3JVMA

Crystal structure of bromodomain 2 of mouse brd4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
116
structure length
116
Chain Sequence
GAMGSKISEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 4
publication title Structures of the Dual Bromodomains of the P-TEFb-activating Protein Brd4 at Atomic Resolution
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 42
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3jvmA00
5CP5A 5AD2A 3Q2FA 4QEVA 2G4AA 2YQDA 4BHWA 5F63A 5E9KA 5CQTA 4LYWA 4Q0OA 5CZGA 3MB4A 4A9NA 5CPEA 3O37A 2DVVA 4QSTA 5DYAA 5ENHA 5EWCA 4QSQA 4WHUA 5G4SA 4BW1A 5L97A 4UYEA 1F68A 5ETBA 4Z1SA 4CUTA 5DFDA 4QY4A 5IGMA 3DAIA 3JVMA 2KTBB 4YYJA 1WUMA 2D82A 5CS8A 5F61A 4QBMA 4ALHA 3U5NA 4F3IA 4YYHA 4WIVA 5DFCA 5AD3A 3O33A 5J0DA 3AQAA 3LXJA 5FFVA 2RNYA 5EWWA 5A83A 4NYWA 4PCIA 5LJ2A 4ZW1A 4IR6A 5BT5A 4LC2A 4MEQA 3QZTA 4YY6A 4YYDA 4HXMA 5DKCA 4Z6HA 4FLPA 3HMFA 3RCWA 5LJ1A 5E0RA 4UYFA 4MR4A 4QZSA 5DBMA 5I89A 3O35A 5COIA 5BT3A 2YELA 4TT4A 4O74A 5CQ6A 4O71A 4QSWA 4CFKA 5A5RA 4NUDA 4XY9A 5II1A 4GPJA 4C66A 5F3AA 3S92A 4UIZA 5FH7A 5A82A 5FG4A 5LKUA 4YYNA 4YBSA 4O76A 1N72A 5DKDA 4NYXA 5EV9A 3P1CA 5FE2A 5D3SA 4TU4A 3O34A 5CUAA 5C7NA 4TYLA 5D24A 4NUCA 4IOOA 4A9MA 5IG6A 3O36A 3U5JA 5D26A 2RO1A 5CQ7A 4UIVA 2DWWA 4QR3A 3Q2EA 5CUDA 5EWVA 4NS5A 5IGKA 1WUGA 2WP1A 5CU8A 2DKWA 4KV4A 5C87A 1ZS5A 4QC1A 5L8UA 4O72A 1X0JA 4CFLA 5EWDA 4CUQA 4YADA 5EVAA 4CURA 4J0RA 4TU6A 5I83A 2RNWA 5TB6A 3U5OA 5C89A 2R0YA 3P5OA 4NXJA 3MB3A 5DYXA 5FG6A 5E9LA 5CY9A 5I29A 5F25A 2DVSA 4NUEA 4HXPA 2RI7A 2R10A 5EK9A 5FE3A 4O77A 4C67A 5F2PA 4XUBA 4LRGA 5ACYA 3QZVA 5EWHA 4IORA 4X2IA 2D9EA 3NXBA 3LQIA 4NQMA 5CRMA 4AKNA 4YC9A 4NRCA 5E9MA 4IR4A 5HM0A 4UYHA 5LVQA 2YEKA 3SVHA 4NR6A 4PKLA 5H1UA 5A85A 4J0SA 4UIUA 5HRXA 4XUAA 5DYUA 5TCMA 5FE4A 4YBMA 5FE8A 5E7DA 4Y03A 4UIXA 5H1VA 5A5OA 4YATA 4LYIA 5A7CA 3G0JA 4OGJA 5LKTA 5LKZA 5DLZA 5EICA 5CQ4A 3UVDA 5AMEA 4O7BA 4MR3A 4E96A 4UYDA 5ENCA 4YYIA 5FB0A 3LQJA 5F5ZA 4TT6A 4BW4A 5FE9A 4O70A 5D3NA 5JI8A 5E3GA 5E73A 4NQNA 4QSUA 3LQHA 4MEOA 5C8GA 4KCXA 4N4HA 2RS9B 5I7YA 4HXLA 5EPRA 5I7XA 4PTBA 3DWYA 4PS5A 4CUUA 5CQ8A 2NXBA 3U5MA 5D3TA 4ZC9A 4YAXA 5EI4A 2DVRA 5F1LA 4A9IA 3SVFA 5HFQA 5HQ6A 5HQ7A 2L85A 4A9HA 2E7NA 5FBXA 4CUSA 5CTLA 4N4IA 4NR4A 4TS8A 5EQ1A 5HJCA 3HMEA 5D3JA 4TQNA 4YH3A 4ALGA 4QYDA 4XY8A 5D25A 5L99A 2R0VA 5FH8A 5CUEA 2YDWA 5CFWA 5KTWA 2RFJA 3QZSA 1E6IA 4LZSA 4UYFB 5E9IA 5CQ3A 4A9JA 5A5QA 3HMHA 3UV4A 4O7CA 3IU6A 5FFWA 5CGPA 2L84A 3JVJA 5EPSA 5FG5A 4TZ8A 4A9LA 5DW2A 5I88A 5EP7A 3JVKA 5G4RA 5F1HA 4CUPA 5ENFA 5KTUA 2OUOA 5DX4A 4A9KA 5A5NA 5LJ0A 3FKMX 3UVWA 4NYVA 5EISA 4QSXA 3MQMA 4O75A 5L96A 4IR5A 5BT4A 2DATA 4NRBA 5HRWA 4YBTA 4O78A 5D3LA 5FFYA 5I80A 4Z6IA 5IIDA 5KU3A 5L8TA 4J3IA 4TTEA 5E3DA 4YYGA 3IU5A 5E9VA 4QR4A 5KTXA 4TT2A 4QSPA 4Q0NA 5DY7A 5HENA 2E7OA 5DW1A 5DLXA 5ETDA 3U5PA 5E9YA 4N4GA 4YY4A 4PY6A 3U5LA 4A9FA 4UYGA 5ENBA 2MJVB 4KV1A 4BW2A 3UVYA 4QUTA 4HXNA 4BJXA 3ZYUA 2OO1A 4O7AA 5CUBA 4DONA 4QSRA 4CL9A 3S91A 2YEMA 5I1QA 4MR6A 4HBXA 5CUGA 5D3PA 5DKHA 4OGIA 4YK0A 2I7KA 5C4QA 3G0LA 5F36A 5H85A 2I8NA 3MUKA 4QSVA 5H1TA 3JVLA 3K2JA 2R0SA 5FE7A 5LUUA 4HXOA 4O7FA 5CQ5A 4IR3A 4Z93A 5D7XA 5KHMA 5HEMA 4HXSA 5EA1A 4UIYA 5CUCA 5EM3A 5FE5A 5FE1A 5I86A 3ONIA 4OUFA 3D7CA 4UITA 3MXFA 4LDFA 4BW3A 4ZQLA 4J1PA 5L98A 4HBVA 2YYNA 1JSPB 2N9GA 5CQAA 2E3KA 4PCEA 4UIWA 4LZ2A 4NR8A 5DFBA 4NR5A 5ENJA 5FE6A 3UVXA 5D3RA 4QEWA 2F6JA 5EGUA 5JWMA 4LZRA 5K29A 5F62A 3UV2A 5C85A 2WP2A 3P1EA 4HXKA 4MR5A 4QNSA 5HCLA 4WHWA 4MEPA 5IGLA 2H60A 4NRAA 4QC3A 5FDZA 2L5EA 5D0CA 4TZ2A 2DVQA 5AMFA 4IOQA 3SVGA 5HFRA 5A81A 2FSAA 5HELA 3GG3A 3UV5A 2YW5A 2F6NA 3TLPA 4YYKA 4NR9A 4O7EA 3U5KA 2GRCA 3MULA 4QB3A 3P1FA 5E74A 5D3HA 5FE0A 5A5PA 5IGNA 4YABA 4QUUA 4HXRA 5HQ5A 1EQFA 5CRZA 3I3JA 4LR6A 1JM4B 2RNXA 4XYAA 5FH6A 4YYMA 2LSPB 4LYSA 5FB1A 3P1DA 4N3WA 3LJWA 4QYLA 5HLSA 4HBYA 5A5SA 5LKXA 3AADA 3UW9A 4RVRA 4A9OA 5ENIA 5EPBA 5IBNA 5KO4A 2OSSA 4Z1QA 5I40A 4HBWA 4NR7A 5II2A 4QEUA 5ENEA 4CLBA 5F60A 5DYCA 5LVRA 4A9EA 5ENGA 4MENA 5EU1A 4QSSA 4QR5A 4YH4A 5HRVA 4N4FA
chains in the Genus database with same CATH superfamily
5CP5A 5AD2A 3Q2FA 4QEVA 2G4AA 2YQDA 4BHWA 5F63A 5E9KA 5CQTA 4LYWA 4Q0OA 5CZGA 3MB4A 4A9NA 5CPEA 3O37A 2DVVA 4QSTA 5DYAA 5ENHA 5EWCA 4QSQA 4WHUA 5G4SA 4BW1A 5L97A 4UYEA 1F68A 5ETBA 4Z1SA 4CUTA 5DFDA 4QY4A 5IGMA 3DAIA 3JVMA 2KTBB 4YYJA 1WUMA 2D82A 5CS8A 5F61A 4QBMA 4ALHA 3U5NA 4F3IA 4YYHA 4WIVA 5DFCA 5AD3A 3O33A 5J0DA 3AQAA 3LXJA 5FFVA 2RNYA 5EWWA 5A83A 4NYWA 4PCIA 5LJ2A 4ZW1A 4IR6A 5BT5A 4LC2A 4MEQA 3QZTA 4YY6A 4YYDA 4HXMA 5DKCA 4Z6HA 4FLPA 3HMFA 3RCWA 5LJ1A 5E0RA 4UYFA 4MR4A 4QZSA 5DBMA 5I89A 3O35A 5COIA 5BT3A 2YELA 4TT4A 4O74A 5CQ6A 4O71A 4QSWA 4CFKA 5A5RA 4NUDA 4XY9A 5II1A 4GPJA 4C66A 5F3AA 3S92A 4UIZA 5FH7A 5A82A 5FG4A 5LKUA 4YYNA 4YBSA 4O76A 1N72A 5DKDA 4NYXA 5EV9A 3P1CA 5FE2A 5D3SA 4TU4A 3O34A 5CUAA 5C7NA 4TYLA 5D24A 4NUCA 4IOOA 4A9MA 5IG6A 3O36A 3U5JA 5D26A 2EJNA 2RO1A 5CQ7A 4UIVA 2DWWA 4QR3A 3Q2EA 5CUDA 5EWVA 4NS5A 5IGKA 1WUGA 2WP1A 5CU8A 2DKWA 4KV4A 5C87A 1ZS5A 4QC1A 5L8UA 4O72A 1X0JA 4CFLA 5EWDA 4CUQA 4YADA 5EVAA 4CURA 4J0RA 4TU6A 5I83A 2RNWA 5TB6A 3U5OA 5C89A 2R0YA 3P5OA 4NXJA 3MB3A 5DYXA 5FG6A 5E9LA 5CY9A 5I29A 5F25A 2DVSA 4NUEA 4HXPA 2RI7A 2R10A 5EK9A 5FE3A 4O77A 4C67A 5F2PA 4XUBA 4LRGA 5ACYA 3QZVA 5EWHA 4IORA 4X2IA 2D9EA 3NXBA 3LQIA 4NQMA 5CRMA 4AKNA 4YC9A 4NRCA 5E9MA 4IR4A 5HM0A 4UYHA 5LVQA 2YEKA 3SVHA 4NR6A 4PKLA 5H1UA 5A85A 4J0SA 1PUOA 4UIUA 5HRXA 4XUAA 5DYUA 5TCMA 5FE4A 4YBMA 5FE8A 5E7DA 4Y03A 4UIXA 5H1VA 5A5OA 4YATA 4LYIA 5A7CA 3G0JA 4OGJA 5LKTA 5LKZA 5DLZA 5EICA 5CQ4A 3UVDA 5AMEA 4O7BA 4MR3A 4E96A 4UYDA 5ENCA 4YYIA 5FB0A 3LQJA 5F5ZA 4TT6A 4BW4A 5FE9A 4O70A 5D3NA 5JI8A 5E3GA 5E73A 4NQNA 4QSUA 3LQHA 4MEOA 5C8GA 4KCXA 4N4HA 2RS9B 5I7YA 4HXLA 5EPRA 5I7XA 4PTBA 3DWYA 4PS5A 4CUUA 5CQ8A 2NXBA 3U5MA 5D3TA 3VKGA 4ZC9A 4YAXA 5EI4A 2DVRA 5F1LA 1ZKRA 3SVFA 4A9IA 5HFQA 5HQ6A 5HQ7A 2L85A 4A9HA 2E7NA 5FBXA 4CUSA 5CTLA 4N4IA 4NR4A 4TS8A 5EQ1A 5HJCA 3HMEA 5D3JA 4TQNA 4YH3A 4ALGA 4QYDA 4XY8A 5D25A 5L99A 2R0VA 5FH8A 5CUEA 2YDWA 5CFWA 5KTWA 2RFJA 3QZSA 1E6IA 4LZSA 4UYFB 5E9IA 5CQ3A 4A9JA 5A5QA 3HMHA 3UV4A 4O7CA 3IU6A 5FFWA 5CGPA 2L84A 3JVJA 5EPSA 4AKIA 5FG5A 4TZ8A 4A9LA 5DW2A 5I88A 5EP7A 3JVKA 5G4RA 5F1HA 4CUPA 5ENFA 5KTUA 2OUOA 5DX4A 4A9KA 5A5NA 3D1DA 5LJ0A 3FKMX 3UVWA 4NYVA 5EISA 4QSXA 3MQMA 4O75A 5L96A 4IR5A 5BT4A 2DATA 4NRBA 5HRWA 4YBTA 4O78A 5D3LA 5FFYA 5I80A 4Z6IA 5IIDA 5KU3A 5L8TA 4J3IA 4TTEA 5E3DA 4YYGA 3IU5A 5E9VA 4QR4A 5KTXA 4TT2A 4QSPA 4Q0NA 5DY7A 5HENA 2E7OA 5DW1A 5DLXA 5ETDA 3U5PA 5E9YA 4N4GA 4YY4A 4PY6A 3U5LA 4A9FA 4UYGA 5ENBA 2MJVB 4KV1A 4BW2A 3UVYA 4QUTA 4HXNA 4BJXA 3ZYUA 2OO1A 4O7AA 3VKHA 5CUBA 4DONA 4QSRA 4CL9A 3S91A 2YEMA 5I1QA 4MR6A 4HBXA 5CUGA 5D3PA 5DKHA 4OGIA 4YK0A 2I7KA 5C4QA 3G0LA 5F36A 5H85A 2I8NA 3MUKA 4QSVA 3ERRA 3JVLA 3K2JA 5H1TA 2R0SA 5FE7A 5LUUA 4HXOA 4O7FA 5CQ5A 4IR3A 4Z93A 4AKGA 5D7XA 5KHMA 5HEMA 4HXSA 5EA1A 4UIYA 5CUCA 5EM3A 5FE5A 5FE1A 5I86A 3ONIA 4OUFA 3D7CA 4UITA 3MXFA 4LDFA 4BW3A 4ZQLA 4J1PA 5L98A 4HBVA 2YYNA 1JSPB 2N9GA 5CQAA 2E3KA 4PCEA 4UIWA 4LZ2A 4NR8A 5DFBA 4NR5A 5ENJA 5FE6A 3UVXA 5D3RA 4QEWA 2F6JA 5EGUA 5JWMA 4LZRA 5K29A 5F62A 3UV2A 5C85A 2WP2A 3P1EA 4HXKA 4MR5A 4QNSA 5HCLA 4WHWA 4MEPA 5IGLA 2H60A 4NRAA 4QC3A 5FDZA 2L5EA 5D0CA 4TZ2A 2DVQA 5AMFA 4IOQA 3SVGA 5HFRA 5A81A 4AKHA 2FSAA 5HELA 3GG3A 3UV5A 2YW5A 2F6NA 3TLPA 4YYKA 4NR9A 4O7EA 3U5KA 2GRCA 3MULA 4QB3A 3P1FA 5E74A 5D3HA 5FE0A 5A5PA 5IGNA 4YABA 4QUUA 4HXRA 5HQ5A 1EQFA 5CRZA 3I3JA 4AI6A 4LR6A 1JM4B 2RNXA 4XYAA 5FH6A 4YYMA 2LSPB 4LYSA 5FB1A 3P1DA 4N3WA 3LJWA 4QYLA 5HLSA 4HBYA 5A5SA 5LKXA 3AADA 3UW9A 4RVRA 4A9OA 5ENIA 5EPBA 5IBNA 5KO4A 2OSSA 4Z1QA 5I40A 4HBWA 4NR7A 5II2A 3D1BA 4QEUA 5ENEA 4CLBA 5F60A 5DYCA 5LVRA 4A9EA 5ENGA 4MENA 5EU1A 4QSSA 4QR5A 4YH4A 5HRVA 4N4FA
chains in the Genus database with same CATH topology
5CP5A 5AD2A 3Q2FA 4QEVA 2G4AA 2YQDA 4BHWA 5F63A 5E9KA 5CQTA 4LYWA 4Q0OA 5CZGA 3MB4A 4A9NA 5CPEA 3O37A 2DVVA 4QSTA 5DYAA 5ENHA 5EWCA 4QSQA 4WHUA 5G4SA 4BW1A 5L97A 4UYEA 1F68A 5ETBA 4Z1SA 4CUTA 5DFDA 4QY4A 5IGMA 3DAIA 3JVMA 2KTBB 4YYJA 1WUMA 2D82A 5CS8A 5F61A 4QBMA 4ALHA 3U5NA 4F3IA 4YYHA 4WIVA 5DFCA 5AD3A 3O33A 5J0DA 3AQAA 3LXJA 5FFVA 2RNYA 5EWWA 5A83A 4NYWA 4PCIA 5LJ2A 4ZW1A 4IR6A 5BT5A 4LC2A 4MEQA 3QZTA 4YY6A 4YYDA 4HXMA 5DKCA 4Z6HA 4FLPA 3HMFA 3RCWA 5LJ1A 5E0RA 4UYFA 4MR4A 4QZSA 5DBMA 5I89A 3O35A 5COIA 5BT3A 2YELA 4TT4A 4O74A 5CQ6A 4O71A 4QSWA 4CFKA 5A5RA 4NUDA 4XY9A 5II1A 4GPJA 4C66A 5F3AA 3S92A 4UIZA 5FH7A 5A82A 5FG4A 5LKUA 4YYNA 4YBSA 4O76A 1N72A 5DKDA 4NYXA 5EV9A 3P1CA 5FE2A 5D3SA 4TU4A 3O34A 5CUAA 5C7NA 4TYLA 5D24A 4NUCA 4IOOA 4A9MA 5IG6A 3O36A 3U5JA 5D26A 2RO1A 5CQ7A 4UIVA 2DWWA 4QR3A 3Q2EA 5CUDA 5EWVA 4NS5A 5IGKA 1WUGA 2WP1A 5CU8A 2DKWA 4KV4A 5C87A 1ZS5A 4QC1A 5L8UA 4O72A 1X0JA 4CFLA 5EWDA 4CUQA 4YADA 5EVAA 4CURA 4J0RA 4TU6A 5I83A 2RNWA 5TB6A 3U5OA 5C89A 2R0YA 3P5OA 4NXJA 3MB3A 5DYXA 5FG6A 5E9LA 5CY9A 5I29A 5F25A 2DVSA 4NUEA 4HXPA 2RI7A 2R10A 5EK9A 5FE3A 4O77A 4C67A 5F2PA 4XUBA 4LRGA 5ACYA 3QZVA 5EWHA 4IORA 4X2IA 2D9EA 3NXBA 3LQIA 4NQMA 5CRMA 4AKNA 4YC9A 4NRCA 5E9MA 4IR4A 5HM0A 4UYHA 5LVQA 2YEKA 3SVHA 4NR6A 4PKLA 5H1UA 5A85A 4J0SA 4UIUA 5HRXA 4XUAA 5DYUA 5TCMA 5FE4A 4YBMA 5FE8A 5E7DA 4Y03A 4UIXA 5H1VA 5A5OA 4YATA 4LYIA 5A7CA 3G0JA 4OGJA 5LKTA 5LKZA 5DLZA 5EICA 5CQ4A 3UVDA 5AMEA 4O7BA 4MR3A 4E96A 4UYDA 5ENCA 4YYIA 5FB0A 3LQJA 5F5ZA 4TT6A 4BW4A 5FE9A 4O70A 5D3NA 5JI8A 5E3GA 5E73A 4NQNA 4QSUA 3LQHA 4MEOA 5C8GA 4KCXA 4N4HA 2RS9B 5I7YA 4HXLA 5EPRA 5I7XA 4PTBA 3DWYA 4PS5A 4CUUA 5CQ8A 2NXBA 3U5MA 5D3TA 4ZC9A 4YAXA 5EI4A 2DVRA 5F1LA 4A9IA 3SVFA 5HFQA 5HQ6A 5HQ7A 2L85A 4A9HA 2E7NA 5FBXA 4CUSA 5CTLA 4N4IA 4NR4A 4TS8A 5EQ1A 5HJCA 3HMEA 5D3JA 4TQNA 4YH3A 4ALGA 4QYDA 4XY8A 5D25A 5L99A 2R0VA 5FH8A 5CUEA 2YDWA 5CFWA 5KTWA 2RFJA 3QZSA 1E6IA 4LZSA 4UYFB 5E9IA 5CQ3A 4A9JA 5A5QA 3HMHA 3UV4A 4O7CA 3IU6A 5FFWA 5CGPA 2L84A 3JVJA 5EPSA 5FG5A 4TZ8A 4A9LA 5DW2A 5I88A 5EP7A 3JVKA 5G4RA 5F1HA 4CUPA 5ENFA 5KTUA 2OUOA 5DX4A 4A9KA 5A5NA 5LJ0A 3FKMX 3UVWA 4NYVA 5EISA 4QSXA 3MQMA 4O75A 5L96A 4IR5A 5BT4A 2DATA 4NRBA 5HRWA 4YBTA 4O78A 5D3LA 5FFYA 5I80A 4Z6IA 5IIDA 5KU3A 5L8TA 4J3IA 4TTEA 5E3DA 4YYGA 3IU5A 5E9VA 4QR4A 5KTXA 4TT2A 4QSPA 4Q0NA 5DY7A 5HENA 2E7OA 5DW1A 5DLXA 5ETDA 3U5PA 5E9YA 4N4GA 4YY4A 4PY6A 3U5LA 4A9FA 4UYGA 5ENBA 2MJVB 4KV1A 4BW2A 3UVYA 4QUTA 4HXNA 4BJXA 3ZYUA 2OO1A 4O7AA 5CUBA 4DONA 4QSRA 4CL9A 3S91A 2YEMA 5I1QA 4MR6A 4HBXA 5CUGA 5D3PA 5DKHA 4OGIA 4YK0A 2I7KA 5C4QA 3G0LA 5F36A 5H85A 2I8NA 3MUKA 4QSVA 5H1TA 3JVLA 3K2JA 2R0SA 5FE7A 5LUUA 4HXOA 4O7FA 5CQ5A 4IR3A 4Z93A 5D7XA 5KHMA 5HEMA 4HXSA 5EA1A 4UIYA 5CUCA 5EM3A 5FE5A 5FE1A 5I86A 3ONIA 4OUFA 3D7CA 4UITA 3MXFA 4LDFA 4BW3A 4ZQLA 4J1PA 5L98A 4HBVA 2YYNA 1JSPB 2N9GA 5CQAA 2E3KA 4PCEA 4UIWA 4LZ2A 4NR8A 5DFBA 4NR5A 5ENJA 5FE6A 3UVXA 5D3RA 4QEWA 2F6JA 5EGUA 5JWMA 4LZRA 5K29A 5F62A 3UV2A 5C85A 2WP2A 3P1EA 4HXKA 4MR5A 4QNSA 5HCLA 4WHWA 4MEPA 5IGLA 2H60A 4NRAA 4QC3A 5FDZA 2L5EA 5D0CA 4TZ2A 2DVQA 5AMFA 4IOQA 3SVGA 5HFRA 5A81A 2FSAA 5HELA 3GG3A 3UV5A 2YW5A 2F6NA 3TLPA 4YYKA 4NR9A 4O7EA 3U5KA 2GRCA 3MULA 4QB3A 3P1FA 5E74A 5D3HA 5FE0A 5A5PA 5IGNA 4YABA 4QUUA 4HXRA 5HQ5A 1EQFA 5CRZA 3I3JA 4LR6A 1JM4B 2RNXA 4XYAA 5FH6A 4YYMA 2LSPB 4LYSA 5FB1A 3P1DA 4N3WA 3LJWA 4QYLA 5HLSA 4HBYA 5A5SA 5LKXA 3AADA 3UW9A 4RVRA 4A9OA 5ENIA 5EPBA 5IBNA 5KO4A 2OSSA 4Z1QA 5I40A 4HBWA 4NR7A 5II2A 4QEUA 5ENEA 4CLBA 5F60A 5DYCA 5LVRA 4A9EA 5ENGA 4MENA 5EU1A 4QSSA 4QR5A 4YH4A 5HRVA 4N4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP5 A;  5AD2 A;  3Q2F A;  4QEV A;  2G4A A;  2YQD A;  4BHW A;  5F63 A;  5E9K A;  5CQT A;  4LYW A;  4Q0O A;  5CZG A;  3MB4 A;  4A9N A;  5CPE A;  3O37 A;  2DVV A;  4QST A;  5DYA A;  5ENH A;  5EWC A;  4QSQ A;  4WHU A;  5G4S A;  4BW1 A;  5L97 A;  4UYE A;  1F68 A;  5ETB A;  4Z1S A;  4CUT A;  5DFD A;  4QY4 A;  5IGM A;  3DAI A;  3JVM A;  2KTB B;  4YYJ A;  1WUM A;  2D82 A;  5CS8 A;  5F61 A;  4QBM A;  4ALH A;  3U5N A;  4F3I A;  4YYH A;  4WIV A;  5DFC A;  5AD3 A;  3O33 A;  5J0D A;  3AQA A;  3LXJ A;  5FFV A;  2RNY A;  5EWW A;  5A83 A;  4NYW A;  4PCI A;  5LJ2 A;  4ZW1 A;  4IR6 A;  5BT5 A;  4LC2 A;  4MEQ A;  3QZT A;  4YY6 A;  4YYD A;  4HXM A;  5DKC A;  4Z6H A;  4FLP A;  3HMF A;  3RCW A;  5LJ1 A;  5E0R A;  4UYF A;  4MR4 A;  4QZS A;  5DBM A;  5I89 A;  3O35 A;  5COI A;  5BT3 A;  2YEL A;  4TT4 A;  4O74 A;  5CQ6 A;  4O71 A;  4QSW A;  4CFK A;  5A5R A;  4NUD A;  4XY9 A;  5II1 A;  4GPJ A;  4C66 A;  5F3A A;  3S92 A;  4UIZ A;  5FH7 A;  5A82 A;  5FG4 A;  5LKU A;  4YYN A;  4YBS A;  4O76 A;  1N72 A;  5DKD A;  4NYX A;  5EV9 A;  3P1C A;  5FE2 A;  5D3S A;  4TU4 A;  3O34 A;  5CUA A;  5C7N A;  4TYL A;  5D24 A;  4NUC A;  4IOO A;  4A9M A;  5IG6 A;  3O36 A;  3U5J A;  5D26 A;  2RO1 A;  5CQ7 A;  4UIV A;  2DWW A;  4QR3 A;  3Q2E A;  5CUD A;  5EWV A;  4NS5 A;  5IGK A;  1WUG A;  2WP1 A;  5CU8 A;  2DKW A;  4KV4 A;  5C87 A;  1ZS5 A;  4QC1 A;  5L8U A;  4O72 A;  1X0J A;  4CFL A;  5EWD A;  4CUQ A;  4YAD A;  5EVA A;  4CUR A;  4J0R A;  4TU6 A;  5I83 A;  2RNW A;  5TB6 A;  3U5O A;  5C89 A;  2R0Y A;  3P5O A;  4NXJ A;  3MB3 A;  5DYX A;  5FG6 A;  5E9L A;  5CY9 A;  5I29 A;  5F25 A;  2DVS A;  4NUE A;  4HXP A;  2RI7 A;  2R10 A;  5EK9 A;  5FE3 A;  4O77 A;  4C67 A;  5F2P A;  4XUB A;  4LRG A;  5ACY A;  3QZV A;  5EWH A;  4IOR A;  4X2I A;  2D9E A;  3NXB A;  3LQI A;  4NQM A;  5CRM A;  4AKN A;  4YC9 A;  4NRC A;  5E9M A;  4IR4 A;  5HM0 A;  4UYH A;  5LVQ A;  2YEK A;  3SVH A;  4NR6 A;  4PKL A;  5H1U A;  5A85 A;  4J0S A;  4UIU A;  5HRX A;  4XUA A;  5DYU A;  5TCM A;  5FE4 A;  4YBM A;  5FE8 A;  5E7D A;  4Y03 A;  4UIX A;  5H1V A;  5A5O A;  4YAT A;  4LYI A;  5A7C A;  3G0J A;  4OGJ A;  5LKT A;  5LKZ A;  5DLZ A;  5EIC A;  5CQ4 A;  3UVD A;  5AME A;  4O7B A;  4MR3 A;  4E96 A;  4UYD A;  5ENC A;  4YYI A;  5FB0 A;  3LQJ A;  5F5Z A;  4TT6 A;  4BW4 A;  5FE9 A;  4O70 A;  5D3N A;  5JI8 A;  5E3G A;  5E73 A;  4NQN A;  4QSU A;  3LQH A;  4MEO A;  5C8G A;  4KCX A;  4N4H A;  2RS9 B;  5I7Y A;  4HXL A;  5EPR A;  5I7X A;  4PTB A;  3DWY A;  4PS5 A;  4CUU A;  5CQ8 A;  2NXB A;  3U5M A;  5D3T A;  4ZC9 A;  4YAX A;  5EI4 A;  2DVR A;  5F1L A;  4A9I A;  3SVF A;  5HFQ A;  5HQ6 A;  5HQ7 A;  2L85 A;  4A9H A;  2E7N A;  5FBX A;  4CUS A;  5CTL A;  4N4I A;  4NR4 A;  4TS8 A;  5EQ1 A;  5HJC A;  3HME A;  5D3J A;  4TQN A;  4YH3 A;  4ALG A;  4QYD A;  4XY8 A;  5D25 A;  5L99 A;  2R0V A;  5FH8 A;  5CUE A;  2YDW A;  5CFW A;  5KTW A;  2RFJ A;  3QZS A;  1E6I A;  4LZS A;  4UYF B;  5E9I A;  5CQ3 A;  4A9J A;  5A5Q A;  3HMH A;  3UV4 A;  4O7C A;  3IU6 A;  5FFW A;  5CGP A;  2L84 A;  3JVJ A;  5EPS A;  5FG5 A;  4TZ8 A;  4A9L A;  5DW2 A;  5I88 A;  5EP7 A;  3JVK A;  5G4R A;  5F1H A;  4CUP A;  5ENF A;  5KTU A;  2OUO A;  5DX4 A;  4A9K A;  5A5N A;  5LJ0 A;  3FKM X;  3UVW A;  4NYV A;  5EIS A;  4QSX A;  3MQM A;  4O75 A;  5L96 A;  4IR5 A;  5BT4 A;  2DAT A;  4NRB A;  5HRW A;  4YBT A;  4O78 A;  5D3L A;  5FFY A;  5I80 A;  4Z6I A;  5IID A;  5KU3 A;  5L8T A;  4J3I A;  4TTE A;  5E3D A;  4YYG A;  3IU5 A;  5E9V A;  4QR4 A;  5KTX A;  4TT2 A;  4QSP A;  4Q0N A;  5DY7 A;  5HEN A;  2E7O A;  5DW1 A;  5DLX A;  5ETD A;  3U5P A;  5E9Y A;  4N4G A;  4YY4 A;  4PY6 A;  3U5L A;  4A9F A;  4UYG A;  5ENB A;  2MJV B;  4KV1 A;  4BW2 A;  3UVY A;  4QUT A;  4HXN A;  4BJX A;  3ZYU A;  2OO1 A;  4O7A A;  5CUB A;  4DON A;  4QSR A;  4CL9 A;  3S91 A;  2YEM A;  5I1Q A;  4MR6 A;  4HBX A;  5CUG A;  5D3P A;  5DKH A;  4OGI A;  4YK0 A;  2I7K A;  5C4Q A;  3G0L A;  5F36 A;  5H85 A;  2I8N A;  3MUK A;  4QSV A;  5H1T A;  3JVL A;  3K2J A;  2R0S A;  5FE7 A;  5LUU A;  4HXO A;  4O7F A;  5CQ5 A;  4IR3 A;  4Z93 A;  5D7X A;  5KHM A;  5HEM A;  4HXS A;  5EA1 A;  4UIY A;  5CUC A;  5EM3 A;  5FE5 A;  5FE1 A;  5I86 A;  3ONI A;  4OUF A;  3D7C A;  4UIT A;  3MXF A;  4LDF A;  4BW3 A;  4ZQL A;  4J1P A;  5L98 A;  4HBV A;  2YYN A;  1JSP B;  2N9G A;  5CQA A;  2E3K A;  4PCE A;  4UIW A;  4LZ2 A;  4NR8 A;  5DFB A;  4NR5 A;  5ENJ A;  5FE6 A;  3UVX A;  5D3R A;  4QEW A;  2F6J A;  5EGU A;  5JWM A;  4LZR A;  5K29 A;  5F62 A;  3UV2 A;  5C85 A;  2WP2 A;  3P1E A;  4HXK A;  4MR5 A;  4QNS A;  5HCL A;  4WHW A;  4MEP A;  5IGL A;  2H60 A;  4NRA A;  4QC3 A;  5FDZ A;  2L5E A;  5D0C A;  4TZ2 A;  2DVQ A;  5AMF A;  4IOQ A;  3SVG A;  5HFR A;  5A81 A;  2FSA A;  5HEL A;  3GG3 A;  3UV5 A;  2YW5 A;  2F6N A;  3TLP A;  4YYK A;  4NR9 A;  4O7E A;  3U5K A;  2GRC A;  3MUL A;  4QB3 A;  3P1F A;  5E74 A;  5D3H A;  5FE0 A;  5A5P A;  5IGN A;  4YAB A;  4QUU A;  4HXR A;  5HQ5 A;  1EQF A;  5CRZ A;  3I3J A;  4LR6 A;  1JM4 B;  2RNX A;  4XYA A;  5FH6 A;  4YYM A;  2LSP B;  4LYS A;  5FB1 A;  3P1D A;  4N3W A;  3LJW A;  4QYL A;  5HLS A;  4HBY A;  5A5S A;  5LKX A;  3AAD A;  3UW9 A;  4RVR A;  4A9O A;  5ENI A;  5EPB A;  5IBN A;  5KO4 A;  2OSS A;  4Z1Q A;  5I40 A;  4HBW A;  4NR7 A;  5II2 A;  4QEU A;  5ENE A;  4CLB A;  5F60 A;  5DYC A;  5LVR A;  4A9E A;  5ENG A;  4MEN A;  5EU1 A;  4QSS A;  4QR5 A;  4YH4 A;  5HRV A;  4N4F A; 
#chains in the Genus database with same CATH topology
 5CP5 A;  5AD2 A;  3Q2F A;  4QEV A;  2G4A A;  2YQD A;  4BHW A;  5F63 A;  5E9K A;  5CQT A;  4LYW A;  4Q0O A;  5CZG A;  3MB4 A;  4A9N A;  5CPE A;  3O37 A;  2DVV A;  4QST A;  5DYA A;  5ENH A;  5EWC A;  4QSQ A;  4WHU A;  5G4S A;  4BW1 A;  5L97 A;  4UYE A;  1F68 A;  5ETB A;  4Z1S A;  4CUT A;  5DFD A;  4QY4 A;  5IGM A;  3DAI A;  3JVM A;  2KTB B;  4YYJ A;  1WUM A;  2D82 A;  5CS8 A;  5F61 A;  4QBM A;  4ALH A;  3U5N A;  4F3I A;  4YYH A;  4WIV A;  5DFC A;  5AD3 A;  3O33 A;  5J0D A;  3AQA A;  3LXJ A;  5FFV A;  2RNY A;  5EWW A;  5A83 A;  4NYW A;  4PCI A;  5LJ2 A;  4ZW1 A;  4IR6 A;  5BT5 A;  4LC2 A;  4MEQ A;  3QZT A;  4YY6 A;  4YYD A;  4HXM A;  5DKC A;  4Z6H A;  4FLP A;  3HMF A;  3RCW A;  5LJ1 A;  5E0R A;  4UYF A;  4MR4 A;  4QZS A;  5DBM A;  5I89 A;  3O35 A;  5COI A;  5BT3 A;  2YEL A;  4TT4 A;  4O74 A;  5CQ6 A;  4O71 A;  4QSW A;  4CFK A;  5A5R A;  4NUD A;  4XY9 A;  5II1 A;  4GPJ A;  4C66 A;  5F3A A;  3S92 A;  4UIZ A;  5FH7 A;  5A82 A;  5FG4 A;  5LKU A;  4YYN A;  4YBS A;  4O76 A;  1N72 A;  5DKD A;  4NYX A;  5EV9 A;  3P1C A;  5FE2 A;  5D3S A;  4TU4 A;  3O34 A;  5CUA A;  5C7N A;  4TYL A;  5D24 A;  4NUC A;  4IOO A;  4A9M A;  5IG6 A;  3O36 A;  3U5J A;  5D26 A;  2EJN A;  2RO1 A;  5CQ7 A;  4UIV A;  2DWW A;  4QR3 A;  3Q2E A;  5CUD A;  5EWV A;  4NS5 A;  5IGK A;  1WUG A;  2WP1 A;  5CU8 A;  2DKW A;  4KV4 A;  5C87 A;  1ZS5 A;  4QC1 A;  5L8U A;  4O72 A;  1X0J A;  4CFL A;  5EWD A;  4CUQ A;  4YAD A;  5EVA A;  4CUR A;  4J0R A;  4TU6 A;  5I83 A;  2RNW A;  5TB6 A;  3U5O A;  5C89 A;  2R0Y A;  3P5O A;  4NXJ A;  3MB3 A;  5DYX A;  5FG6 A;  5E9L A;  5CY9 A;  5I29 A;  5F25 A;  2DVS A;  4NUE A;  4HXP A;  2RI7 A;  2R10 A;  5EK9 A;  5FE3 A;  4O77 A;  4C67 A;  5F2P A;  4XUB A;  4LRG A;  5ACY A;  3QZV A;  5EWH A;  4IOR A;  4X2I A;  2D9E A;  3NXB A;  3LQI A;  4NQM A;  5CRM A;  4AKN A;  4YC9 A;  4NRC A;  5E9M A;  4IR4 A;  5HM0 A;  4UYH A;  5LVQ A;  2YEK A;  3SVH A;  4NR6 A;  4PKL A;  5H1U A;  5A85 A;  4J0S A;  1PUO A;  4UIU A;  5HRX A;  4XUA A;  5DYU A;  5TCM A;  5FE4 A;  4YBM A;  5FE8 A;  5E7D A;  4Y03 A;  4UIX A;  5H1V A;  5A5O A;  4YAT A;  4LYI A;  5A7C A;  3G0J A;  4OGJ A;  5LKT A;  5LKZ A;  5DLZ A;  5EIC A;  5CQ4 A;  3UVD A;  5AME A;  4O7B A;  4MR3 A;  4E96 A;  4UYD A;  5ENC A;  4YYI A;  5FB0 A;  3LQJ A;  5F5Z A;  4TT6 A;  4BW4 A;  5FE9 A;  4O70 A;  5D3N A;  5JI8 A;  5E3G A;  5E73 A;  4NQN A;  4QSU A;  3LQH A;  4MEO A;  5C8G A;  4KCX A;  4N4H A;  2RS9 B;  5I7Y A;  4HXL A;  5EPR A;  5I7X A;  4PTB A;  3DWY A;  4PS5 A;  4CUU A;  5CQ8 A;  2NXB A;  3U5M A;  5D3T A;  3VKG A;  4ZC9 A;  4YAX A;  5EI4 A;  2DVR A;  5F1L A;  1ZKR A;  3SVF A;  4A9I A;  5HFQ A;  5HQ6 A;  5HQ7 A;  2L85 A;  4A9H A;  2E7N A;  5FBX A;  4CUS A;  5CTL A;  4N4I A;  4NR4 A;  4TS8 A;  5EQ1 A;  5HJC A;  3HME A;  5D3J A;  4TQN A;  4YH3 A;  4ALG A;  4QYD A;  4XY8 A;  5D25 A;  5L99 A;  2R0V A;  5FH8 A;  5CUE A;  2YDW A;  5CFW A;  5KTW A;  2RFJ A;  3QZS A;  1E6I A;  4LZS A;  4UYF B;  5E9I A;  5CQ3 A;  4A9J A;  5A5Q A;  3HMH A;  3UV4 A;  4O7C A;  3IU6 A;  5FFW A;  5CGP A;  2L84 A;  3JVJ A;  5EPS A;  4AKI A;  5FG5 A;  4TZ8 A;  4A9L A;  5DW2 A;  5I88 A;  5EP7 A;  3JVK A;  5G4R A;  5F1H A;  4CUP A;  5ENF A;  5KTU A;  2OUO A;  5DX4 A;  4A9K A;  5A5N A;  3D1D A;  5LJ0 A;  3FKM X;  3UVW A;  4NYV A;  5EIS A;  4QSX A;  3MQM A;  4O75 A;  5L96 A;  4IR5 A;  5BT4 A;  2DAT A;  4NRB A;  5HRW A;  4YBT A;  4O78 A;  5D3L A;  5FFY A;  5I80 A;  4Z6I A;  5IID A;  5KU3 A;  5L8T A;  4J3I A;  4TTE A;  5E3D A;  4YYG A;  3IU5 A;  5E9V A;  4QR4 A;  5KTX A;  4TT2 A;  4QSP A;  4Q0N A;  5DY7 A;  5HEN A;  2E7O A;  5DW1 A;  5DLX A;  5ETD A;  3U5P A;  5E9Y A;  4N4G A;  4YY4 A;  4PY6 A;  3U5L A;  4A9F A;  4UYG A;  5ENB A;  2MJV B;  4KV1 A;  4BW2 A;  3UVY A;  4QUT A;  4HXN A;  4BJX A;  3ZYU A;  2OO1 A;  4O7A A;  3VKH A;  5CUB A;  4DON A;  4QSR A;  4CL9 A;  3S91 A;  2YEM A;  5I1Q A;  4MR6 A;  4HBX A;  5CUG A;  5D3P A;  5DKH A;  4OGI A;  4YK0 A;  2I7K A;  5C4Q A;  3G0L A;  5F36 A;  5H85 A;  2I8N A;  3MUK A;  4QSV A;  3ERR A;  3JVL A;  3K2J A;  5H1T A;  2R0S A;  5FE7 A;  5LUU A;  4HXO A;  4O7F A;  5CQ5 A;  4IR3 A;  4Z93 A;  4AKG A;  5D7X A;  5KHM A;  5HEM A;  4HXS A;  5EA1 A;  4UIY A;  5CUC A;  5EM3 A;  5FE5 A;  5FE1 A;  5I86 A;  3ONI A;  4OUF A;  3D7C A;  4UIT A;  3MXF A;  4LDF A;  4BW3 A;  4ZQL A;  4J1P A;  5L98 A;  4HBV A;  2YYN A;  1JSP B;  2N9G A;  5CQA A;  2E3K A;  4PCE A;  4UIW A;  4LZ2 A;  4NR8 A;  5DFB A;  4NR5 A;  5ENJ A;  5FE6 A;  3UVX A;  5D3R A;  4QEW A;  2F6J A;  5EGU A;  5JWM A;  4LZR A;  5K29 A;  5F62 A;  3UV2 A;  5C85 A;  2WP2 A;  3P1E A;  4HXK A;  4MR5 A;  4QNS A;  5HCL A;  4WHW A;  4MEP A;  5IGL A;  2H60 A;  4NRA A;  4QC3 A;  5FDZ A;  2L5E A;  5D0C A;  4TZ2 A;  2DVQ A;  5AMF A;  4IOQ A;  3SVG A;  5HFR A;  5A81 A;  4AKH A;  2FSA A;  5HEL A;  3GG3 A;  3UV5 A;  2YW5 A;  2F6N A;  3TLP A;  4YYK A;  4NR9 A;  4O7E A;  3U5K A;  2GRC A;  3MUL A;  4QB3 A;  3P1F A;  5E74 A;  5D3H A;  5FE0 A;  5A5P A;  5IGN A;  4YAB A;  4QUU A;  4HXR A;  5HQ5 A;  1EQF A;  5CRZ A;  3I3J A;  4AI6 A;  4LR6 A;  1JM4 B;  2RNX A;  4XYA A;  5FH6 A;  4YYM A;  2LSP B;  4LYS A;  5FB1 A;  3P1D A;  4N3W A;  3LJW A;  4QYL A;  5HLS A;  4HBY A;  5A5S A;  5LKX A;  3AAD A;  3UW9 A;  4RVR A;  4A9O A;  5ENI A;  5EPB A;  5IBN A;  5KO4 A;  2OSS A;  4Z1Q A;  5I40 A;  4HBW A;  4NR7 A;  5II2 A;  3D1B A;  4QEU A;  5ENE A;  4CLB A;  5F60 A;  5DYC A;  5LVR A;  4A9E A;  5ENG A;  4MEN A;  5EU1 A;  4QSS A;  4QR5 A;  4YH4 A;  5HRV A;  4N4F A; 
#chains in the Genus database with same CATH homology
 5CP5 A;  5AD2 A;  3Q2F A;  4QEV A;  2G4A A;  2YQD A;  4BHW A;  5F63 A;  5E9K A;  5CQT A;  4LYW A;  4Q0O A;  5CZG A;  3MB4 A;  4A9N A;  5CPE A;  3O37 A;  2DVV A;  4QST A;  5DYA A;  5ENH A;  5EWC A;  4QSQ A;  4WHU A;  5G4S A;  4BW1 A;  5L97 A;  4UYE A;  1F68 A;  5ETB A;  4Z1S A;  4CUT A;  5DFD A;  4QY4 A;  5IGM A;  3DAI A;  3JVM A;  2KTB B;  4YYJ A;  1WUM A;  2D82 A;  5CS8 A;  5F61 A;  4QBM A;  4ALH A;  3U5N A;  4F3I A;  4YYH A;  4WIV A;  5DFC A;  5AD3 A;  3O33 A;  5J0D A;  3AQA A;  3LXJ A;  5FFV A;  2RNY A;  5EWW A;  5A83 A;  4NYW A;  4PCI A;  5LJ2 A;  4ZW1 A;  4IR6 A;  5BT5 A;  4LC2 A;  4MEQ A;  3QZT A;  4YY6 A;  4YYD A;  4HXM A;  5DKC A;  4Z6H A;  4FLP A;  3HMF A;  3RCW A;  5LJ1 A;  5E0R A;  4UYF A;  4MR4 A;  4QZS A;  5DBM A;  5I89 A;  3O35 A;  5COI A;  5BT3 A;  2YEL A;  4TT4 A;  4O74 A;  5CQ6 A;  4O71 A;  4QSW A;  4CFK A;  5A5R A;  4NUD A;  4XY9 A;  5II1 A;  4GPJ A;  4C66 A;  5F3A A;  3S92 A;  4UIZ A;  5FH7 A;  5A82 A;  5FG4 A;  5LKU A;  4YYN A;  4YBS A;  4O76 A;  1N72 A;  5DKD A;  4NYX A;  5EV9 A;  3P1C A;  5FE2 A;  5D3S A;  4TU4 A;  3O34 A;  5CUA A;  5C7N A;  4TYL A;  5D24 A;  4NUC A;  4IOO A;  4A9M A;  5IG6 A;  3O36 A;  3U5J A;  5D26 A;  2RO1 A;  5CQ7 A;  4UIV A;  2DWW A;  4QR3 A;  3Q2E A;  5CUD A;  5EWV A;  4NS5 A;  5IGK A;  1WUG A;  2WP1 A;  5CU8 A;  2DKW A;  4KV4 A;  5C87 A;  1ZS5 A;  4QC1 A;  5L8U A;  4O72 A;  1X0J A;  4CFL A;  5EWD A;  4CUQ A;  4YAD A;  5EVA A;  4CUR A;  4J0R A;  4TU6 A;  5I83 A;  2RNW A;  5TB6 A;  3U5O A;  5C89 A;  2R0Y A;  3P5O A;  4NXJ A;  3MB3 A;  5DYX A;  5FG6 A;  5E9L A;  5CY9 A;  5I29 A;  5F25 A;  2DVS A;  4NUE A;  4HXP A;  2RI7 A;  2R10 A;  5EK9 A;  5FE3 A;  4O77 A;  4C67 A;  5F2P A;  4XUB A;  4LRG A;  5ACY A;  3QZV A;  5EWH A;  4IOR A;  4X2I A;  2D9E A;  3NXB A;  3LQI A;  4NQM A;  5CRM A;  4AKN A;  4YC9 A;  4NRC A;  5E9M A;  4IR4 A;  5HM0 A;  4UYH A;  5LVQ A;  2YEK A;  3SVH A;  4NR6 A;  4PKL A;  5H1U A;  5A85 A;  4J0S A;  4UIU A;  5HRX A;  4XUA A;  5DYU A;  5TCM A;  5FE4 A;  4YBM A;  5FE8 A;  5E7D A;  4Y03 A;  4UIX A;  5H1V A;  5A5O A;  4YAT A;  4LYI A;  5A7C A;  3G0J A;  4OGJ A;  5LKT A;  5LKZ A;  5DLZ A;  5EIC A;  5CQ4 A;  3UVD A;  5AME A;  4O7B A;  4MR3 A;  4E96 A;  4UYD A;  5ENC A;  4YYI A;  5FB0 A;  3LQJ A;  5F5Z A;  4TT6 A;  4BW4 A;  5FE9 A;  4O70 A;  5D3N A;  5JI8 A;  5E3G A;  5E73 A;  4NQN A;  4QSU A;  3LQH A;  4MEO A;  5C8G A;  4KCX A;  4N4H A;  2RS9 B;  5I7Y A;  4HXL A;  5EPR A;  5I7X A;  4PTB A;  3DWY A;  4PS5 A;  4CUU A;  5CQ8 A;  2NXB A;  3U5M A;  5D3T A;  4ZC9 A;  4YAX A;  5EI4 A;  2DVR A;  5F1L A;  4A9I A;  3SVF A;  5HFQ A;  5HQ6 A;  5HQ7 A;  2L85 A;  4A9H A;  2E7N A;  5FBX A;  4CUS A;  5CTL A;  4N4I A;  4NR4 A;  4TS8 A;  5EQ1 A;  5HJC A;  3HME A;  5D3J A;  4TQN A;  4YH3 A;  4ALG A;  4QYD A;  4XY8 A;  5D25 A;  5L99 A;  2R0V A;  5FH8 A;  5CUE A;  2YDW A;  5CFW A;  5KTW A;  2RFJ A;  3QZS A;  1E6I A;  4LZS A;  4UYF B;  5E9I A;  5CQ3 A;  4A9J A;  5A5Q A;  3HMH A;  3UV4 A;  4O7C A;  3IU6 A;  5FFW A;  5CGP A;  2L84 A;  3JVJ A;  5EPS A;  5FG5 A;  4TZ8 A;  4A9L A;  5DW2 A;  5I88 A;  5EP7 A;  3JVK A;  5G4R A;  5F1H A;  4CUP A;  5ENF A;  5KTU A;  2OUO A;  5DX4 A;  4A9K A;  5A5N A;  5LJ0 A;  3FKM X;  3UVW A;  4NYV A;  5EIS A;  4QSX A;  3MQM A;  4O75 A;  5L96 A;  4IR5 A;  5BT4 A;  2DAT A;  4NRB A;  5HRW A;  4YBT A;  4O78 A;  5D3L A;  5FFY A;  5I80 A;  4Z6I A;  5IID A;  5KU3 A;  5L8T A;  4J3I A;  4TTE A;  5E3D A;  4YYG A;  3IU5 A;  5E9V A;  4QR4 A;  5KTX A;  4TT2 A;  4QSP A;  4Q0N A;  5DY7 A;  5HEN A;  2E7O A;  5DW1 A;  5DLX A;  5ETD A;  3U5P A;  5E9Y A;  4N4G A;  4YY4 A;  4PY6 A;  3U5L A;  4A9F A;  4UYG A;  5ENB A;  2MJV B;  4KV1 A;  4BW2 A;  3UVY A;  4QUT A;  4HXN A;  4BJX A;  3ZYU A;  2OO1 A;  4O7A A;  5CUB A;  4DON A;  4QSR A;  4CL9 A;  3S91 A;  2YEM A;  5I1Q A;  4MR6 A;  4HBX A;  5CUG A;  5D3P A;  5DKH A;  4OGI A;  4YK0 A;  2I7K A;  5C4Q A;  3G0L A;  5F36 A;  5H85 A;  2I8N A;  3MUK A;  4QSV A;  5H1T A;  3JVL A;  3K2J A;  2R0S A;  5FE7 A;  5LUU A;  4HXO A;  4O7F A;  5CQ5 A;  4IR3 A;  4Z93 A;  5D7X A;  5KHM A;  5HEM A;  4HXS A;  5EA1 A;  4UIY A;  5CUC A;  5EM3 A;  5FE5 A;  5FE1 A;  5I86 A;  3ONI A;  4OUF A;  3D7C A;  4UIT A;  3MXF A;  4LDF A;  4BW3 A;  4ZQL A;  4J1P A;  5L98 A;  4HBV A;  2YYN A;  1JSP B;  2N9G A;  5CQA A;  2E3K A;  4PCE A;  4UIW A;  4LZ2 A;  4NR8 A;  5DFB A;  4NR5 A;  5ENJ A;  5FE6 A;  3UVX A;  5D3R A;  4QEW A;  2F6J A;  5EGU A;  5JWM A;  4LZR A;  5K29 A;  5F62 A;  3UV2 A;  5C85 A;  2WP2 A;  3P1E A;  4HXK A;  4MR5 A;  4QNS A;  5HCL A;  4WHW A;  4MEP A;  5IGL A;  2H60 A;  4NRA A;  4QC3 A;  5FDZ A;  2L5E A;  5D0C A;  4TZ2 A;  2DVQ A;  5AMF A;  4IOQ A;  3SVG A;  5HFR A;  5A81 A;  2FSA A;  5HEL A;  3GG3 A;  3UV5 A;  2YW5 A;  2F6N A;  3TLP A;  4YYK A;  4NR9 A;  4O7E A;  3U5K A;  2GRC A;  3MUL A;  4QB3 A;  3P1F A;  5E74 A;  5D3H A;  5FE0 A;  5A5P A;  5IGN A;  4YAB A;  4QUU A;  4HXR A;  5HQ5 A;  1EQF A;  5CRZ A;  3I3J A;  4LR6 A;  1JM4 B;  2RNX A;  4XYA A;  5FH6 A;  4YYM A;  2LSP B;  4LYS A;  5FB1 A;  3P1D A;  4N3W A;  3LJW A;  4QYL A;  5HLS A;  4HBY A;  5A5S A;  5LKX A;  3AAD A;  3UW9 A;  4RVR A;  4A9O A;  5ENI A;  5EPB A;  5IBN A;  5KO4 A;  2OSS A;  4Z1Q A;  5I40 A;  4HBW A;  4NR7 A;  5II2 A;  4QEU A;  5ENE A;  4CLB A;  5F60 A;  5DYC A;  5LVR A;  4A9E A;  5ENG A;  4MEN A;  5EU1 A;  4QSS A;  4QR5 A;  4YH4 A;  5HRV A;  4N4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...