5ENBA

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with o-tolylthiourea (sgc - diamond i04-1 fragment screening)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
123
structure length
123
Chain Sequence
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PH-interacting protein
publication title A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5enbA00
3S92A 4HBYA 1N72A 4XY9A 4GPJA 5D25A 3NXBA 5TB6A 4CUPA 5HRXA 3TLPA 5H1UA 5HQ7A 5DW1A 3LQJA 5CRMA 4IR6A 4J0RA 4A9HA 5LKTA 4HBXA 5EK9A 4A9IA 3RCWA 4MENA 5C85A 4NXJA 5ENHA 5FE8A 5D24A 5HENA 5C87A 2I8NA 4YYIA 4HXMA 4LR6A 4MR6A 5A5PA 5A82A 4HXLA 5A5SA 5F1LA 4YBMA 4MR5A 4HXSA 4TT6A 5DFCA 5I80A 4OGJA 4BW1A 3JVLA 2KTBB 4A9JA 4O77A 5HFQA 5EWCA 2YYNA 5FG4A 3D7CA 4Z93A 4QSWA 5LJ2A 1EQFA 5FFYA 5FB0A 4BW4A 4LRGA 4MEQA 5E9KA 4TU6A 5E73A 5I89A 4YH4A 4QC1A 4YAXA 3GG3A 2E7OA 3AADA 5A5NA 5CTLA 4NYWA 3SVHA 4YY4A 4YBTA 5F62A 5FE4A 4QSPA 4HXNA 5E9VA 4PCEA 5FDZA 2N9GA 4PY6A 5I7XA 5AD2A 5E7DA 5CQ7A 5EV9A 5F61A 3UV4A 3QZSA 4NR8A 5LVRA 3DWYA 5C7NA 5ENIA 5CP5A 4QYLA 5I88A 3ZYUA 5F1HA 5F25A 5KU3A 2WP1A 4O7CA 4CUSA 5CUDA 5LKZA 4UYEA 4IR5A 5CGPA 2R0SA 4QB3A 5CQ4A 5HCLA 2RNXA 4UYGA 5LKUA 5D3PA 5FH6A 2L84A 3JVMA 5L99A 5A5QA 2D9EA 4XY8A 3U5LA 2H60A 4OGIA 5ENCA 4UITA 5FFWA 5G4RA 4A9LA 3AQAA 4QSQA 1WUMA 3LXJA 4N4GA 5CQ5A 5I29A 4Y03A 3UV2A 3JVJA 2RFJA 5E3DA 2F6JA 4WIVA 4O75A 4UYDA 3Q2EA 4UYHA 5ENBA 5FE6A 5LVQA 4CUTA 5H85A 3HMFA 4TZ2A 4CUUA 5CUAA 5DKHA 4Q0OA 5J0DA 5E9MA 4NYXA 5CY9A 3UVDA 4XUBA 5LJ1A 5AMEA 5HEMA 3MQMA 4HBWA 3U5MA 5LJ0A 5DFDA 4HXKA 4CFLA 5CU8A 4NYVA 5E3GA 5A83A 5EGUA 5DYAA 5D3SA 5HJCA 3DAIA 4QZSA 4ZC9A 4UIVA 2MJVB 5A5RA 5D7XA 4X2IA 4YADA 5EPBA 5FB1A 4CLBA 4XUAA 3LQIA 4QNSA 4QR4A 5D3RA 2LSPB 4NR4A 3MB4A 4J1PA 5ENFA 5IGNA 4Z6HA 5FE9A 4QC3A 5ENGA 5FFVA 4WHWA 4BJXA 5KO4A 3S91A 4MEPA 4KV4A 2YQDA 4CL9A 4N4IA 4Z1SA 2I7KA 5HM0A 4F3IA 5E0RA 5IGKA 5FBXA 4A9KA 4UIZA 4TT2A 5EWWA 2YELA 4LC2A 2D82A 4CURA 5FE2A 5ENEA 5A81A 5ETBA 4YYDA 4O7FA 3MUKA 2DWWA 2R0VA 2YDWA 4UIYA 5D3JA 4UYFB 4QSRA 5HQ5A 5BT5A 4QSXA 3P1EA 4TZ8A 5FE0A 5DKCA 4TT4A 4QR5A 5BT4A 3G0LA 5CZGA 5I86A 5CUGA 5F5ZA 4HXPA 4NQNA 5DYCA 5EU1A 4HBVA 4A9FA 4RVRA 4QEUA 5FE5A 4C67A 4N3WA 3MB3A 2WP2A 3LQHA 5L98A 5DW2A 4KCXA 5L8UA 5F36A 5HQ6A 4O71A 5I7YA 4QSUA 3O37A 4CUQA 1WUGA 5D3TA 5A5OA 4NUEA 5IBNA 4QUUA 4YY6A 4C66A 4Z1QA 4PTBA 2G4AA 4HXOA 5HRVA 4YK0A 5DFBA 5I83A 2GRCA 4TU4A 5IGMA 5C8GA 3G0JA 1JM4B 2OUOA 4O7AA 3QZTA 3U5OA 5FH7A 5E74A 3K2JA 5CQTA 5E9LA 3U5NA 4NRAA 4QYDA 5K29A 5II2A 2DKWA 4QSSA 4BHWA 4IORA 5D3HA 2YEKA 3I3JA 3U5PA 3P1FA 3Q2FA 4FLPA 5EM3A 4QUTA 5TCMA 2YEMA 4J3IA 3UW9A 4N4HA 5EWVA 4O78A 2OO1A 5F63A 5COIA 5AD3A 4Q0NA 5EWHA 4YC9A 5DX4A 5CUBA 5II1A 3FKMX 4O7EA 5HELA 5D26A 5IGLA 5FG5A 5LKXA 4YYHA 5D0CA 5EI4A 3U5KA 4O70A 5F3AA 3SVGA 3O33A 5KTUA 2DVSA 5D3NA 4YATA 5DY7A 3IU6A 4NRCA 2R0YA 4NQMA 3JVKA 4UIWA 5CUEA 4BW2A 4YYGA 2RS9B 2FSAA 4BW3A 4XYAA 5DKDA 3LJWA 5I40A 4PKLA 4QSTA 5CRZA 4PCIA 5FE7A 5L8TA 5A7CA 4A9MA 5CS8A 4ALGA 4NR9A 5KTXA 5CFWA 4LYWA 5DBMA 5CQ3A 2E3KA 3O35A 5EWDA 5AMFA 5JI8A 3UVWA 3QZVA 5CQ8A 5DLZA 4TS8A 5A85A 2RNWA 4MR3A 4O74A 5FG6A 5F2PA 4YYJA 4YBSA 3MXFA 4NS5A 3O34A 2DVRA 5EPSA 5HFRA 5C4QA 4MEOA 3IU5A 5E9IA 5L97A 4HXRA 4O72A 4YH3A 5FE3A 2RI7A 5EISA 4NUCA 3SVFA 3MULA 4QY4A 2DATA 4AKNA 5BT3A 3P5OA 4OUFA 5EA1A 5C89A 5G4SA 5EICA 4UIXA 2YW5A 4ZQLA 4A9EA 5EP7A 2RNYA 4PS5A 5CQ6A 4QEVA 3O36A 2L85A 4NRBA 4A9NA 3UVYA 4YABA 4QSVA 4LYSA 5HRWA 5IIDA 5JWMA 5D3LA 5CUCA 2L5EA 1X0JA 5CPEA 5KHMA 5E9YA 5ENJA 1F68A 4LZ2A 1E6IA 5FH8A 4QR3A 2DVQA 5H1VA 4QEWA 4IOOA 5F60A 2DVVA 4YYMA 4NUDA 4TTEA 5KTWA 3HMEA 3P1DA 1ZS5A 5H1TA 5IG6A 4IR4A 5ETDA 5EQ1A 4NR6A 4WHUA 4LYIA 4E96A 2RO1A 4DONA 5ACYA 4KV1A 4QBMA 5EPRA 2F6NA 3UV5A 4CFKA 2OSSA 4O7BA 4N4FA 4LZSA 2NXBA 5DYUA 3UVXA 4TQNA 5CQAA 5DYXA 3ONIA 4MR4A 5I1QA 5DLXA 4YYNA 4ALHA 5L96A 4J0SA 4LDFA 4IOQA 5FE1A 4LZRA 4Z6IA 5LUUA 5HLSA 4NR5A 4O76A 4UIUA 5EVAA 4A9OA 4YYKA 2R10A 4UYFA 4ZW1A 3HMHA 4TYLA 4NR7A 1JSPB 3U5JA 4IR3A 2E7NA 3P1CA
chains in the Genus database with same CATH superfamily
3S92A 4HBYA 1N72A 4XY9A 4GPJA 5D25A 3NXBA 5TB6A 4CUPA 5HRXA 3TLPA 5H1UA 5HQ7A 5DW1A 3LQJA 5CRMA 4IR6A 4J0RA 4A9HA 5LKTA 4HBXA 5EK9A 4A9IA 3RCWA 4MENA 5C85A 4NXJA 5ENHA 5FE8A 5D24A 5HENA 5C87A 2I8NA 4YYIA 4HXMA 4LR6A 4MR6A 5A5PA 2EJNA 5A82A 4HXLA 5A5SA 5F1LA 4YBMA 4MR5A 4HXSA 4TT6A 5DFCA 5I80A 3ERRA 4OGJA 4BW1A 3JVLA 2KTBB 4A9JA 4O77A 5HFQA 5EWCA 2YYNA 5FG4A 3D7CA 4Z93A 4QSWA 5LJ2A 1EQFA 5FFYA 5FB0A 4BW4A 4LRGA 4MEQA 5E9KA 4TU6A 5E73A 5I89A 4YH4A 4QC1A 4YAXA 3GG3A 2E7OA 3AADA 5A5NA 5CTLA 4NYWA 3SVHA 4YY4A 4YBTA 5F62A 5FE4A 4QSPA 4HXNA 5E9VA 4PCEA 5FDZA 2N9GA 4PY6A 5I7XA 5AD2A 5E7DA 5CQ7A 5EV9A 5F61A 3UV4A 3QZSA 4NR8A 5LVRA 3DWYA 5C7NA 5ENIA 5CP5A 4QYLA 5I88A 3ZYUA 5F1HA 5F25A 5KU3A 2WP1A 4O7CA 3VKGA 4CUSA 5CUDA 5LKZA 4UYEA 4IR5A 5CGPA 2R0SA 4QB3A 5CQ4A 5HCLA 2RNXA 4UYGA 5LKUA 5D3PA 5FH6A 2L84A 3JVMA 5L99A 5A5QA 2D9EA 4XY8A 3U5LA 2H60A 4OGIA 5ENCA 4UITA 5FFWA 5G4RA 4A9LA 3AQAA 4QSQA 1WUMA 3LXJA 4N4GA 5CQ5A 5I29A 4Y03A 3UV2A 3JVJA 2RFJA 5E3DA 2F6JA 4WIVA 4O75A 4UYDA 3Q2EA 4UYHA 5ENBA 5FE6A 5LVQA 4CUTA 5H85A 3HMFA 4TZ2A 4CUUA 5CUAA 5DKHA 4Q0OA 5J0DA 5E9MA 4NYXA 5CY9A 3UVDA 4XUBA 5LJ1A 5AMEA 5HEMA 3MQMA 4HBWA 3U5MA 5LJ0A 5DFDA 4HXKA 4CFLA 5CU8A 4NYVA 5E3GA 5A83A 5EGUA 5DYAA 5D3SA 5HJCA 3DAIA 4QZSA 4ZC9A 4UIVA 2MJVB 5A5RA 5D7XA 4X2IA 4YADA 5EPBA 5FB1A 4CLBA 4XUAA 3LQIA 4AI6A 4QNSA 4QR4A 5D3RA 2LSPB 4NR4A 3MB4A 4J1PA 5ENFA 5IGNA 4Z6HA 5FE9A 4QC3A 5ENGA 5FFVA 4WHWA 4BJXA 5KO4A 3S91A 4MEPA 4KV4A 2YQDA 4CL9A 4N4IA 4Z1SA 2I7KA 5HM0A 4F3IA 5E0RA 5IGKA 5FBXA 4A9KA 4UIZA 4TT2A 5EWWA 2YELA 4LC2A 2D82A 4CURA 5FE2A 5ENEA 5A81A 5ETBA 4YYDA 4O7FA 3MUKA 2DWWA 2R0VA 2YDWA 4UIYA 5D3JA 4UYFB 4QSRA 5HQ5A 5BT5A 4QSXA 3P1EA 4TZ8A 5FE0A 5DKCA 4TT4A 4QR5A 5BT4A 3G0LA 5CZGA 5I86A 5CUGA 5F5ZA 4HXPA 4NQNA 5DYCA 5EU1A 4HBVA 1ZKRA 3D1DA 4A9FA 4RVRA 4QEUA 5FE5A 4C67A 4N3WA 3MB3A 2WP2A 3LQHA 5L98A 5DW2A 4KCXA 5L8UA 5F36A 5HQ6A 4O71A 5I7YA 4QSUA 3O37A 4CUQA 1WUGA 5D3TA 5A5OA 4NUEA 5IBNA 4QUUA 4YY6A 4C66A 4Z1QA 4PTBA 2G4AA 4HXOA 5HRVA 4YK0A 5DFBA 5I83A 2GRCA 4TU4A 5IGMA 5C8GA 3G0JA 1JM4B 2OUOA 4O7AA 3QZTA 3U5OA 5FH7A 5E74A 3K2JA 5CQTA 5E9LA 3U5NA 4NRAA 4QYDA 5K29A 5II2A 2DKWA 4QSSA 4BHWA 4IORA 4AKGA 5D3HA 2YEKA 3I3JA 3U5PA 3P1FA 3Q2FA 4FLPA 5EM3A 4QUTA 5TCMA 2YEMA 4J3IA 3UW9A 3VKHA 4N4HA 5EWVA 4O78A 2OO1A 5F63A 5COIA 5AD3A 4Q0NA 5EWHA 4YC9A 5DX4A 5CUBA 5II1A 3FKMX 4O7EA 5HELA 5D26A 5IGLA 5FG5A 5LKXA 4YYHA 5D0CA 1PUOA 5EI4A 3U5KA 4O70A 5F3AA 3SVGA 3O33A 5KTUA 2DVSA 5D3NA 4YATA 5DY7A 3IU6A 4NRCA 2R0YA 4NQMA 3JVKA 4UIWA 5CUEA 4BW2A 4YYGA 2RS9B 2FSAA 4BW3A 4XYAA 5DKDA 3LJWA 5I40A 4PKLA 4QSTA 5CRZA 4PCIA 5FE7A 5L8TA 5A7CA 4A9MA 5CS8A 4ALGA 4NR9A 5KTXA 5CFWA 4LYWA 5DBMA 5CQ3A 2E3KA 4AKIA 3O35A 5EWDA 5AMFA 5JI8A 3UVWA 3QZVA 5CQ8A 5DLZA 4TS8A 5A85A 2RNWA 4MR3A 4O74A 5FG6A 5F2PA 4YYJA 4YBSA 3MXFA 4NS5A 3O34A 2DVRA 5EPSA 5HFRA 5C4QA 4MEOA 3IU5A 5E9IA 5L97A 4HXRA 4O72A 4YH3A 5FE3A 2RI7A 5EISA 4NUCA 3SVFA 3MULA 4QY4A 2DATA 4AKNA 5BT3A 3P5OA 4OUFA 5EA1A 5C89A 5G4SA 5EICA 4UIXA 2YW5A 4ZQLA 4A9EA 5EP7A 2RNYA 4PS5A 5CQ6A 4QEVA 3O36A 2L85A 4NRBA 4A9NA 3UVYA 4YABA 4QSVA 4LYSA 5HRWA 5IIDA 5JWMA 5D3LA 5CUCA 2L5EA 1X0JA 5CPEA 5KHMA 5E9YA 5ENJA 1F68A 4LZ2A 1E6IA 5FH8A 4QR3A 2DVQA 5H1VA 4QEWA 4AKHA 4IOOA 5F60A 2DVVA 4YYMA 4NUDA 4TTEA 5KTWA 3HMEA 3P1DA 1ZS5A 5H1TA 5IG6A 4IR4A 5ETDA 5EQ1A 4NR6A 4WHUA 3D1BA 4LYIA 4E96A 2RO1A 4DONA 5ACYA 4KV1A 4QBMA 5EPRA 2F6NA 3UV5A 4CFKA 2OSSA 4O7BA 4N4FA 4LZSA 2NXBA 5DYUA 3UVXA 4TQNA 5CQAA 5DYXA 3ONIA 4MR4A 5I1QA 5DLXA 4YYNA 4ALHA 5L96A 4J0SA 4LDFA 4IOQA 5FE1A 4LZRA 4Z6IA 5LUUA 5HLSA 4NR5A 4O76A 4UIUA 5EVAA 4A9OA 4YYKA 2R10A 4UYFA 4ZW1A 3HMHA 4TYLA 4NR7A 1JSPB 3U5JA 4IR3A 2E7NA 3P1CA
chains in the Genus database with same CATH topology
3S92A 4HBYA 1N72A 4XY9A 4GPJA 5D25A 3NXBA 5TB6A 4CUPA 5HRXA 3TLPA 5H1UA 5HQ7A 5DW1A 3LQJA 5CRMA 4IR6A 4J0RA 4A9HA 5LKTA 4HBXA 5EK9A 4A9IA 3RCWA 4MENA 5C85A 4NXJA 5ENHA 5FE8A 5D24A 5HENA 5C87A 2I8NA 4YYIA 4HXMA 4LR6A 4MR6A 5A5PA 5A82A 4HXLA 5A5SA 5F1LA 4YBMA 4MR5A 4HXSA 4TT6A 5DFCA 5I80A 4OGJA 4BW1A 3JVLA 2KTBB 4A9JA 4O77A 5HFQA 5EWCA 2YYNA 5FG4A 3D7CA 4Z93A 4QSWA 5LJ2A 1EQFA 5FFYA 5FB0A 4BW4A 4LRGA 4MEQA 5E9KA 4TU6A 5E73A 5I89A 4YH4A 4QC1A 4YAXA 3GG3A 2E7OA 3AADA 5A5NA 5CTLA 4NYWA 3SVHA 4YY4A 4YBTA 5F62A 5FE4A 4QSPA 4HXNA 5E9VA 4PCEA 5FDZA 2N9GA 4PY6A 5I7XA 5AD2A 5E7DA 5CQ7A 5EV9A 5F61A 3UV4A 3QZSA 4NR8A 5LVRA 3DWYA 5C7NA 5ENIA 5CP5A 4QYLA 5I88A 3ZYUA 5F1HA 5F25A 5KU3A 2WP1A 4O7CA 4CUSA 5CUDA 5LKZA 4UYEA 4IR5A 5CGPA 2R0SA 4QB3A 5CQ4A 5HCLA 2RNXA 4UYGA 5LKUA 5D3PA 5FH6A 2L84A 3JVMA 5L99A 5A5QA 2D9EA 4XY8A 3U5LA 2H60A 4OGIA 5ENCA 4UITA 5FFWA 5G4RA 4A9LA 3AQAA 4QSQA 1WUMA 3LXJA 4N4GA 5CQ5A 5I29A 4Y03A 3UV2A 3JVJA 2RFJA 5E3DA 2F6JA 4WIVA 4O75A 4UYDA 3Q2EA 4UYHA 5ENBA 5FE6A 5LVQA 4CUTA 5H85A 3HMFA 4TZ2A 4CUUA 5CUAA 5DKHA 4Q0OA 5J0DA 5E9MA 4NYXA 5CY9A 3UVDA 4XUBA 5LJ1A 5AMEA 5HEMA 3MQMA 4HBWA 3U5MA 5LJ0A 5DFDA 4HXKA 4CFLA 5CU8A 4NYVA 5E3GA 5A83A 5EGUA 5DYAA 5D3SA 5HJCA 3DAIA 4QZSA 4ZC9A 4UIVA 2MJVB 5A5RA 5D7XA 4X2IA 4YADA 5EPBA 5FB1A 4CLBA 4XUAA 3LQIA 4QNSA 4QR4A 5D3RA 2LSPB 4NR4A 3MB4A 4J1PA 5ENFA 5IGNA 4Z6HA 5FE9A 4QC3A 5ENGA 5FFVA 4WHWA 4BJXA 5KO4A 3S91A 4MEPA 4KV4A 2YQDA 4CL9A 4N4IA 4Z1SA 2I7KA 5HM0A 4F3IA 5E0RA 5IGKA 5FBXA 4A9KA 4UIZA 4TT2A 5EWWA 2YELA 4LC2A 2D82A 4CURA 5FE2A 5ENEA 5A81A 5ETBA 4YYDA 4O7FA 3MUKA 2DWWA 2R0VA 2YDWA 4UIYA 5D3JA 4UYFB 4QSRA 5HQ5A 5BT5A 4QSXA 3P1EA 4TZ8A 5FE0A 5DKCA 4TT4A 4QR5A 5BT4A 3G0LA 5CZGA 5I86A 5CUGA 5F5ZA 4HXPA 4NQNA 5DYCA 5EU1A 4HBVA 4A9FA 4RVRA 4QEUA 5FE5A 4C67A 4N3WA 3MB3A 2WP2A 3LQHA 5L98A 5DW2A 4KCXA 5L8UA 5F36A 5HQ6A 4O71A 5I7YA 4QSUA 3O37A 4CUQA 1WUGA 5D3TA 5A5OA 4NUEA 5IBNA 4QUUA 4YY6A 4C66A 4Z1QA 4PTBA 2G4AA 4HXOA 5HRVA 4YK0A 5DFBA 5I83A 2GRCA 4TU4A 5IGMA 5C8GA 3G0JA 1JM4B 2OUOA 4O7AA 3QZTA 3U5OA 5FH7A 5E74A 3K2JA 5CQTA 5E9LA 3U5NA 4NRAA 4QYDA 5K29A 5II2A 2DKWA 4QSSA 4BHWA 4IORA 5D3HA 2YEKA 3I3JA 3U5PA 3P1FA 3Q2FA 4FLPA 5EM3A 4QUTA 5TCMA 2YEMA 4J3IA 3UW9A 4N4HA 5EWVA 4O78A 2OO1A 5F63A 5COIA 5AD3A 4Q0NA 5EWHA 4YC9A 5DX4A 5CUBA 5II1A 3FKMX 4O7EA 5HELA 5D26A 5IGLA 5FG5A 5LKXA 4YYHA 5D0CA 5EI4A 3U5KA 4O70A 5F3AA 3SVGA 3O33A 5KTUA 2DVSA 5D3NA 4YATA 5DY7A 3IU6A 4NRCA 2R0YA 4NQMA 3JVKA 4UIWA 5CUEA 4BW2A 4YYGA 2RS9B 2FSAA 4BW3A 4XYAA 5DKDA 3LJWA 5I40A 4PKLA 4QSTA 5CRZA 4PCIA 5FE7A 5L8TA 5A7CA 4A9MA 5CS8A 4ALGA 4NR9A 5KTXA 5CFWA 4LYWA 5DBMA 5CQ3A 2E3KA 3O35A 5EWDA 5AMFA 5JI8A 3UVWA 3QZVA 5CQ8A 5DLZA 4TS8A 5A85A 2RNWA 4MR3A 4O74A 5FG6A 5F2PA 4YYJA 4YBSA 3MXFA 4NS5A 3O34A 2DVRA 5EPSA 5HFRA 5C4QA 4MEOA 3IU5A 5E9IA 5L97A 4HXRA 4O72A 4YH3A 5FE3A 2RI7A 5EISA 4NUCA 3SVFA 3MULA 4QY4A 2DATA 4AKNA 5BT3A 3P5OA 4OUFA 5EA1A 5C89A 5G4SA 5EICA 4UIXA 2YW5A 4ZQLA 4A9EA 5EP7A 2RNYA 4PS5A 5CQ6A 4QEVA 3O36A 2L85A 4NRBA 4A9NA 3UVYA 4YABA 4QSVA 4LYSA 5HRWA 5IIDA 5JWMA 5D3LA 5CUCA 2L5EA 1X0JA 5CPEA 5KHMA 5E9YA 5ENJA 1F68A 4LZ2A 1E6IA 5FH8A 4QR3A 2DVQA 5H1VA 4QEWA 4IOOA 5F60A 2DVVA 4YYMA 4NUDA 4TTEA 5KTWA 3HMEA 3P1DA 1ZS5A 5H1TA 5IG6A 4IR4A 5ETDA 5EQ1A 4NR6A 4WHUA 4LYIA 4E96A 2RO1A 4DONA 5ACYA 4KV1A 4QBMA 5EPRA 2F6NA 3UV5A 4CFKA 2OSSA 4O7BA 4N4FA 4LZSA 2NXBA 5DYUA 3UVXA 4TQNA 5CQAA 5DYXA 3ONIA 4MR4A 5I1QA 5DLXA 4YYNA 4ALHA 5L96A 4J0SA 4LDFA 4IOQA 5FE1A 4LZRA 4Z6IA 5LUUA 5HLSA 4NR5A 4O76A 4UIUA 5EVAA 4A9OA 4YYKA 2R10A 4UYFA 4ZW1A 3HMHA 4TYLA 4NR7A 1JSPB 3U5JA 4IR3A 2E7NA 3P1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S92 A;  4HBY A;  1N72 A;  4XY9 A;  4GPJ A;  5D25 A;  3NXB A;  5TB6 A;  4CUP A;  5HRX A;  3TLP A;  5H1U A;  5HQ7 A;  5DW1 A;  3LQJ A;  5CRM A;  4IR6 A;  4J0R A;  4A9H A;  5LKT A;  4HBX A;  5EK9 A;  4A9I A;  3RCW A;  4MEN A;  5C85 A;  4NXJ A;  5ENH A;  5FE8 A;  5D24 A;  5HEN A;  5C87 A;  2I8N A;  4YYI A;  4HXM A;  4LR6 A;  4MR6 A;  5A5P A;  5A82 A;  4HXL A;  5A5S A;  5F1L A;  4YBM A;  4MR5 A;  4HXS A;  4TT6 A;  5DFC A;  5I80 A;  4OGJ A;  4BW1 A;  3JVL A;  2KTB B;  4A9J A;  4O77 A;  5HFQ A;  5EWC A;  2YYN A;  5FG4 A;  3D7C A;  4Z93 A;  4QSW A;  5LJ2 A;  1EQF A;  5FFY A;  5FB0 A;  4BW4 A;  4LRG A;  4MEQ A;  5E9K A;  4TU6 A;  5E73 A;  5I89 A;  4YH4 A;  4QC1 A;  4YAX A;  3GG3 A;  2E7O A;  3AAD A;  5A5N A;  5CTL A;  4NYW A;  3SVH A;  4YY4 A;  4YBT A;  5F62 A;  5FE4 A;  4QSP A;  4HXN A;  5E9V A;  4PCE A;  5FDZ A;  2N9G A;  4PY6 A;  5I7X A;  5AD2 A;  5E7D A;  5CQ7 A;  5EV9 A;  5F61 A;  3UV4 A;  3QZS A;  4NR8 A;  5LVR A;  3DWY A;  5C7N A;  5ENI A;  5CP5 A;  4QYL A;  5I88 A;  3ZYU A;  5F1H A;  5F25 A;  5KU3 A;  2WP1 A;  4O7C A;  4CUS A;  5CUD A;  5LKZ A;  4UYE A;  4IR5 A;  5CGP A;  2R0S A;  4QB3 A;  5CQ4 A;  5HCL A;  2RNX A;  4UYG A;  5LKU A;  5D3P A;  5FH6 A;  2L84 A;  3JVM A;  5L99 A;  5A5Q A;  2D9E A;  4XY8 A;  3U5L A;  2H60 A;  4OGI A;  5ENC A;  4UIT A;  5FFW A;  5G4R A;  4A9L A;  3AQA A;  4QSQ A;  1WUM A;  3LXJ A;  4N4G A;  5CQ5 A;  5I29 A;  4Y03 A;  3UV2 A;  3JVJ A;  2RFJ A;  5E3D A;  2F6J A;  4WIV A;  4O75 A;  4UYD A;  3Q2E A;  4UYH A;  5ENB A;  5FE6 A;  5LVQ A;  4CUT A;  5H85 A;  3HMF A;  4TZ2 A;  4CUU A;  5CUA A;  5DKH A;  4Q0O A;  5J0D A;  5E9M A;  4NYX A;  5CY9 A;  3UVD A;  4XUB A;  5LJ1 A;  5AME A;  5HEM A;  3MQM A;  4HBW A;  3U5M A;  5LJ0 A;  5DFD A;  4HXK A;  4CFL A;  5CU8 A;  4NYV A;  5E3G A;  5A83 A;  5EGU A;  5DYA A;  5D3S A;  5HJC A;  3DAI A;  4QZS A;  4ZC9 A;  4UIV A;  2MJV B;  5A5R A;  5D7X A;  4X2I A;  4YAD A;  5EPB A;  5FB1 A;  4CLB A;  4XUA A;  3LQI A;  4QNS A;  4QR4 A;  5D3R A;  2LSP B;  4NR4 A;  3MB4 A;  4J1P A;  5ENF A;  5IGN A;  4Z6H A;  5FE9 A;  4QC3 A;  5ENG A;  5FFV A;  4WHW A;  4BJX A;  5KO4 A;  3S91 A;  4MEP A;  4KV4 A;  2YQD A;  4CL9 A;  4N4I A;  4Z1S A;  2I7K A;  5HM0 A;  4F3I A;  5E0R A;  5IGK A;  5FBX A;  4A9K A;  4UIZ A;  4TT2 A;  5EWW A;  2YEL A;  4LC2 A;  2D82 A;  4CUR A;  5FE2 A;  5ENE A;  5A81 A;  5ETB A;  4YYD A;  4O7F A;  3MUK A;  2DWW A;  2R0V A;  2YDW A;  4UIY A;  5D3J A;  4UYF B;  4QSR A;  5HQ5 A;  5BT5 A;  4QSX A;  3P1E A;  4TZ8 A;  5FE0 A;  5DKC A;  4TT4 A;  4QR5 A;  5BT4 A;  3G0L A;  5CZG A;  5I86 A;  5CUG A;  5F5Z A;  4HXP A;  4NQN A;  5DYC A;  5EU1 A;  4HBV A;  4A9F A;  4RVR A;  4QEU A;  5FE5 A;  4C67 A;  4N3W A;  3MB3 A;  2WP2 A;  3LQH A;  5L98 A;  5DW2 A;  4KCX A;  5L8U A;  5F36 A;  5HQ6 A;  4O71 A;  5I7Y A;  4QSU A;  3O37 A;  4CUQ A;  1WUG A;  5D3T A;  5A5O A;  4NUE A;  5IBN A;  4QUU A;  4YY6 A;  4C66 A;  4Z1Q A;  4PTB A;  2G4A A;  4HXO A;  5HRV A;  4YK0 A;  5DFB A;  5I83 A;  2GRC A;  4TU4 A;  5IGM A;  5C8G A;  3G0J A;  1JM4 B;  2OUO A;  4O7A A;  3QZT A;  3U5O A;  5FH7 A;  5E74 A;  3K2J A;  5CQT A;  5E9L A;  3U5N A;  4NRA A;  4QYD A;  5K29 A;  5II2 A;  2DKW A;  4QSS A;  4BHW A;  4IOR A;  5D3H A;  2YEK A;  3I3J A;  3U5P A;  3P1F A;  3Q2F A;  4FLP A;  5EM3 A;  4QUT A;  5TCM A;  2YEM A;  4J3I A;  3UW9 A;  4N4H A;  5EWV A;  4O78 A;  2OO1 A;  5F63 A;  5COI A;  5AD3 A;  4Q0N A;  5EWH A;  4YC9 A;  5DX4 A;  5CUB A;  5II1 A;  3FKM X;  4O7E A;  5HEL A;  5D26 A;  5IGL A;  5FG5 A;  5LKX A;  4YYH A;  5D0C A;  5EI4 A;  3U5K A;  4O70 A;  5F3A A;  3SVG A;  3O33 A;  5KTU A;  2DVS A;  5D3N A;  4YAT A;  5DY7 A;  3IU6 A;  4NRC A;  2R0Y A;  4NQM A;  3JVK A;  4UIW A;  5CUE A;  4BW2 A;  4YYG A;  2RS9 B;  2FSA A;  4BW3 A;  4XYA A;  5DKD A;  3LJW A;  5I40 A;  4PKL A;  4QST A;  5CRZ A;  4PCI A;  5FE7 A;  5L8T A;  5A7C A;  4A9M A;  5CS8 A;  4ALG A;  4NR9 A;  5KTX A;  5CFW A;  4LYW A;  5DBM A;  5CQ3 A;  2E3K A;  3O35 A;  5EWD A;  5AMF A;  5JI8 A;  3UVW A;  3QZV A;  5CQ8 A;  5DLZ A;  4TS8 A;  5A85 A;  2RNW A;  4MR3 A;  4O74 A;  5FG6 A;  5F2P A;  4YYJ A;  4YBS A;  3MXF A;  4NS5 A;  3O34 A;  2DVR A;  5EPS A;  5HFR A;  5C4Q A;  4MEO A;  3IU5 A;  5E9I A;  5L97 A;  4HXR A;  4O72 A;  4YH3 A;  5FE3 A;  2RI7 A;  5EIS A;  4NUC A;  3SVF A;  3MUL A;  4QY4 A;  2DAT A;  4AKN A;  5BT3 A;  3P5O A;  4OUF A;  5EA1 A;  5C89 A;  5G4S A;  5EIC A;  4UIX A;  2YW5 A;  4ZQL A;  4A9E A;  5EP7 A;  2RNY A;  4PS5 A;  5CQ6 A;  4QEV A;  3O36 A;  2L85 A;  4NRB A;  4A9N A;  3UVY A;  4YAB A;  4QSV A;  4LYS A;  5HRW A;  5IID A;  5JWM A;  5D3L A;  5CUC A;  2L5E A;  1X0J A;  5CPE A;  5KHM A;  5E9Y A;  5ENJ A;  1F68 A;  4LZ2 A;  1E6I A;  5FH8 A;  4QR3 A;  2DVQ A;  5H1V A;  4QEW A;  4IOO A;  5F60 A;  2DVV A;  4YYM A;  4NUD A;  4TTE A;  5KTW A;  3HME A;  3P1D A;  1ZS5 A;  5H1T A;  5IG6 A;  4IR4 A;  5ETD A;  5EQ1 A;  4NR6 A;  4WHU A;  4LYI A;  4E96 A;  2RO1 A;  4DON A;  5ACY A;  4KV1 A;  4QBM A;  5EPR A;  2F6N A;  3UV5 A;  4CFK A;  2OSS A;  4O7B A;  4N4F A;  4LZS A;  2NXB A;  5DYU A;  3UVX A;  4TQN A;  5CQA A;  5DYX A;  3ONI A;  4MR4 A;  5I1Q A;  5DLX A;  4YYN A;  4ALH A;  5L96 A;  4J0S A;  4LDF A;  4IOQ A;  5FE1 A;  4LZR A;  4Z6I A;  5LUU A;  5HLS A;  4NR5 A;  4O76 A;  4UIU A;  5EVA A;  4A9O A;  4YYK A;  2R10 A;  4UYF A;  4ZW1 A;  3HMH A;  4TYL A;  4NR7 A;  1JSP B;  3U5J A;  4IR3 A;  2E7N A;  3P1C A; 
#chains in the Genus database with same CATH topology
 3S92 A;  4HBY A;  1N72 A;  4XY9 A;  4GPJ A;  5D25 A;  3NXB A;  5TB6 A;  4CUP A;  5HRX A;  3TLP A;  5H1U A;  5HQ7 A;  5DW1 A;  3LQJ A;  5CRM A;  4IR6 A;  4J0R A;  4A9H A;  5LKT A;  4HBX A;  5EK9 A;  4A9I A;  3RCW A;  4MEN A;  5C85 A;  4NXJ A;  5ENH A;  5FE8 A;  5D24 A;  5HEN A;  5C87 A;  2I8N A;  4YYI A;  4HXM A;  4LR6 A;  4MR6 A;  5A5P A;  2EJN A;  5A82 A;  4HXL A;  5A5S A;  5F1L A;  4YBM A;  4MR5 A;  4HXS A;  4TT6 A;  5DFC A;  5I80 A;  3ERR A;  4OGJ A;  4BW1 A;  3JVL A;  2KTB B;  4A9J A;  4O77 A;  5HFQ A;  5EWC A;  2YYN A;  5FG4 A;  3D7C A;  4Z93 A;  4QSW A;  5LJ2 A;  1EQF A;  5FFY A;  5FB0 A;  4BW4 A;  4LRG A;  4MEQ A;  5E9K A;  4TU6 A;  5E73 A;  5I89 A;  4YH4 A;  4QC1 A;  4YAX A;  3GG3 A;  2E7O A;  3AAD A;  5A5N A;  5CTL A;  4NYW A;  3SVH A;  4YY4 A;  4YBT A;  5F62 A;  5FE4 A;  4QSP A;  4HXN A;  5E9V A;  4PCE A;  5FDZ A;  2N9G A;  4PY6 A;  5I7X A;  5AD2 A;  5E7D A;  5CQ7 A;  5EV9 A;  5F61 A;  3UV4 A;  3QZS A;  4NR8 A;  5LVR A;  3DWY A;  5C7N A;  5ENI A;  5CP5 A;  4QYL A;  5I88 A;  3ZYU A;  5F1H A;  5F25 A;  5KU3 A;  2WP1 A;  4O7C A;  3VKG A;  4CUS A;  5CUD A;  5LKZ A;  4UYE A;  4IR5 A;  5CGP A;  2R0S A;  4QB3 A;  5CQ4 A;  5HCL A;  2RNX A;  4UYG A;  5LKU A;  5D3P A;  5FH6 A;  2L84 A;  3JVM A;  5L99 A;  5A5Q A;  2D9E A;  4XY8 A;  3U5L A;  2H60 A;  4OGI A;  5ENC A;  4UIT A;  5FFW A;  5G4R A;  4A9L A;  3AQA A;  4QSQ A;  1WUM A;  3LXJ A;  4N4G A;  5CQ5 A;  5I29 A;  4Y03 A;  3UV2 A;  3JVJ A;  2RFJ A;  5E3D A;  2F6J A;  4WIV A;  4O75 A;  4UYD A;  3Q2E A;  4UYH A;  5ENB A;  5FE6 A;  5LVQ A;  4CUT A;  5H85 A;  3HMF A;  4TZ2 A;  4CUU A;  5CUA A;  5DKH A;  4Q0O A;  5J0D A;  5E9M A;  4NYX A;  5CY9 A;  3UVD A;  4XUB A;  5LJ1 A;  5AME A;  5HEM A;  3MQM A;  4HBW A;  3U5M A;  5LJ0 A;  5DFD A;  4HXK A;  4CFL A;  5CU8 A;  4NYV A;  5E3G A;  5A83 A;  5EGU A;  5DYA A;  5D3S A;  5HJC A;  3DAI A;  4QZS A;  4ZC9 A;  4UIV A;  2MJV B;  5A5R A;  5D7X A;  4X2I A;  4YAD A;  5EPB A;  5FB1 A;  4CLB A;  4XUA A;  3LQI A;  4AI6 A;  4QNS A;  4QR4 A;  5D3R A;  2LSP B;  4NR4 A;  3MB4 A;  4J1P A;  5ENF A;  5IGN A;  4Z6H A;  5FE9 A;  4QC3 A;  5ENG A;  5FFV A;  4WHW A;  4BJX A;  5KO4 A;  3S91 A;  4MEP A;  4KV4 A;  2YQD A;  4CL9 A;  4N4I A;  4Z1S A;  2I7K A;  5HM0 A;  4F3I A;  5E0R A;  5IGK A;  5FBX A;  4A9K A;  4UIZ A;  4TT2 A;  5EWW A;  2YEL A;  4LC2 A;  2D82 A;  4CUR A;  5FE2 A;  5ENE A;  5A81 A;  5ETB A;  4YYD A;  4O7F A;  3MUK A;  2DWW A;  2R0V A;  2YDW A;  4UIY A;  5D3J A;  4UYF B;  4QSR A;  5HQ5 A;  5BT5 A;  4QSX A;  3P1E A;  4TZ8 A;  5FE0 A;  5DKC A;  4TT4 A;  4QR5 A;  5BT4 A;  3G0L A;  5CZG A;  5I86 A;  5CUG A;  5F5Z A;  4HXP A;  4NQN A;  5DYC A;  5EU1 A;  4HBV A;  1ZKR A;  3D1D A;  4A9F A;  4RVR A;  4QEU A;  5FE5 A;  4C67 A;  4N3W A;  3MB3 A;  2WP2 A;  3LQH A;  5L98 A;  5DW2 A;  4KCX A;  5L8U A;  5F36 A;  5HQ6 A;  4O71 A;  5I7Y A;  4QSU A;  3O37 A;  4CUQ A;  1WUG A;  5D3T A;  5A5O A;  4NUE A;  5IBN A;  4QUU A;  4YY6 A;  4C66 A;  4Z1Q A;  4PTB A;  2G4A A;  4HXO A;  5HRV A;  4YK0 A;  5DFB A;  5I83 A;  2GRC A;  4TU4 A;  5IGM A;  5C8G A;  3G0J A;  1JM4 B;  2OUO A;  4O7A A;  3QZT A;  3U5O A;  5FH7 A;  5E74 A;  3K2J A;  5CQT A;  5E9L A;  3U5N A;  4NRA A;  4QYD A;  5K29 A;  5II2 A;  2DKW A;  4QSS A;  4BHW A;  4IOR A;  4AKG A;  5D3H A;  2YEK A;  3I3J A;  3U5P A;  3P1F A;  3Q2F A;  4FLP A;  5EM3 A;  4QUT A;  5TCM A;  2YEM A;  4J3I A;  3UW9 A;  3VKH A;  4N4H A;  5EWV A;  4O78 A;  2OO1 A;  5F63 A;  5COI A;  5AD3 A;  4Q0N A;  5EWH A;  4YC9 A;  5DX4 A;  5CUB A;  5II1 A;  3FKM X;  4O7E A;  5HEL A;  5D26 A;  5IGL A;  5FG5 A;  5LKX A;  4YYH A;  5D0C A;  1PUO A;  5EI4 A;  3U5K A;  4O70 A;  5F3A A;  3SVG A;  3O33 A;  5KTU A;  2DVS A;  5D3N A;  4YAT A;  5DY7 A;  3IU6 A;  4NRC A;  2R0Y A;  4NQM A;  3JVK A;  4UIW A;  5CUE A;  4BW2 A;  4YYG A;  2RS9 B;  2FSA A;  4BW3 A;  4XYA A;  5DKD A;  3LJW A;  5I40 A;  4PKL A;  4QST A;  5CRZ A;  4PCI A;  5FE7 A;  5L8T A;  5A7C A;  4A9M A;  5CS8 A;  4ALG A;  4NR9 A;  5KTX A;  5CFW A;  4LYW A;  5DBM A;  5CQ3 A;  2E3K A;  4AKI A;  3O35 A;  5EWD A;  5AMF A;  5JI8 A;  3UVW A;  3QZV A;  5CQ8 A;  5DLZ A;  4TS8 A;  5A85 A;  2RNW A;  4MR3 A;  4O74 A;  5FG6 A;  5F2P A;  4YYJ A;  4YBS A;  3MXF A;  4NS5 A;  3O34 A;  2DVR A;  5EPS A;  5HFR A;  5C4Q A;  4MEO A;  3IU5 A;  5E9I A;  5L97 A;  4HXR A;  4O72 A;  4YH3 A;  5FE3 A;  2RI7 A;  5EIS A;  4NUC A;  3SVF A;  3MUL A;  4QY4 A;  2DAT A;  4AKN A;  5BT3 A;  3P5O A;  4OUF A;  5EA1 A;  5C89 A;  5G4S A;  5EIC A;  4UIX A;  2YW5 A;  4ZQL A;  4A9E A;  5EP7 A;  2RNY A;  4PS5 A;  5CQ6 A;  4QEV A;  3O36 A;  2L85 A;  4NRB A;  4A9N A;  3UVY A;  4YAB A;  4QSV A;  4LYS A;  5HRW A;  5IID A;  5JWM A;  5D3L A;  5CUC A;  2L5E A;  1X0J A;  5CPE A;  5KHM A;  5E9Y A;  5ENJ A;  1F68 A;  4LZ2 A;  1E6I A;  5FH8 A;  4QR3 A;  2DVQ A;  5H1V A;  4QEW A;  4AKH A;  4IOO A;  5F60 A;  2DVV A;  4YYM A;  4NUD A;  4TTE A;  5KTW A;  3HME A;  3P1D A;  1ZS5 A;  5H1T A;  5IG6 A;  4IR4 A;  5ETD A;  5EQ1 A;  4NR6 A;  4WHU A;  3D1B A;  4LYI A;  4E96 A;  2RO1 A;  4DON A;  5ACY A;  4KV1 A;  4QBM A;  5EPR A;  2F6N A;  3UV5 A;  4CFK A;  2OSS A;  4O7B A;  4N4F A;  4LZS A;  2NXB A;  5DYU A;  3UVX A;  4TQN A;  5CQA A;  5DYX A;  3ONI A;  4MR4 A;  5I1Q A;  5DLX A;  4YYN A;  4ALH A;  5L96 A;  4J0S A;  4LDF A;  4IOQ A;  5FE1 A;  4LZR A;  4Z6I A;  5LUU A;  5HLS A;  4NR5 A;  4O76 A;  4UIU A;  5EVA A;  4A9O A;  4YYK A;  2R10 A;  4UYF A;  4ZW1 A;  3HMH A;  4TYL A;  4NR7 A;  1JSP B;  3U5J A;  4IR3 A;  2E7N A;  3P1C A; 
#chains in the Genus database with same CATH homology
 3S92 A;  4HBY A;  1N72 A;  4XY9 A;  4GPJ A;  5D25 A;  3NXB A;  5TB6 A;  4CUP A;  5HRX A;  3TLP A;  5H1U A;  5HQ7 A;  5DW1 A;  3LQJ A;  5CRM A;  4IR6 A;  4J0R A;  4A9H A;  5LKT A;  4HBX A;  5EK9 A;  4A9I A;  3RCW A;  4MEN A;  5C85 A;  4NXJ A;  5ENH A;  5FE8 A;  5D24 A;  5HEN A;  5C87 A;  2I8N A;  4YYI A;  4HXM A;  4LR6 A;  4MR6 A;  5A5P A;  5A82 A;  4HXL A;  5A5S A;  5F1L A;  4YBM A;  4MR5 A;  4HXS A;  4TT6 A;  5DFC A;  5I80 A;  4OGJ A;  4BW1 A;  3JVL A;  2KTB B;  4A9J A;  4O77 A;  5HFQ A;  5EWC A;  2YYN A;  5FG4 A;  3D7C A;  4Z93 A;  4QSW A;  5LJ2 A;  1EQF A;  5FFY A;  5FB0 A;  4BW4 A;  4LRG A;  4MEQ A;  5E9K A;  4TU6 A;  5E73 A;  5I89 A;  4YH4 A;  4QC1 A;  4YAX A;  3GG3 A;  2E7O A;  3AAD A;  5A5N A;  5CTL A;  4NYW A;  3SVH A;  4YY4 A;  4YBT A;  5F62 A;  5FE4 A;  4QSP A;  4HXN A;  5E9V A;  4PCE A;  5FDZ A;  2N9G A;  4PY6 A;  5I7X A;  5AD2 A;  5E7D A;  5CQ7 A;  5EV9 A;  5F61 A;  3UV4 A;  3QZS A;  4NR8 A;  5LVR A;  3DWY A;  5C7N A;  5ENI A;  5CP5 A;  4QYL A;  5I88 A;  3ZYU A;  5F1H A;  5F25 A;  5KU3 A;  2WP1 A;  4O7C A;  4CUS A;  5CUD A;  5LKZ A;  4UYE A;  4IR5 A;  5CGP A;  2R0S A;  4QB3 A;  5CQ4 A;  5HCL A;  2RNX A;  4UYG A;  5LKU A;  5D3P A;  5FH6 A;  2L84 A;  3JVM A;  5L99 A;  5A5Q A;  2D9E A;  4XY8 A;  3U5L A;  2H60 A;  4OGI A;  5ENC A;  4UIT A;  5FFW A;  5G4R A;  4A9L A;  3AQA A;  4QSQ A;  1WUM A;  3LXJ A;  4N4G A;  5CQ5 A;  5I29 A;  4Y03 A;  3UV2 A;  3JVJ A;  2RFJ A;  5E3D A;  2F6J A;  4WIV A;  4O75 A;  4UYD A;  3Q2E A;  4UYH A;  5ENB A;  5FE6 A;  5LVQ A;  4CUT A;  5H85 A;  3HMF A;  4TZ2 A;  4CUU A;  5CUA A;  5DKH A;  4Q0O A;  5J0D A;  5E9M A;  4NYX A;  5CY9 A;  3UVD A;  4XUB A;  5LJ1 A;  5AME A;  5HEM A;  3MQM A;  4HBW A;  3U5M A;  5LJ0 A;  5DFD A;  4HXK A;  4CFL A;  5CU8 A;  4NYV A;  5E3G A;  5A83 A;  5EGU A;  5DYA A;  5D3S A;  5HJC A;  3DAI A;  4QZS A;  4ZC9 A;  4UIV A;  2MJV B;  5A5R A;  5D7X A;  4X2I A;  4YAD A;  5EPB A;  5FB1 A;  4CLB A;  4XUA A;  3LQI A;  4QNS A;  4QR4 A;  5D3R A;  2LSP B;  4NR4 A;  3MB4 A;  4J1P A;  5ENF A;  5IGN A;  4Z6H A;  5FE9 A;  4QC3 A;  5ENG A;  5FFV A;  4WHW A;  4BJX A;  5KO4 A;  3S91 A;  4MEP A;  4KV4 A;  2YQD A;  4CL9 A;  4N4I A;  4Z1S A;  2I7K A;  5HM0 A;  4F3I A;  5E0R A;  5IGK A;  5FBX A;  4A9K A;  4UIZ A;  4TT2 A;  5EWW A;  2YEL A;  4LC2 A;  2D82 A;  4CUR A;  5FE2 A;  5ENE A;  5A81 A;  5ETB A;  4YYD A;  4O7F A;  3MUK A;  2DWW A;  2R0V A;  2YDW A;  4UIY A;  5D3J A;  4UYF B;  4QSR A;  5HQ5 A;  5BT5 A;  4QSX A;  3P1E A;  4TZ8 A;  5FE0 A;  5DKC A;  4TT4 A;  4QR5 A;  5BT4 A;  3G0L A;  5CZG A;  5I86 A;  5CUG A;  5F5Z A;  4HXP A;  4NQN A;  5DYC A;  5EU1 A;  4HBV A;  4A9F A;  4RVR A;  4QEU A;  5FE5 A;  4C67 A;  4N3W A;  3MB3 A;  2WP2 A;  3LQH A;  5L98 A;  5DW2 A;  4KCX A;  5L8U A;  5F36 A;  5HQ6 A;  4O71 A;  5I7Y A;  4QSU A;  3O37 A;  4CUQ A;  1WUG A;  5D3T A;  5A5O A;  4NUE A;  5IBN A;  4QUU A;  4YY6 A;  4C66 A;  4Z1Q A;  4PTB A;  2G4A A;  4HXO A;  5HRV A;  4YK0 A;  5DFB A;  5I83 A;  2GRC A;  4TU4 A;  5IGM A;  5C8G A;  3G0J A;  1JM4 B;  2OUO A;  4O7A A;  3QZT A;  3U5O A;  5FH7 A;  5E74 A;  3K2J A;  5CQT A;  5E9L A;  3U5N A;  4NRA A;  4QYD A;  5K29 A;  5II2 A;  2DKW A;  4QSS A;  4BHW A;  4IOR A;  5D3H A;  2YEK A;  3I3J A;  3U5P A;  3P1F A;  3Q2F A;  4FLP A;  5EM3 A;  4QUT A;  5TCM A;  2YEM A;  4J3I A;  3UW9 A;  4N4H A;  5EWV A;  4O78 A;  2OO1 A;  5F63 A;  5COI A;  5AD3 A;  4Q0N A;  5EWH A;  4YC9 A;  5DX4 A;  5CUB A;  5II1 A;  3FKM X;  4O7E A;  5HEL A;  5D26 A;  5IGL A;  5FG5 A;  5LKX A;  4YYH A;  5D0C A;  5EI4 A;  3U5K A;  4O70 A;  5F3A A;  3SVG A;  3O33 A;  5KTU A;  2DVS A;  5D3N A;  4YAT A;  5DY7 A;  3IU6 A;  4NRC A;  2R0Y A;  4NQM A;  3JVK A;  4UIW A;  5CUE A;  4BW2 A;  4YYG A;  2RS9 B;  2FSA A;  4BW3 A;  4XYA A;  5DKD A;  3LJW A;  5I40 A;  4PKL A;  4QST A;  5CRZ A;  4PCI A;  5FE7 A;  5L8T A;  5A7C A;  4A9M A;  5CS8 A;  4ALG A;  4NR9 A;  5KTX A;  5CFW A;  4LYW A;  5DBM A;  5CQ3 A;  2E3K A;  3O35 A;  5EWD A;  5AMF A;  5JI8 A;  3UVW A;  3QZV A;  5CQ8 A;  5DLZ A;  4TS8 A;  5A85 A;  2RNW A;  4MR3 A;  4O74 A;  5FG6 A;  5F2P A;  4YYJ A;  4YBS A;  3MXF A;  4NS5 A;  3O34 A;  2DVR A;  5EPS A;  5HFR A;  5C4Q A;  4MEO A;  3IU5 A;  5E9I A;  5L97 A;  4HXR A;  4O72 A;  4YH3 A;  5FE3 A;  2RI7 A;  5EIS A;  4NUC A;  3SVF A;  3MUL A;  4QY4 A;  2DAT A;  4AKN A;  5BT3 A;  3P5O A;  4OUF A;  5EA1 A;  5C89 A;  5G4S A;  5EIC A;  4UIX A;  2YW5 A;  4ZQL A;  4A9E A;  5EP7 A;  2RNY A;  4PS5 A;  5CQ6 A;  4QEV A;  3O36 A;  2L85 A;  4NRB A;  4A9N A;  3UVY A;  4YAB A;  4QSV A;  4LYS A;  5HRW A;  5IID A;  5JWM A;  5D3L A;  5CUC A;  2L5E A;  1X0J A;  5CPE A;  5KHM A;  5E9Y A;  5ENJ A;  1F68 A;  4LZ2 A;  1E6I A;  5FH8 A;  4QR3 A;  2DVQ A;  5H1V A;  4QEW A;  4IOO A;  5F60 A;  2DVV A;  4YYM A;  4NUD A;  4TTE A;  5KTW A;  3HME A;  3P1D A;  1ZS5 A;  5H1T A;  5IG6 A;  4IR4 A;  5ETD A;  5EQ1 A;  4NR6 A;  4WHU A;  4LYI A;  4E96 A;  2RO1 A;  4DON A;  5ACY A;  4KV1 A;  4QBM A;  5EPR A;  2F6N A;  3UV5 A;  4CFK A;  2OSS A;  4O7B A;  4N4F A;  4LZS A;  2NXB A;  5DYU A;  3UVX A;  4TQN A;  5CQA A;  5DYX A;  3ONI A;  4MR4 A;  5I1Q A;  5DLX A;  4YYN A;  4ALH A;  5L96 A;  4J0S A;  4LDF A;  4IOQ A;  5FE1 A;  4LZR A;  4Z6I A;  5LUU A;  5HLS A;  4NR5 A;  4O76 A;  4UIU A;  5EVA A;  4A9O A;  4YYK A;  2R10 A;  4UYF A;  4ZW1 A;  3HMH A;  4TYL A;  4NR7 A;  1JSP B;  3U5J A;  4IR3 A;  2E7N A;  3P1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...