVGA 5DLXA 4HBWA 4MR5A 4XYAA 5DFBA 5L97A 5DW1A 5A82A 5CY9A 4QC3A 5IBNA 5DYCA 4CFKA 5CUEA 1X0JA 5LKUA 3K2JA 4QYLA 5FG4A 4NQNA 3G0JA 2R10A 5FH6A 5H1VA 5AD2A 4UITA 2G4AA 4TZ2A 4UYFB 2YQDA 5D26A 5DKCA 4UIVA 4BW2A 3HMHA 5FFWA 4TZ8A 3JVKA 5D3SA 2OO1A 4O7EA 4UIXA 3NXBA 2NXBA 4O75A 3FKMX 4A9IA 4QSXA 2YDWA 5E3GA 4YBSA 5HFQA 5FE1A 4IOOA 4A9OA 4HXLA 5CS8A 4MR4A 4E96A 4YYIA 5EWHA 4QNSA 4LYWA 5CQAA 5E74A 4ZW1A 5LKTA 4OUFA 5F1HA 5AMFA 5CUDA 5LUUA 5D0CA 5FE7A 4IR5A 2DVRA 5EWDA 4O76A 5I7XA 5F62A 4MEQA 4HXSA 5A5PA 4N4IA 3GG3A 3TLPA 3IU6A 4TT6A 5ENBA 4QBMA 4CL9A 3HMFA 5I83A 5HQ6A 4BHWA 4HBXA 5HELA 4A9KA 5BT5A 4YYGA 2FSAA 4O78A 4CLBA 4A9HA 3P1FA 5IGNA 3Q2EA 5IGKA 4CUPA 3D7CA 4NS5A 2MJVB 5FH8A 3IU5A 3LQIA 5CQ3A 5FE3A 5K29A 2L5EA 5FG5A 2YEKA 4A9NA 4UYDA 4PY6A 5ACYA 5FH7A 5JWMA 4MR6A 3UV2A 3O33A 4QEWA 5A5OA 2YW5A 4Z1SA 3LQHA 4MEPA 5I29A 2R0SA 4NRCA 5HRVA 4QUTA 4TT2A 5FE5A 3QZTA 4CUSA 5EV9A 2L85A 3UW9A 4YY6A 5J0DA 5D3HA 4ALHA 5FFYA 4QSQA 5EWWA 5FG6A 1JSPB 5H85A 4QZSA 4LZRA 5I86A 4Z93A 4O70A 4O7FA 5EA1A 4ALGA 5I40A 4O71A 4QSPA 5LJ0A 4OGJA 2F6NA 4NR7A 4QEUA 5ENCA 3O36A 3P1EA 5E7DA 1WUGA 4RVRA 1WUMA 5F5ZA 5D3NA 5CUAA 4UIUA 2D82A 4F3IA 2F6JA 4O72A 2WP2A 3AQAA 4O74A 2E7NA 5II1A 4YYHA 4WHUA 4TT4A 4YBTA 5DBMA 4IR4A 5L8UA 5C4QA 5E9KA
chains in the Genus database with same CATH superfamily
4YC9A 5IGMA 4YATA 4MR3A 5CQ4A 5I7YA 4XUAA 4J1PA 5FB0A 3S92A 5G4SA 5ENGA 5EWCA 3JVLA 1JM4B 4A9JA 4YBMA 5I89A 2DVVA 5EK9A 5D3JA 5DKHA 4LRGA 4TS8A 4HXNA 4A9EA 3LQJA 5G4RA 2DWWA 5DKDA 4HBVA 5E9YA 2RFJA 5LKZA 4NXJA 5EPRA 4NYWA 5EI4A 4YYNA 3U5OA 2L84A 4HBYA 4ZC9A 4YYDA 3U5KA 5EVAA 3UVWA 5A85A 5HLSA 4NR6A 5DLZA 5EWVA 5EM3A 5TB6A 5CZGA 4Q0OA 5HRXA 2YEMA 5KTXA 4A9MA 5CUBA 2I8NA 4YYKA 5FBXA 4J3IA 5EU1A 5EGUA 5HCLA 4YYMA 4YK0A 3P1CA 5CRMA 4HXPA 4NYVA 5HQ7A 5DYXA 5D24A 2D9EA 5C7NA 3I3JA 4BJXA 5I88A 4AI6A 3DAIA 5KU3A 4NUDA 4Z6HA 5F61A 5D7XA 3MUKA 4KV4A 4NQMA 4UYFA 5CQ6A 1ZS5A 2RNWA 5AD3A 2R0YA 4XY8A 5II2A 4QUUA 4UIYA 4NUEA 3HMEA 3RCWA 1N72A 5DYAA 5KTUA 5E9LA 3UVDA 3LJWA 4PTBA 4TYLA 5LJ2A 5LVQA 4QSVA 5E73A 5DW2A 5FE0A 4MEOA 5CU8A 2DATA 5H1TA 4KV1A 5IGLA 5E9VA 5HM0A 5TCMA 2OSSA 2RO1A 4QY4A 3MULA 4NR4A 2R0VA 4J0SA 3Q2FA 4LR6A 5I1QA 4BW1A 3O35A 3U5JA 5DY7A 5F2PA 3P5OA 5L98A 4IR6A 4DONA 5D3PA 3UV4A 3DWYA 5FE6A 4A9LA 2WP1A 5ETDA 5F63A 5H1UA 3U5PA 5AMEA 4LYSA 4NR9A 3UV5A 4QSRA 4Y03A 5HEMA 3QZSA 2EJNA 5LKXA 2YYNA 3U5NA 2E3KA 4NYXA 5L96A 2DVQA 5LVRA 3MXFA 5I80A 3SVFA 5BT4A 3JVMA 5KO4A 5DYUA 3LXJA 5CQ7A 4AKHA 5F25A 5JI8A 5A5QA 4CUTA 1EQFA 5D3LA 3O37A 4J0RA 4Z1QA 4PCIA 4UIZA 4CURA 4QSUA 2KTBB 4NUCA 5CRZA 5A83A 4QSWA 3MB3A 5CQ8A 4QEVA 4UYGA 5E0RA 4YY4A 4AKIA 4HXMA 4O7CA 5A5RA 5BT3A 2RI7A 4BW3A 2GRCA 4FLPA 4O7BA 4YH3A 2I7KA 5EISA 4A9FA 5ENFA 2DVSA 4TU4A 4IOQA 4TU6A 5CUCA 5HQ5A 3MQMA 4YAXA 5CP5A 5IIDA 5ETBA 2N9GA 5DFDA 5EPSA 4CFLA 5A5NA 4NRAA 4MENA 4PCEA 5D25A 5KHMA 4XY9A 3JVJA 5E9IA 5HENA 4QR5A 3S91A 4ZQLA 5F36A 4YH4A 3VKHA 5F60A 5ENHA 4KCXA 4QR4A 4QSSA 4O77A 4UYHA 5FE8A 4NRBA 5F1LA 5HFRA 4UIWA 2RS9B 5ENIA 4C66A 5L8TA 2YELA 5IG6A 4IORA 5D3RA 5CFWA 4N4HA 4PS5A 4WHWA 4QB3A 4X2IA 4LYIA 3MB4A 4XUBA 4NR5A 5FB1A 4AKGA 5EP7A 4N4GA 4BW4A 5CGPA 4NR8A 5D3TA 5EQ1A 5ENEA 3VKGA 5CUGA 3UVYA 5COIA 5FE4A 5CQ5A 5E9MA 4QSTA 5HJCA 4Q0NA 3U5LA 4LC2A 4C67A 5FE2A 3ERRA 2RNYA 5L99A 5A7CA 3SVHA 4HXKA 5C87A 5LJ1A 4HXOA 4QR3A 5E3DA 4GPJA 3UVXA 3P1DA 4O7AA 5DFCA 5A81A 5KTWA 5C8GA 4Z6IA 2H60A 4N4FA 4QYDA 4N3WA 4YABA 2DKWA 4TTEA 3U5MA 4TQNA 3ONIA 3ZYUA 4IR3A 4CUUA 5FDZA 4LDFA 5EPBA 5F3AA 2RNXA 5HRWA 5DX4A 4LZ2A 2LSPB 4QC1A 5EICA 4AKNA 4YADA 4YYJA 4CUQA 5C89A 5C85A 4PKLA 4WIVA 4HXRA 5CQTA 4LZSA 2OUOA 5CPEA 2E7OA 3D1BA 5CTLA 1F68A 3O34A 4UYEA 5A5SA 5ENJA 4OGIA 5FFVA 3G0LA 3QZVA 3AADA 5FE9A 1E6IA 3SVGA 5DLXA 4HBWA 4MR5A 4XYAA 5DFBA 5L97A 5DW1A 5A82A 5CY9A 4QC3A 5IBNA 5DYCA 4CFKA 5CUEA 1X0JA 5LKUA 3K2JA 4QYLA 5FG4A 4NQNA 3G0JA 2R10A 5FH6A 5H1VA 5AD2A 4UITA 2G4AA 4TZ2A 4UYFB 2YQDA 5D26A 3D1DA 5DKCA 4UIVA 4BW2A 3HMHA 5FFWA 4TZ8A 3JVKA 5D3SA 2OO1A 4O7EA 4UIXA 3NXBA 2NXBA 4O75A 3FKMX 4A9IA 4QSXA 2YDWA 5E3GA 4YBSA 5HFQA 5FE1A 4IOOA 4A9OA 4HXLA 5CS8A 4MR4A 4E96A 4YYIA 5EWHA 4QNSA 4LYWA 5CQAA 5E74A 4ZW1A 5LKTA 4OUFA 5F1HA 5AMFA 5CUDA 5LUUA 5D0CA 5FE7A 4IR5A 2DVRA 5EWDA 4O76A 5I7XA 5F62A 1PUOA 4MEQA 4HXSA 5A5PA 4N4IA 3GG3A 3TLPA 3IU6A 4TT6A 5ENBA 4QBMA 4CL9A 3HMFA 5I83A 5HQ6A 4BHWA 4HBXA 5HELA 4A9KA 5BT5A 4YYGA 2FSAA 4O78A 4CLBA 4A9HA 3P1FA 5IGNA 3Q2EA 5IGKA 4CUPA 3D7CA 4NS5A 2MJVB 5FH8A 3IU5A 3LQIA 5CQ3A 5FE3A 5K29A 2L5EA 5FG5A 2YEKA 4A9NA 4UYDA 4PY6A 5ACYA 5FH7A 5JWMA 4MR6A 3UV2A 3O33A 4QEWA 5A5OA 2YW5A 4Z1SA 3LQHA 4MEPA 5I29A 2R0SA 4NRCA 5HRVA 4QUTA 4TT2A 5FE5A 3QZTA 4CUSA 5EV9A 2L85A 3UW9A 4YY6A 5J0DA 5D3HA 4ALHA 5FFYA 4QSQA 5EWWA 5FG6A 1JSPB 5H85A 4QZSA 4LZRA 5I86A 4Z93A 4O70A 4O7FA 5EA1A 4ALGA 5I40A 4O71A 4QSPA 5LJ0A 4OGJA 2F6NA 4NR7A 4QEUA 1ZKRA 5ENCA 3O36A 3P1EA 5E7DA 1WUGA 4RVRA 1WUMA 5F5ZA 5D3NA 5CUAA 4UIUA 2D82A 4F3IA 2F6JA 4O72A 2WP2A 3AQAA 4O74A 2E7NA 5II1A 4YYHA 4WHUA 4TT4A 4YBTA 5DBMA 4IR4A 5L8UA 5C4QA 5E9KA
chains in the Genus database with same CATH topology
4YC9A 5IGMA 4YATA 4MR3A 5CQ4A 5I7YA 4XUAA 4J1PA 5FB0A 3S92A 5G4SA 5ENGA 5EWCA 3JVLA 1JM4B 4A9JA 4YBMA 5I89A 2DVVA 5EK9A 5D3JA 5DKHA 4LRGA 4TS8A 4HXNA 4A9EA 3LQJA 5G4RA 2DWWA 5DKDA 4HBVA 5E9YA 2RFJA 5LKZA 4NXJA 5EPRA 4NYWA 5EI4A 4YYNA 3U5OA 2L84A 4HBYA 4ZC9A 4YYDA 3U5KA 5EVAA 3UVWA 5A85A 5HLSA 4NR6A 5DLZA 5EWVA 5EM3A 5TB6A 5CZGA 4Q0OA 5HRXA 2YEMA 5KTXA 4A9MA 5CUBA 2I8NA 4YYKA 5FBXA 4J3IA 5EU1A 5EGUA 5HCLA 4YYMA 4YK0A 3P1CA 5CRMA 4HXPA 4NYVA 5HQ7A 5DYXA 5D24A 2D9EA 5C7NA 3I3JA 4BJXA 5I88A 3DAIA 5KU3A 4NUDA 4Z6HA 5F61A 5D7XA 3MUKA 4KV4A 4NQMA 4UYFA 5CQ6A 1ZS5A 2RNWA 5AD3A 2R0YA 4XY8A 5II2A 4QUUA 4UIYA 4NUEA 3HMEA 3RCWA 1N72A 5DYAA 5KTUA 5E9LA 3UVDA 3LJWA 4PTBA 4TYLA 5LJ2A 5LVQA 4QSVA 5E73A 5DW2A 5FE0A 4MEOA 5CU8A 2DATA 5H1TA 4KV1A 5IGLA 5E9VA 5HM0A 5TCMA 2OSSA 2RO1A 4QY4A 3MULA 4NR4A 2R0VA 4J0SA 3Q2FA 4LR6A 5I1QA 4BW1A 3O35A 3U5JA 5DY7A 5F2PA 3P5OA 5L98A 4IR6A 4DONA 5D3PA 3UV4A 3DWYA 5FE6A 4A9LA 2WP1A 5ETDA 5F63A 5H1UA 3U5PA 5AMEA 4LYSA 4NR9A 3UV5A 4QSRA 4Y03A 5HEMA 3QZSA 5LKXA 3U5NA 2YYNA 2E3KA 4NYXA 5L96A 2DVQA 5LVRA 3MXFA 5I80A 3SVFA 5BT4A 3JVMA 5KO4A 5DYUA 3LXJA 5CQ7A 5F25A 5JI8A 5A5QA 4CUTA 1EQFA 5D3LA 3O37A 4J0RA 4Z1QA 4PCIA 4UIZA 4CURA 4QSUA 2KTBB 4NUCA 5CRZA 5A83A 4QSWA 3MB3A 5CQ8A 4QEVA 4UYGA 5E0RA 4YY4A 4HXMA 4O7CA 5A5RA 5BT3A 2RI7A 4BW3A 2GRCA 4FLPA 4O7BA 4YH3A 2I7KA 5EISA 4A9FA 5ENFA 2DVSA 4TU4A 4IOQA 4TU6A 5CUCA 5HQ5A 3MQMA 4YAXA 5CP5A 5IIDA 5ETBA 2N9GA 5DFDA 5EPSA 4CFLA 5A5NA 4NRAA 4MENA 4PCEA 5D25A 5KHMA 4XY9A 3JVJA 5E9IA 5HENA 4QR5A 3S91A 4ZQLA 5F36A 4YH4A 5F60A 5ENHA 4KCXA 4QR4A 4QSSA 4O77A 4UYHA 5FE8A 4NRBA 5F1LA 5HFRA 4UIWA 2RS9B 5ENIA 4C66A 5L8TA 2YELA 5IG6A 4IORA 5D3RA 5CFWA 4N4HA 4PS5A 4WHWA 4QB3A 4X2IA 4LYIA 3MB4A 4XUBA 4NR5A 5FB1A 5EP7A 4N4GA 4BW4A 5CGPA 4NR8A 5D3TA 5EQ1A 5ENEA 5CUGA 3UVYA 5COIA 5FE4A 5CQ5A 5E9MA 4QSTA 5HJCA 4Q0NA 3U5LA 4LC2A 4C67A 5FE2A 2RNYA 5L99A 5A7CA 3SVHA 4HXKA 5C87A 5LJ1A 4HXOA 4QR3A 5E3DA 4GPJA 3UVXA 3P1DA 4O7AA 5DFCA 5A81A 5KTWA 5C8GA 4Z6IA 2H60A 4N4FA 4QYDA 4N3WA 4YABA 2DKWA 4TTEA 3U5MA 4TQNA 3ONIA 3ZYUA 4IR3A 4CUUA 5FDZA 4LDFA 5EPBA 5F3AA 2RNXA 5HRWA 5DX4A 4LZ2A 2LSPB 4QC1A 5EICA 4AKNA 4YADA 4YYJA 4CUQA 5C89A 5C85A 4PKLA 4WIVA 4HXRA 5CQTA 4LZSA 2OUOA 5CPEA 2E7OA 5CTLA 1F68A 3O34A 4UYEA 5A5SA 5ENJA 4OGIA 5FFVA 3G0LA 3QZVA 3AADA 5FE9A 1E6IA 3SVGA 5DLXA 4HBWA 4MR5A 4XYAA 5DFBA 5L97A 5DW1A 5A82A 5CY9A 4QC3A 5IBNA 5DYCA 4CFKA 5CUEA 1X0JA 5LKUA 3K2JA 4QYLA 5FG4A 4NQNA 3G0JA 2R10A 5FH6A 5H1VA 5AD2A 4UITA 2G4AA 4TZ2A 4UYFB 2YQDA 5D26A 5DKCA 4UIVA 4BW2A 3HMHA 5FFWA 4TZ8A 3JVKA 5D3SA 2OO1A 4O7EA 4UIXA 3NXBA 2NXBA 4O75A 3FKMX 4A9IA 4QSXA 2YDWA 5E3GA 4YBSA 5HFQA 5FE1A 4IOOA 4A9OA 4HXLA 5CS8A 4MR4A 4E96A 4YYIA 5EWHA 4QNSA 4LYWA 5CQAA 5E74A 4ZW1A 5LKTA 4OUFA 5F1HA 5AMFA 5CUDA 5LUUA 5D0CA 5FE7A 4IR5A 2DVRA 5EWDA 4O76A 5I7XA 5F62A 4MEQA 4HXSA 5A5PA 4N4IA 3GG3A 3TLPA 3IU6A 4TT6A 5ENBA 4QBMA 4CL9A 3HMFA 5I83A 5HQ6A 4BHWA 4HBXA 5HELA 4A9KA 5BT5A 4YYGA 2FSAA 4O78A 4CLBA 4A9HA 3P1FA 5IGNA 3Q2EA 5IGKA 4CUPA 3D7CA 4NS5A 2MJVB 5FH8A 3IU5A 3LQIA 5CQ3A 5FE3A 5K29A 2L5EA 5FG5A 2YEKA 4A9NA 4UYDA 4PY6A 5ACYA 5FH7A 5JWMA 4MR6A 3UV2A 3O33A 4QEWA 5A5OA 2YW5A 4Z1SA 3LQHA 4MEPA 5I29A 2R0SA 4NRCA 5HRVA 4QUTA 4TT2A 5FE5A 3QZTA 4CUSA 5EV9A 2L85A 3UW9A 4YY6A 5J0DA 5D3HA 4ALHA 5FFYA 4QSQA 5EWWA 5FG6A 1JSPB 5H85A 4QZSA 4LZRA 5I86A 4Z93A 4O70A 4O7FA 5EA1A 4ALGA 5I40A 4O71A 4QSPA 5LJ0A 4OGJA 2F6NA 4NR7A 4QEUA 5ENCA 3O36A 3P1EA 5E7DA 1WUGA 4RVRA 1WUMA 5F5ZA 5D3NA 5CUAA 4UIUA 2D82A 4F3IA 2F6JA 4O72A 2WP2A 3AQAA 4O74A 2E7NA 5II1A 4YYHA 4WHUA 4TT4A 4YBTA 5DBMA 4IR4A 5L8UA 5C4QA 5E9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YC9 A;  5IGM A;  4YAT A;  4MR3 A;  5CQ4 A;  5I7Y A;  4XUA A;  4J1P A;  5FB0 A;  3S92 A;  5G4S A;  5ENG A;  5EWC A;  3JVL A;  1JM4 B;  4A9J A;  4YBM A;  5I89 A;  2DVV A;  5EK9 A;  5D3J A;  5DKH A;  4LRG A;  4TS8 A;  4HXN A;  4A9E A;  3LQJ A;  5G4R A;  2DWW A;  5DKD A;  4HBV A;  5E9Y A;  2RFJ A;  5LKZ A;  4NXJ A;  5EPR A;  4NYW A;  5EI4 A;  4YYN A;  3U5O A;  2L84 A;  4HBY A;  4ZC9 A;  4YYD A;  3U5K A;  5EVA A;  3UVW A;  5A85 A;  5HLS A;  4NR6 A;  5DLZ A;  5EWV A;  5EM3 A;  5TB6 A;  5CZG A;  4Q0O A;  5HRX A;  2YEM A;  5KTX A;  4A9M A;  5CUB A;  2I8N A;  4YYK A;  5FBX A;  4J3I A;  5EU1 A;  5EGU A;  5HCL A;  4YYM A;  4YK0 A;  3P1C A;  5CRM A;  4HXP A;  4NYV A;  5HQ7 A;  5DYX A;  5D24 A;  2D9E A;  5C7N A;  3I3J A;  4BJX A;  5I88 A;  3DAI A;  5KU3 A;  4NUD A;  4Z6H A;  5F61 A;  5D7X A;  3MUK A;  4KV4 A;  4NQM A;  4UYF A;  5CQ6 A;  1ZS5 A;  2RNW A;  5AD3 A;  2R0Y A;  4XY8 A;  5II2 A;  4QUU A;  4UIY A;  4NUE A;  3HME A;  3RCW A;  1N72 A;  5DYA A;  5KTU A;  5E9L A;  3UVD A;  3LJW A;  4PTB A;  4TYL A;  5LJ2 A;  5LVQ A;  4QSV A;  5E73 A;  5DW2 A;  5FE0 A;  4MEO A;  5CU8 A;  2DAT A;  5H1T A;  4KV1 A;  5IGL A;  5E9V A;  5HM0 A;  5TCM A;  2OSS A;  2RO1 A;  4QY4 A;  3MUL A;  4NR4 A;  2R0V A;  4J0S A;  3Q2F A;  4LR6 A;  5I1Q A;  4BW1 A;  3O35 A;  3U5J A;  5DY7 A;  5F2P A;  3P5O A;  5L98 A;  4IR6 A;  4DON A;  5D3P A;  3UV4 A;  3DWY A;  5FE6 A;  4A9L A;  2WP1 A;  5ETD A;  5F63 A;  5H1U A;  3U5P A;  5AME A;  4LYS A;  4NR9 A;  3UV5 A;  4QSR A;  4Y03 A;  5HEM A;  3QZS A;  5LKX A;  3U5N A;  2YYN A;  2E3K A;  4NYX A;  5L96 A;  2DVQ A;  5LVR A;  3MXF A;  5I80 A;  3SVF A;  5BT4 A;  3JVM A;  5KO4 A;  5DYU A;  3LXJ A;  5CQ7 A;  5F25 A;  5JI8 A;  5A5Q A;  4CUT A;  1EQF A;  5D3L A;  3O37 A;  4J0R A;  4Z1Q A;  4PCI A;  4UIZ A;  4CUR A;  4QSU A;  2KTB B;  4NUC A;  5CRZ A;  5A83 A;  4QSW A;  3MB3 A;  5CQ8 A;  4QEV A;  4UYG A;  5E0R A;  4YY4 A;  4HXM A;  4O7C A;  5A5R A;  5BT3 A;  2RI7 A;  4BW3 A;  2GRC A;  4FLP A;  4O7B A;  4YH3 A;  2I7K A;  5EIS A;  4A9F A;  5ENF A;  2DVS A;  4TU4 A;  4IOQ A;  4TU6 A;  5CUC A;  5HQ5 A;  3MQM A;  4YAX A;  5CP5 A;  5IID A;  5ETB A;  2N9G A;  5DFD A;  5EPS A;  4CFL A;  5A5N A;  4NRA A;  4MEN A;  4PCE A;  5D25 A;  5KHM A;  4XY9 A;  3JVJ A;  5E9I A;  5HEN A;  4QR5 A;  3S91 A;  4ZQL A;  5F36 A;  4YH4 A;  5F60 A;  5ENH A;  4KCX A;  4QR4 A;  4QSS A;  4O77 A;  4UYH A;  5FE8 A;  4NRB A;  5F1L A;  5HFR A;  4UIW A;  2RS9 B;  5ENI A;  4C66 A;  5L8T A;  2YEL A;  5IG6 A;  4IOR A;  5D3R A;  5CFW A;  4N4H A;  4PS5 A;  4WHW A;  4QB3 A;  4X2I A;  4LYI A;  3MB4 A;  4XUB A;  4NR5 A;  5FB1 A;  5EP7 A;  4N4G A;  4BW4 A;  5CGP A;  4NR8 A;  5D3T A;  5EQ1 A;  5ENE A;  5CUG A;  3UVY A;  5COI A;  5FE4 A;  5CQ5 A;  5E9M A;  4QST A;  5HJC A;  4Q0N A;  3U5L A;  4LC2 A;  4C67 A;  5FE2 A;  2RNY A;  5L99 A;  5A7C A;  3SVH A;  4HXK A;  5C87 A;  5LJ1 A;  4HXO A;  4QR3 A;  5E3D A;  4GPJ A;  3UVX A;  3P1D A;  4O7A A;  5DFC A;  5A81 A;  5KTW A;  5C8G A;  4Z6I A;  2H60 A;  4N4F A;  4QYD A;  4N3W A;  4YAB A;  2DKW A;  4TTE A;  3U5M A;  4TQN A;  3ONI A;  3ZYU A;  4IR3 A;  4CUU A;  5FDZ A;  4LDF A;  5EPB A;  5F3A A;  2RNX A;  5HRW A;  5DX4 A;  4LZ2 A;  2LSP B;  4QC1 A;  5EIC A;  4AKN A;  4YAD A;  4YYJ A;  4CUQ A;  5C89 A;  5C85 A;  4PKL A;  4WIV A;  4HXR A;  5CQT A;  4LZS A;  2OUO A;  5CPE A;  2E7O A;  5CTL A;  1F68 A;  3O34 A;  4UYE A;  5A5S A;  5ENJ A;  4OGI A;  5FFV A;  3G0L A;  3QZV A;  3AAD A;  5FE9 A;  1E6I A;  3SVG A;  5DLX A;  4HBW A;  4MR5 A;  4XYA A;  5DFB A;  5L97 A;  5DW1 A;  5A82 A;  5CY9 A;  4QC3 A;  5IBN A;  5DYC A;  4CFK A;  5CUE A;  1X0J A;  5LKU A;  3K2J A;  4QYL A;  5FG4 A;  4NQN A;  3G0J A;  2R10 A;  5FH6 A;  5H1V A;  5AD2 A;  4UIT A;  2G4A A;  4TZ2 A;  4UYF B;  2YQD A;  5D26 A;  5DKC A;  4UIV A;  4BW2 A;  3HMH A;  5FFW A;  4TZ8 A;  3JVK A;  5D3S A;  2OO1 A;  4O7E A;  4UIX A;  3NXB A;  2NXB A;  4O75 A;  3FKM X;  4A9I A;  4QSX A;  2YDW A;  5E3G A;  4YBS A;  5HFQ A;  5FE1 A;  4IOO A;  4A9O A;  4HXL A;  5CS8 A;  4MR4 A;  4E96 A;  4YYI A;  5EWH A;  4QNS A;  4LYW A;  5CQA A;  5E74 A;  4ZW1 A;  5LKT A;  4OUF A;  5F1H A;  5AMF A;  5CUD A;  5LUU A;  5D0C A;  5FE7 A;  4IR5 A;  2DVR A;  5EWD A;  4O76 A;  5I7X A;  5F62 A;  4MEQ A;  4HXS A;  5A5P A;  4N4I A;  3GG3 A;  3TLP A;  3IU6 A;  4TT6 A;  5ENB A;  4QBM A;  4CL9 A;  3HMF A;  5I83 A;  5HQ6 A;  4BHW A;  4HBX A;  5HEL A;  4A9K A;  5BT5 A;  4YYG A;  2FSA A;  4O78 A;  4CLB A;  4A9H A;  3P1F A;  5IGN A;  3Q2E A;  5IGK A;  4CUP A;  3D7C A;  4NS5 A;  2MJV B;  5FH8 A;  3IU5 A;  3LQI A;  5CQ3 A;  5FE3 A;  5K29 A;  2L5E A;  5FG5 A;  2YEK A;  4A9N A;  4UYD A;  4PY6 A;  5ACY A;  5FH7 A;  5JWM A;  4MR6 A;  3UV2 A;  3O33 A;  4QEW A;  5A5O A;  2YW5 A;  4Z1S A;  3LQH A;  4MEP A;  5I29 A;  2R0S A;  4NRC A;  5HRV A;  4QUT A;  4TT2 A;  5FE5 A;  3QZT A;  4CUS A;  5EV9 A;  2L85 A;  3UW9 A;  4YY6 A;  5J0D A;  5D3H A;  4ALH A;  5FFY A;  4QSQ A;  5EWW A;  5FG6 A;  1JSP B;  5H85 A;  4QZS A;  4LZR A;  5I86 A;  4Z93 A;  4O70 A;  4O7F A;  5EA1 A;  4ALG A;  5I40 A;  4O71 A;  4QSP A;  5LJ0 A;  4OGJ A;  2F6N A;  4NR7 A;  4QEU A;  5ENC A;  3O36 A;  3P1E A;  5E7D A;  1WUG A;  4RVR A;  1WUM A;  5F5Z A;  5D3N A;  5CUA A;  4UIU A;  2D82 A;  4F3I A;  2F6J A;  4O72 A;  2WP2 A;  3AQA A;  4O74 A;  2E7N A;  5II1 A;  4YYH A;  4WHU A;  4TT4 A;  4YBT A;  5DBM A;  4IR4 A;  5L8U A;  5C4Q A;  5E9K A; 
#chains in the Genus database with same CATH topology
 4YC9 A;  5IGM A;  4YAT A;  4MR3 A;  5CQ4 A;  5I7Y A;  4XUA A;  4J1P A;  5FB0 A;  3S92 A;  5G4S A;  5ENG A;  5EWC A;  3JVL A;  1JM4 B;  4A9J A;  4YBM A;  5I89 A;  2DVV A;  5EK9 A;  5D3J A;  5DKH A;  4LRG A;  4TS8 A;  4HXN A;  4A9E A;  3LQJ A;  5G4R A;  2DWW A;  5DKD A;  4HBV A;  5E9Y A;  2RFJ A;  5LKZ A;  4NXJ A;  5EPR A;  4NYW A;  5EI4 A;  4YYN A;  3U5O A;  2L84 A;  4HBY A;  4ZC9 A;  4YYD A;  3U5K A;  5EVA A;  3UVW A;  5A85 A;  5HLS A;  4NR6 A;  5DLZ A;  5EWV A;  5EM3 A;  5TB6 A;  5CZG A;  4Q0O A;  5HRX A;  2YEM A;  5KTX A;  4A9M A;  5CUB A;  2I8N A;  4YYK A;  5FBX A;  4J3I A;  5EU1 A;  5EGU A;  5HCL A;  4YYM A;  4YK0 A;  3P1C A;  5CRM A;  4HXP A;  4NYV A;  5HQ7 A;  5DYX A;  5D24 A;  2D9E A;  5C7N A;  3I3J A;  4BJX A;  5I88 A;  4AI6 A;  3DAI A;  5KU3 A;  4NUD A;  4Z6H A;  5F61 A;  5D7X A;  3MUK A;  4KV4 A;  4NQM A;  4UYF A;  5CQ6 A;  1ZS5 A;  2RNW A;  5AD3 A;  2R0Y A;  4XY8 A;  5II2 A;  4QUU A;  4UIY A;  4NUE A;  3HME A;  3RCW A;  1N72 A;  5DYA A;  5KTU A;  5E9L A;  3UVD A;  3LJW A;  4PTB A;  4TYL A;  5LJ2 A;  5LVQ A;  4QSV A;  5E73 A;  5DW2 A;  5FE0 A;  4MEO A;  5CU8 A;  2DAT A;  5H1T A;  4KV1 A;  5IGL A;  5E9V A;  5HM0 A;  5TCM A;  2OSS A;  2RO1 A;  4QY4 A;  3MUL A;  4NR4 A;  2R0V A;  4J0S A;  3Q2F A;  4LR6 A;  5I1Q A;  4BW1 A;  3O35 A;  3U5J A;  5DY7 A;  5F2P A;  3P5O A;  5L98 A;  4IR6 A;  4DON A;  5D3P A;  3UV4 A;  3DWY A;  5FE6 A;  4A9L A;  2WP1 A;  5ETD A;  5F63 A;  5H1U A;  3U5P A;  5AME A;  4LYS A;  4NR9 A;  3UV5 A;  4QSR A;  4Y03 A;  5HEM A;  3QZS A;  2EJN A;  5LKX A;  2YYN A;  3U5N A;  2E3K A;  4NYX A;  5L96 A;  2DVQ A;  5LVR A;  3MXF A;  5I80 A;  3SVF A;  5BT4 A;  3JVM A;  5KO4 A;  5DYU A;  3LXJ A;  5CQ7 A;  4AKH A;  5F25 A;  5JI8 A;  5A5Q A;  4CUT A;  1EQF A;  5D3L A;  3O37 A;  4J0R A;  4Z1Q A;  4PCI A;  4UIZ A;  4CUR A;  4QSU A;  2KTB B;  4NUC A;  5CRZ A;  5A83 A;  4QSW A;  3MB3 A;  5CQ8 A;  4QEV A;  4UYG A;  5E0R A;  4YY4 A;  4AKI A;  4HXM A;  4O7C A;  5A5R A;  5BT3 A;  2RI7 A;  4BW3 A;  2GRC A;  4FLP A;  4O7B A;  4YH3 A;  2I7K A;  5EIS A;  4A9F A;  5ENF A;  2DVS A;  4TU4 A;  4IOQ A;  4TU6 A;  5CUC A;  5HQ5 A;  3MQM A;  4YAX A;  5CP5 A;  5IID A;  5ETB A;  2N9G A;  5DFD A;  5EPS A;  4CFL A;  5A5N A;  4NRA A;  4MEN A;  4PCE A;  5D25 A;  5KHM A;  4XY9 A;  3JVJ A;  5E9I A;  5HEN A;  4QR5 A;  3S91 A;  4ZQL A;  5F36 A;  4YH4 A;  3VKH A;  5F60 A;  5ENH A;  4KCX A;  4QR4 A;  4QSS A;  4O77 A;  4UYH A;  5FE8 A;  4NRB A;  5F1L A;  5HFR A;  4UIW A;  2RS9 B;  5ENI A;  4C66 A;  5L8T A;  2YEL A;  5IG6 A;  4IOR A;  5D3R A;  5CFW A;  4N4H A;  4PS5 A;  4WHW A;  4QB3 A;  4X2I A;  4LYI A;  3MB4 A;  4XUB A;  4NR5 A;  5FB1 A;  4AKG A;  5EP7 A;  4N4G A;  4BW4 A;  5CGP A;  4NR8 A;  5D3T A;  5EQ1 A;  5ENE A;  3VKG A;  5CUG A;  3UVY A;  5COI A;  5FE4 A;  5CQ5 A;  5E9M A;  4QST A;  5HJC A;  4Q0N A;  3U5L A;  4LC2 A;  4C67 A;  5FE2 A;  3ERR A;  2RNY A;  5L99 A;  5A7C A;  3SVH A;  4HXK A;  5C87 A;  5LJ1 A;  4HXO A;  4QR3 A;  5E3D A;  4GPJ A;  3UVX A;  3P1D A;  4O7A A;  5DFC A;  5A81 A;  5KTW A;  5C8G A;  4Z6I A;  2H60 A;  4N4F A;  4QYD A;  4N3W A;  4YAB A;  2DKW A;  4TTE A;  3U5M A;  4TQN A;  3ONI A;  3ZYU A;  4IR3 A;  4CUU A;  5FDZ A;  4LDF A;  5EPB A;  5F3A A;  2RNX A;  5HRW A;  5DX4 A;  4LZ2 A;  2LSP B;  4QC1 A;  5EIC A;  4AKN A;  4YAD A;  4YYJ A;  4CUQ A;  5C89 A;  5C85 A;  4PKL A;  4WIV A;  4HXR A;  5CQT A;  4LZS A;  2OUO A;  5CPE A;  2E7O A;  3D1B A;  5CTL A;  1F68 A;  3O34 A;  4UYE A;  5A5S A;  5ENJ A;  4OGI A;  5FFV A;  3G0L A;  3QZV A;  3AAD A;  5FE9 A;  1E6I A;  3SVG A;  5DLX A;  4HBW A;  4MR5 A;  4XYA A;  5DFB A;  5L97 A;  5DW1 A;  5A82 A;  5CY9 A;  4QC3 A;  5IBN A;  5DYC A;  4CFK A;  5CUE A;  1X0J A;  5LKU A;  3K2J A;  4QYL A;  5FG4 A;  4NQN A;  3G0J A;  2R10 A;  5FH6 A;  5H1V A;  5AD2 A;  4UIT A;  2G4A A;  4TZ2 A;  4UYF B;  2YQD A;  5D26 A;  3D1D A;  5DKC A;  4UIV A;  4BW2 A;  3HMH A;  5FFW A;  4TZ8 A;  3JVK A;  5D3S A;  2OO1 A;  4O7E A;  4UIX A;  3NXB A;  2NXB A;  4O75 A;  3FKM X;  4A9I A;  4QSX A;  2YDW A;  5E3G A;  4YBS A;  5HFQ A;  5FE1 A;  4IOO A;  4A9O A;  4HXL A;  5CS8 A;  4MR4 A;  4E96 A;  4YYI A;  5EWH A;  4QNS A;  4LYW A;  5CQA A;  5E74 A;  4ZW1 A;  5LKT A;  4OUF A;  5F1H A;  5AMF A;  5CUD A;  5LUU A;  5D0C A;  5FE7 A;  4IR5 A;  2DVR A;  5EWD A;  4O76 A;  5I7X A;  5F62 A;  1PUO A;  4MEQ A;  4HXS A;  5A5P A;  4N4I A;  3GG3 A;  3TLP A;  3IU6 A;  4TT6 A;  5ENB A;  4QBM A;  4CL9 A;  3HMF A;  5I83 A;  5HQ6 A;  4BHW A;  4HBX A;  5HEL A;  4A9K A;  5BT5 A;  4YYG A;  2FSA A;  4O78 A;  4CLB A;  4A9H A;  3P1F A;  5IGN A;  3Q2E A;  5IGK A;  4CUP A;  3D7C A;  4NS5 A;  2MJV B;  5FH8 A;  3IU5 A;  3LQI A;  5CQ3 A;  5FE3 A;  5K29 A;  2L5E A;  5FG5 A;  2YEK A;  4A9N A;  4UYD A;  4PY6 A;  5ACY A;  5FH7 A;  5JWM A;  4MR6 A;  3UV2 A;  3O33 A;  4QEW A;  5A5O A;  2YW5 A;  4Z1S A;  3LQH A;  4MEP A;  5I29 A;  2R0S A;  4NRC A;  5HRV A;  4QUT A;  4TT2 A;  5FE5 A;  3QZT A;  4CUS A;  5EV9 A;  2L85 A;  3UW9 A;  4YY6 A;  5J0D A;  5D3H A;  4ALH A;  5FFY A;  4QSQ A;  5EWW A;  5FG6 A;  1JSP B;  5H85 A;  4QZS A;  4LZR A;  5I86 A;  4Z93 A;  4O70 A;  4O7F A;  5EA1 A;  4ALG A;  5I40 A;  4O71 A;  4QSP A;  5LJ0 A;  4OGJ A;  2F6N A;  4NR7 A;  4QEU A;  1ZKR A;  5ENC A;  3O36 A;  3P1E A;  5E7D A;  1WUG A;  4RVR A;  1WUM A;  5F5Z A;  5D3N A;  5CUA A;  4UIU A;  2D82 A;  4F3I A;  2F6J A;  4O72 A;  2WP2 A;  3AQA A;  4O74 A;  2E7N A;  5II1 A;  4YYH A;  4WHU A;  4TT4 A;  4YBT A;  5DBM A;  4IR4 A;  5L8U A;  5C4Q A;  5E9K A; 
#chains in the Genus database with same CATH homology
 4YC9 A;  5IGM A;  4YAT A;  4MR3 A;  5CQ4 A;  5I7Y A;  4XUA A;  4J1P A;  5FB0 A;  3S92 A;  5G4S A;  5ENG A;  5EWC A;  3JVL A;  1JM4 B;  4A9J A;  4YBM A;  5I89 A;  2DVV A;  5EK9 A;  5D3J A;  5DKH A;  4LRG A;  4TS8 A;  4HXN A;  4A9E A;  3LQJ A;  5G4R A;  2DWW A;  5DKD A;  4HBV A;  5E9Y A;  2RFJ A;  5LKZ A;  4NXJ A;  5EPR A;  4NYW A;  5EI4 A;  4YYN A;  3U5O A;  2L84 A;  4HBY A;  4ZC9 A;  4YYD A;  3U5K A;  5EVA A;  3UVW A;  5A85 A;  5HLS A;  4NR6 A;  5DLZ A;  5EWV A;  5EM3 A;  5TB6 A;  5CZG A;  4Q0O A;  5HRX A;  2YEM A;  5KTX A;  4A9M A;  5CUB A;  2I8N A;  4YYK A;  5FBX A;  4J3I A;  5EU1 A;  5EGU A;  5HCL A;  4YYM A;  4YK0 A;  3P1C A;  5CRM A;  4HXP A;  4NYV A;  5HQ7 A;  5DYX A;  5D24 A;  2D9E A;  5C7N A;  3I3J A;  4BJX A;  5I88 A;  3DAI A;  5KU3 A;  4NUD A;  4Z6H A;  5F61 A;  5D7X A;  3MUK A;  4KV4 A;  4NQM A;  4UYF A;  5CQ6 A;  1ZS5 A;  2RNW A;  5AD3 A;  2R0Y A;  4XY8 A;  5II2 A;  4QUU A;  4UIY A;  4NUE A;  3HME A;  3RCW A;  1N72 A;  5DYA A;  5KTU A;  5E9L A;  3UVD A;  3LJW A;  4PTB A;  4TYL A;  5LJ2 A;  5LVQ A;  4QSV A;  5E73 A;  5DW2 A;  5FE0 A;  4MEO A;  5CU8 A;  2DAT A;  5H1T A;  4KV1 A;  5IGL A;  5E9V A;  5HM0 A;  5TCM A;  2OSS A;  2RO1 A;  4QY4 A;  3MUL A;  4NR4 A;  2R0V A;  4J0S A;  3Q2F A;  4LR6 A;  5I1Q A;  4BW1 A;  3O35 A;  3U5J A;  5DY7 A;  5F2P A;  3P5O A;  5L98 A;  4IR6 A;  4DON A;  5D3P A;  3UV4 A;  3DWY A;  5FE6 A;  4A9L A;  2WP1 A;  5ETD A;  5F63 A;  5H1U A;  3U5P A;  5AME A;  4LYS A;  4NR9 A;  3UV5 A;  4QSR A;  4Y03 A;  5HEM A;  3QZS A;  5LKX A;  3U5N A;  2YYN A;  2E3K A;  4NYX A;  5L96 A;  2DVQ A;  5LVR A;  3MXF A;  5I80 A;  3SVF A;  5BT4 A;  3JVM A;  5KO4 A;  5DYU A;  3LXJ A;  5CQ7 A;  5F25 A;  5JI8 A;  5A5Q A;  4CUT A;  1EQF A;  5D3L A;  3O37 A;  4J0R A;  4Z1Q A;  4PCI A;  4UIZ A;  4CUR A;  4QSU A;  2KTB B;  4NUC A;  5CRZ A;  5A83 A;  4QSW A;  3MB3 A;  5CQ8 A;  4QEV A;  4UYG A;  5E0R A;  4YY4 A;  4HXM A;  4O7C A;  5A5R A;  5BT3 A;  2RI7 A;  4BW3 A;  2GRC A;  4FLP A;  4O7B A;  4YH3 A;  2I7K A;  5EIS A;  4A9F A;  5ENF A;  2DVS A;  4TU4 A;  4IOQ A;  4TU6 A;  5CUC A;  5HQ5 A;  3MQM A;  4YAX A;  5CP5 A;  5IID A;  5ETB A;  2N9G A;  5DFD A;  5EPS A;  4CFL A;  5A5N A;  4NRA A;  4MEN A;  4PCE A;  5D25 A;  5KHM A;  4XY9 A;  3JVJ A;  5E9I A;  5HEN A;  4QR5 A;  3S91 A;  4ZQL A;  5F36 A;  4YH4 A;  5F60 A;  5ENH A;  4KCX A;  4QR4 A;  4QSS A;  4O77 A;  4UYH A;  5FE8 A;  4NRB A;  5F1L A;  5HFR A;  4UIW A;  2RS9 B;  5ENI A;  4C66 A;  5L8T A;  2YEL A;  5IG6 A;  4IOR A;  5D3R A;  5CFW A;  4N4H A;  4PS5 A;  4WHW A;  4QB3 A;  4X2I A;  4LYI A;  3MB4 A;  4XUB A;  4NR5 A;  5FB1 A;  5EP7 A;  4N4G A;  4BW4 A;  5CGP A;  4NR8 A;  5D3T A;  5EQ1 A;  5ENE A;  5CUG A;  3UVY A;  5COI A;  5FE4 A;  5CQ5 A;  5E9M A;  4QST A;  5HJC A;  4Q0N A;  3U5L A;  4LC2 A;  4C67 A;  5FE2 A;  2RNY A;  5L99 A;  5A7C A;  3SVH A;  4HXK A;  5C87 A;  5LJ1 A;  4HXO A;  4QR3 A;  5E3D A;  4GPJ A;  3UVX A;  3P1D A;  4O7A A;  5DFC A;  5A81 A;  5KTW A;  5C8G A;  4Z6I A;  2H60 A;  4N4F A;  4QYD A;  4N3W A;  4YAB A;  2DKW A;  4TTE A;  3U5M A;  4TQN A;  3ONI A;  3ZYU A;  4IR3 A;  4CUU A;  5FDZ A;  4LDF A;  5EPB A;  5F3A A;  2RNX A;  5HRW A;  5DX4 A;  4LZ2 A;  2LSP B;  4QC1 A;  5EIC A;  4AKN A;  4YAD A;  4YYJ A;  4CUQ A;  5C89 A;  5C85 A;  4PKL A;  4WIV A;  4HXR A;  5CQT A;  4LZS A;  2OUO A;  5CPE A;  2E7O A;  5CTL A;  1F68 A;  3O34 A;  4UYE A;  5A5S A;  5ENJ A;  4OGI A;  5FFV A;  3G0L A;  3QZV A;  3AAD A;  5FE9 A;  1E6I A;  3SVG A;  5DLX A;  4HBW A;  4MR5 A;  4XYA A;  5DFB A;  5L97 A;  5DW1 A;  5A82 A;  5CY9 A;  4QC3 A;  5IBN A;  5DYC A;  4CFK A;  5CUE A;  1X0J A;  5LKU A;  3K2J A;  4QYL A;  5FG4 A;  4NQN A;  3G0J A;  2R10 A;  5FH6 A;  5H1V A;  5AD2 A;  4UIT A;  2G4A A;  4TZ2 A;  4UYF B;  2YQD A;  5D26 A;  5DKC A;  4UIV A;  4BW2 A;  3HMH A;  5FFW A;  4TZ8 A;  3JVK A;  5D3S A;  2OO1 A;  4O7E A;  4UIX A;  3NXB A;  2NXB A;  4O75 A;  3FKM X;  4A9I A;  4QSX A;  2YDW A;  5E3G A;  4YBS A;  5HFQ A;  5FE1 A;  4IOO A;  4A9O A;  4HXL A;  5CS8 A;  4MR4 A;  4E96 A;  4YYI A;  5EWH A;  4QNS A;  4LYW A;  5CQA A;  5E74 A;  4ZW1 A;  5LKT A;  4OUF A;  5F1H A;  5AMF A;  5CUD A;  5LUU A;  5D0C A;  5FE7 A;  4IR5 A;  2DVR A;  5EWD A;  4O76 A;  5I7X A;  5F62 A;  4MEQ A;  4HXS A;  5A5P A;  4N4I A;  3GG3 A;  3TLP A;  3IU6 A;  4TT6 A;  5ENB A;  4QBM A;  4CL9 A;  3HMF A;  5I83 A;  5HQ6 A;  4BHW A;  4HBX A;  5HEL A;  4A9K A;  5BT5 A;  4YYG A;  2FSA A;  4O78 A;  4CLB A;  4A9H A;  3P1F A;  5IGN A;  3Q2E A;  5IGK A;  4CUP A;  3D7C A;  4NS5 A;  2MJV B;  5FH8 A;  3IU5 A;  3LQI A;  5CQ3 A;  5FE3 A;  5K29 A;  2L5E A;  5FG5 A;  2YEK A;  4A9N A;  4UYD A;  4PY6 A;  5ACY A;  5FH7 A;  5JWM A;  4MR6 A;  3UV2 A;  3O33 A;  4QEW A;  5A5O A;  2YW5 A;  4Z1S A;  3LQH A;  4MEP A;  5I29 A;  2R0S A;  4NRC A;  5HRV A;  4QUT A;  4TT2 A;  5FE5 A;  3QZT A;  4CUS A;  5EV9 A;  2L85 A;  3UW9 A;  4YY6 A;  5J0D A;  5D3H A;  4ALH A;  5FFY A;  4QSQ A;  5EWW A;  5FG6 A;  1JSP B;  5H85 A;  4QZS A;  4LZR A;  5I86 A;  4Z93 A;  4O70 A;  4O7F A;  5EA1 A;  4ALG A;  5I40 A;  4O71 A;  4QSP A;  5LJ0 A;  4OGJ A;  2F6N A;  4NR7 A;  4QEU A;  5ENC A;  3O36 A;  3P1E A;  5E7D A;  1WUG A;  4RVR A;  1WUM A;  5F5Z A;  5D3N A;  5CUA A;  4UIU A;  2D82 A;  4F3I A;  2F6J A;  4O72 A;  2WP2 A;  3AQA A;  4O74 A;  2E7N A;  5II1 A;  4YYH A;  4WHU A;  4TT4 A;  4YBT A;  5DBM A;  4IR4 A;  5L8U A;  5C4Q A;  5E9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...