5EA1A

Crystal structure of smarca4 bromodomain in complex with mpd
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
114
structure length
114
Chain Sequence
SPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription activator BRG1
publication title High-Throughput Fragment Docking into the BAZ2B Bromodomain: Efficient in Silico Screening for X-Ray Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 44
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature ec 3.6.4.-:
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ea1A00
4YH4A 3QZVA 5L98A 4QSWA 1N72A 4QSRA 3P1FA 5I1QA 4UYEA 5CUEA 2E7OA 5EK9A 4A9LA 5I88A 3UVYA 3UVXA 4YYIA 5A5PA 4NYWA 5L8TA 3JVMA 3UW9A 4Z1SA 3HMEA 5CQ7A 2OUOA 5HLSA 4QSTA 5EICA 5A5QA 5LUUA 5EPBA 4NR5A 2YEMA 5DKHA 4O7AA 2LSPB 5LJ1A 5EVAA 4YBSA 4MR3A 3P1DA 5KO4A 4QEVA 4Z6HA 2R0YA 4TT2A 4HXLA 5LKZA 3JVKA 5CFWA 5A5RA 3MB3A 5CRMA 5G4RA 4NXJA 4OGJA 5L96A 5DY7A 5EWVA 5F62A 5F63A 5DFDA 4IOOA 2RS9B 4PCEA 4CUPA 5D26A 5ENIA 5DLXA 5E9YA 5EA1A 3UV4A 5A5OA 4KV4A 5DKCA 4QBMA 5FH6A 3AADA 5CP5A 4O76A 3U5KA 4GPJA 3DAIA 5EV9A 5C87A 4NUCA 5ENJA 3LQHA 5HENA 3MUKA 2GRCA 4NUEA 4HXRA 5HQ7A 4PY6A 2R0SA 3O33A 4XY9A 4HBYA 5FE3A 4QZSA 5FH8A 5D3JA 1ZS5A 5C85A 5F1HA 4BHWA 4YYMA 5FB1A 3U5NA 5E9LA 3ONIA 5D3HA 2F6JA 4YYNA 3QZSA 5DYUA 4UIVA 5ETDA 3NXBA 5CUBA 3UV5A 5H1VA 3S91A 5I7XA 4MR4A 2DWWA 4QYDA 2RNYA 5CS8A 5DYXA 5HEMA 4QYLA 5EWDA 5KU3A 5II1A 5BT4A 2H60A 5FE9A 3QZTA 4NR7A 4YATA 5E9MA 4DONA 4QSVA 5A83A 2FSAA 2MJVB 3O37A 5E0RA 5CY9A 4NYXA 5CQ6A 2I8NA 5CU8A 5ACYA 5LVQA 4MEPA 5DFBA 5CUCA 5IGNA 3S92A 5COIA 3IU5A 5EWHA 5I80A 5D3TA 4QC1A 2E3KA 5HRVA 3MQMA 4PKLA 4UIXA 5A5NA 5FBXA 3Q2EA 4HXKA 3SVGA 4HXSA 5I86A 5DYCA 4PCIA 3LQJA 4TZ2A 4QEUA 4MR5A 5CQAA 4QC3A 4A9FA 4Y03A 5EM3A 4ALHA 4TS8A 4QSQA 5KHMA 5D25A 4O7FA 2L84A 4ALGA 5LJ2A 5IGLA 5F60A 4ZW1A 4YYKA 4HBXA 2I7KA 5FE5A 5A5SA 5FE7A 4N4GA 5F3AA 5FB0A 5CUDA 4A9KA 2L5EA 3MB4A 4LYSA 4NR8A 5D3NA 5FG5A 5TCMA 4LDFA 5IGMA 5CRZA 2R10A 4KCXA 3DWYA 4X2IA 4YYHA 5EQ1A 4XYAA 5H85A 2RI7A 5C4QA 5E73A 3O34A 4YH3A 5AMFA 5CQ8A 4UIYA 5FE6A 4QSXA 3U5OA 4CUTA 5L8UA 4UYFA 2YELA 2YQDA 5CTLA 4CLBA 3UVWA 4HBWA 4NR4A 5AD2A 4XY8A 4UITA 5CQTA 4HBVA 4MEOA 3AQAA 4O70A 5D3RA 4BW3A 5LJ0A 4N4HA 4LC2A 5F2PA 3K2JA 4LYIA 4HXPA 4KV1A 5F25A 2OSSA 3GG3A 4QUTA 5CZGA 3MXFA 5DW2A 5CQ4A 5F36A 5IBNA 5KTUA 4YY6A 4YK0A 5E74A 5D0CA 4CURA 5LKXA 5I29A 4MR6A 4IR5A 4NQNA 2R0VA 5C7NA 5E9IA 5K29A 5FFVA 2WP1A 4IR6A 3RCWA 4CUUA 4OUFA 3JVJA 4UYDA 4QSPA 3FKMX 4YYJA 3U5JA 4YABA 5HRXA 5ENHA 2N9GA 4MEQA 4ZC9A 5L97A 3O36A 3UV2A 4CL9A 5A81A 2DVSA 4IR3A 4FLPA 5HCLA 4J0SA 5CUAA 5BT3A 4HXMA 4IR4A 4NRAA 4XUAA 4YBTA 5FG6A 4Q0NA 2RNWA 5ENGA 5AD3A 5EI4A 4YC9A 4YY4A 4ZQLA 4LRGA 4O78A 2YEKA 5EPSA 5FFWA 3U5LA 4J3IA 2DKWA 4HXNA 4O72A 4QSUA 5II2A 5H1TA 4LZRA 4NQMA 4NRBA 2E7NA 5F61A 3SVFA 4TZ8A 5IGKA 5J0DA 5TB6A 5LKTA 3O35A 5LVRA 4UYFB 3IU6A 2OO1A 4J0RA 4LZ2A 5D3PA 5FG4A 4RVRA 4AKNA 5EWWA 1F68A 5I40A 4C67A 3LQIA 4TQNA 5FE1A 3G0JA 5I89A 5FDZA 4A9EA 5IIDA 3Q2FA 4YYGA 5E7DA 5CQ5A 5HQ5A 5C8GA 4PS5A 5DW1A 5ENBA 4A9MA 5FE2A 2RO1A 5LKUA 2YYNA 4IOQA 4YBMA 4HXOA 2YDWA 3ZYUA 5ENFA 4XUBA 4LZSA 5CGPA 3P5OA 5E9KA 4BW2A 5BT5A 5DFCA 5ENEA 5FH7A 4QR4A 4LR6A 5CPEA 3D7CA 5I83A 1JM4B 4TU6A 2RNXA 4QUUA 4A9IA 4N4FA 5KTXA 4O74A 4UYGA 5EWCA 5F5ZA 4QB3A 4O7CA 2DVRA 5ETBA 4UYHA 5HFQA 2YW5A 4QNSA 4MENA 5JI8A 5A85A 5E9VA 4OGIA 2DATA 4E96A 3I3JA 5ENCA 1E6IA 3U5MA 4QEWA 4YADA 5DLZA 5HM0A 3P1EA 5D24A 4O7EA 2G4AA 2D82A 5HELA 4N3WA 5HJCA 4CUSA 4O77A 4UIWA 5AMEA 2DVQA 5D7XA 5EGUA 4BW1A 5HQ6A 4TT6A 5A7CA 3HMHA 5DX4A 1EQFA 4J1PA 4TU4A 5FE4A 3JVLA 5I7YA 2DVVA 5JWMA 2F6NA 4CFKA 4NYVA 4NR6A 3UVDA 5C89A 4N4IA 4QY4A 4Z93A 5EU1A 4CFLA 4BW4A 4A9OA 5KTWA 4NRCA 4NUDA 4NS5A 5CQ3A 4Z6IA 2D9EA 3G0LA 4YYDA 4WHUA 1X0JA 5D3LA 5E3DA 5EP7A 2L85A 5FE0A 5FE8A 4YAXA 4O7BA 4A9JA 3MULA 4Q0OA 3LXJA 4QSSA 5DYAA 2RFJA 1WUMA 5HFRA 1WUGA 5DKDA 2WP2A 4UIZA 3U5PA 4TT4A 4PTBA 4A9HA 5E3GA 4C66A 4A9NA 5A82A 5L99A 4NR9A 2KTBB 4WHWA 4F3IA 5H1UA 5HRWA 5DBMA 5FFYA 3SVHA 4TYLA 4QR5A 4Z1QA 5IG6A 3TLPA 3P1CA 2NXBA 4WIVA 4O71A 5EISA 3HMFA 4BJXA 5G4SA 5CUGA 5D3SA 4TTEA 4LYWA 4UIUA 4O75A 4QR3A 5EPRA 5F1LA 4IORA 1JSPB 4CUQA 3LJWA
chains in the Genus database with same CATH superfamily
4YH4A 3QZVA 5L98A 4QSWA 1N72A 4QSRA 3P1FA 5I1QA 4UYEA 5CUEA 2E7OA 5EK9A 4A9LA 5I88A 3UVYA 3UVXA 4YYIA 5A5PA 4NYWA 5L8TA 3JVMA 3UW9A 4Z1SA 3HMEA 5CQ7A 2OUOA 5HLSA 4QSTA 5EICA 5A5QA 5LUUA 5EPBA 4NR5A 2YEMA 5DKHA 4O7AA 2LSPB 5LJ1A 5EVAA 4YBSA 4MR3A 3P1DA 5KO4A 4QEVA 3D1BA 4Z6HA 2R0YA 4TT2A 4HXLA 5LKZA 3JVKA 5CFWA 5A5RA 3MB3A 5CRMA 5G4RA 4AKHA 4NXJA 4OGJA 5L96A 5DY7A 5EWVA 5F62A 5F63A 5DFDA 4IOOA 2RS9B 4PCEA 4CUPA 5D26A 5ENIA 5DLXA 5E9YA 5EA1A 3UV4A 5A5OA 4KV4A 5DKCA 4QBMA 5FH6A 3AADA 5CP5A 4O76A 3U5KA 4GPJA 3DAIA 5EV9A 5C87A 4NUCA 5ENJA 4AKIA 3LQHA 5HENA 3MUKA 2GRCA 4NUEA 4HXRA 5HQ7A 4PY6A 2R0SA 3O33A 4XY9A 4HBYA 5FE3A 4QZSA 5FH8A 5D3JA 1ZS5A 5C85A 5F1HA 4BHWA 4YYMA 5FB1A 3U5NA 5E9LA 3ONIA 5D3HA 2F6JA 4YYNA 3QZSA 5DYUA 4UIVA 5ETDA 3NXBA 5CUBA 3UV5A 5H1VA 3S91A 5I7XA 4MR4A 2DWWA 4QYDA 2RNYA 5CS8A 5DYXA 5HEMA 4QYLA 5EWDA 5KU3A 5II1A 5BT4A 2H60A 5FE9A 3VKGA 3QZTA 4NR7A 4YATA 5E9MA 4DONA 4QSVA 5A83A 2FSAA 2MJVB 3O37A 5E0RA 5CY9A 4NYXA 5CQ6A 2I8NA 5CU8A 5ACYA 5LVQA 4MEPA 5DFBA 5CUCA 5IGNA 3S92A 5COIA 3IU5A 5EWHA 5I80A 5D3TA 4QC1A 2E3KA 5HRVA 3MQMA 4PKLA 4UIXA 5A5NA 5FBXA 3Q2EA 4HXKA 3SVGA 4HXSA 5I86A 5DYCA 4PCIA 3LQJA 4TZ2A 4QEUA 4MR5A 3D1DA 5CQAA 4QC3A 4A9FA 4Y03A 5EM3A 4ALHA 4TS8A 4QSQA 5KHMA 5D25A 4O7FA 2L84A 4ALGA 5LJ2A 5IGLA 5F60A 4ZW1A 4YYKA 4HBXA 2I7KA 5FE5A 5A5SA 5FE7A 4N4GA 5F3AA 5FB0A 5CUDA 4A9KA 2L5EA 3MB4A 4LYSA 4NR8A 5D3NA 5FG5A 5TCMA 4LDFA 5IGMA 5CRZA 2R10A 4KCXA 3DWYA 4X2IA 4YYHA 5EQ1A 4XYAA 5H85A 2RI7A 5C4QA 5E73A 3O34A 4YH3A 5AMFA 5CQ8A 4UIYA 5FE6A 4QSXA 3U5OA 4CUTA 5L8UA 4UYFA 2YELA 2YQDA 5CTLA 4CLBA 3UVWA 4HBWA 4NR4A 5AD2A 4XY8A 4UITA 5CQTA 4HBVA 4MEOA 3AQAA 4O70A 5D3RA 4BW3A 5LJ0A 4N4HA 4LC2A 5F2PA 3K2JA 4LYIA 4HXPA 4KV1A 5F25A 2OSSA 3GG3A 4QUTA 5CZGA 3MXFA 5DW2A 5CQ4A 5F36A 5IBNA 5KTUA 4YY6A 4YK0A 5E74A 5D0CA 4CURA 5LKXA 5I29A 4MR6A 4IR5A 4NQNA 2R0VA 5C7NA 5E9IA 5K29A 5FFVA 2WP1A 4IR6A 3RCWA 4CUUA 4OUFA 3JVJA 4UYDA 4QSPA 3FKMX 4YYJA 3U5JA 4YABA 5HRXA 5ENHA 2N9GA 4MEQA 4ZC9A 5L97A 3O36A 3UV2A 4CL9A 5A81A 2DVSA 4IR3A 4FLPA 5HCLA 4J0SA 5CUAA 5BT3A 4HXMA 4IR4A 4NRAA 4XUAA 4YBTA 5FG6A 4Q0NA 2RNWA 5ENGA 5AD3A 5EI4A 4YC9A 4YY4A 4ZQLA 4LRGA 4O78A 2YEKA 5EPSA 5FFWA 3U5LA 4J3IA 2DKWA 4HXNA 4O72A 4QSUA 5II2A 5H1TA 4LZRA 4NQMA 4NRBA 2E7NA 5F61A 3SVFA 4TZ8A 5IGKA 5J0DA 5TB6A 5LKTA 4AI6A 3O35A 5LVRA 4UYFB 3IU6A 2OO1A 4J0RA 4LZ2A 5D3PA 5FG4A 4RVRA 4AKNA 5EWWA 1F68A 5I40A 4C67A 3LQIA 4TQNA 5FE1A 3G0JA 5I89A 5FDZA 4A9EA 5IIDA 3Q2FA 4YYGA 5E7DA 5CQ5A 5HQ5A 5C8GA 4PS5A 5DW1A 5ENBA 4A9MA 5FE2A 2RO1A 5LKUA 2YYNA 2EJNA 4IOQA 4YBMA 4HXOA 2YDWA 3ZYUA 5ENFA 4XUBA 4LZSA 5CGPA 3P5OA 5E9KA 4BW2A 5BT5A 5DFCA 5ENEA 5FH7A 4QR4A 4LR6A 5CPEA 3D7CA 5I83A 1JM4B 4TU6A 2RNXA 4QUUA 4A9IA 4N4FA 5KTXA 4O74A 4UYGA 5EWCA 5F5ZA 4QB3A 4O7CA 2DVRA 5ETBA 4UYHA 5HFQA 2YW5A 4QNSA 4MENA 5JI8A 5A85A 5E9VA 4OGIA 2DATA 4E96A 3I3JA 5ENCA 1E6IA 3U5MA 4QEWA 4YADA 5DLZA 5HM0A 3P1EA 5D24A 4O7EA 2G4AA 2D82A 5HELA 4N3WA 5HJCA 4CUSA 4O77A 4UIWA 5AMEA 2DVQA 5D7XA 5EGUA 4BW1A 5HQ6A 1ZKRA 4TT6A 4AKGA 5A7CA 3HMHA 5DX4A 1EQFA 4J1PA 4TU4A 5FE4A 3JVLA 5I7YA 2DVVA 5JWMA 2F6NA 4CFKA 4NYVA 4NR6A 3UVDA 5C89A 4N4IA 4QY4A 4Z93A 5EU1A 4CFLA 4BW4A 4A9OA 5KTWA 4NRCA 4NUDA 4NS5A 5CQ3A 4Z6IA 2D9EA 3G0LA 4YYDA 4WHUA 1X0JA 5D3LA 5E3DA 5EP7A 2L85A 5FE0A 5FE8A 4YAXA 3ERRA 4O7BA 4A9JA 3MULA 4Q0OA 3LXJA 4QSSA 5DYAA 2RFJA 1WUMA 5HFRA 1WUGA 5DKDA 2WP2A 4UIZA 3U5PA 4TT4A 4PTBA 4A9HA 5E3GA 4C66A 4A9NA 5A82A 5L99A 4NR9A 2KTBB 4WHWA 4F3IA 5H1UA 5HRWA 5DBMA 5FFYA 3SVHA 4TYLA 4QR5A 4Z1QA 5IG6A 3TLPA 3P1CA 2NXBA 4WIVA 4O71A 5EISA 3HMFA 4BJXA 5G4SA 5CUGA 5D3SA 4TTEA 4LYWA 4UIUA 4O75A 1PUOA 4QR3A 5EPRA 5F1LA 4IORA 1JSPB 4CUQA 3LJWA 3VKHA
chains in the Genus database with same CATH topology
4YH4A 3QZVA 5L98A 4QSWA 1N72A 4QSRA 3P1FA 5I1QA 4UYEA 5CUEA 2E7OA 5EK9A 4A9LA 5I88A 3UVYA 3UVXA 4YYIA 5A5PA 4NYWA 5L8TA 3JVMA 3UW9A 4Z1SA 3HMEA 5CQ7A 2OUOA 5HLSA 4QSTA 5EICA 5A5QA 5LUUA 5EPBA 4NR5A 2YEMA 5DKHA 4O7AA 2LSPB 5LJ1A 5EVAA 4YBSA 4MR3A 3P1DA 5KO4A 4QEVA 4Z6HA 2R0YA 4TT2A 4HXLA 5LKZA 3JVKA 5CFWA 5A5RA 3MB3A 5CRMA 5G4RA 4NXJA 4OGJA 5L96A 5DY7A 5EWVA 5F62A 5F63A 5DFDA 4IOOA 2RS9B 4PCEA 4CUPA 5D26A 5ENIA 5DLXA 5E9YA 5EA1A 3UV4A 5A5OA 4KV4A 5DKCA 4QBMA 5FH6A 3AADA 5CP5A 4O76A 3U5KA 4GPJA 3DAIA 5EV9A 5C87A 4NUCA 5ENJA 3LQHA 5HENA 3MUKA 2GRCA 4NUEA 4HXRA 5HQ7A 4PY6A 2R0SA 3O33A 4XY9A 4HBYA 5FE3A 4QZSA 5FH8A 5D3JA 1ZS5A 5C85A 5F1HA 4BHWA 4YYMA 5FB1A 3U5NA 5E9LA 3ONIA 5D3HA 2F6JA 4YYNA 3QZSA 5DYUA 4UIVA 5ETDA 3NXBA 5CUBA 3UV5A 5H1VA 3S91A 5I7XA 4MR4A 2DWWA 4QYDA 2RNYA 5CS8A 5DYXA 5HEMA 4QYLA 5EWDA 5KU3A 5II1A 5BT4A 2H60A 5FE9A 3QZTA 4NR7A 4YATA 5E9MA 4DONA 4QSVA 5A83A 2FSAA 2MJVB 3O37A 5E0RA 5CY9A 4NYXA 5CQ6A 2I8NA 5CU8A 5ACYA 5LVQA 4MEPA 5DFBA 5CUCA 5IGNA 3S92A 5COIA 3IU5A 5EWHA 5I80A 5D3TA 4QC1A 2E3KA 5HRVA 3MQMA 4PKLA 4UIXA 5A5NA 5FBXA 3Q2EA 4HXKA 3SVGA 4HXSA 5I86A 5DYCA 4PCIA 3LQJA 4TZ2A 4QEUA 4MR5A 5CQAA 4QC3A 4A9FA 4Y03A 5EM3A 4ALHA 4TS8A 4QSQA 5KHMA 5D25A 4O7FA 2L84A 4ALGA 5LJ2A 5IGLA 5F60A 4ZW1A 4YYKA 4HBXA 2I7KA 5FE5A 5A5SA 5FE7A 4N4GA 5F3AA 5FB0A 5CUDA 4A9KA 2L5EA 3MB4A 4LYSA 4NR8A 5D3NA 5FG5A 5TCMA 4LDFA 5IGMA 5CRZA 2R10A 4KCXA 3DWYA 4X2IA 4YYHA 5EQ1A 4XYAA 5H85A 2RI7A 5C4QA 5E73A 3O34A 4YH3A 5AMFA 5CQ8A 4UIYA 5FE6A 4QSXA 3U5OA 4CUTA 5L8UA 4UYFA 2YELA 2YQDA 5CTLA 4CLBA 3UVWA 4HBWA 4NR4A 5AD2A 4XY8A 4UITA 5CQTA 4HBVA 4MEOA 3AQAA 4O70A 5D3RA 4BW3A 5LJ0A 4N4HA 4LC2A 5F2PA 3K2JA 4LYIA 4HXPA 4KV1A 5F25A 2OSSA 3GG3A 4QUTA 5CZGA 3MXFA 5DW2A 5CQ4A 5F36A 5IBNA 5KTUA 4YY6A 4YK0A 5E74A 5D0CA 4CURA 5LKXA 5I29A 4MR6A 4IR5A 4NQNA 2R0VA 5C7NA 5E9IA 5K29A 5FFVA 2WP1A 4IR6A 3RCWA 4CUUA 4OUFA 3JVJA 4UYDA 4QSPA 3FKMX 4YYJA 3U5JA 4YABA 5HRXA 5ENHA 2N9GA 4MEQA 4ZC9A 5L97A 3O36A 3UV2A 4CL9A 5A81A 2DVSA 4IR3A 4FLPA 5HCLA 4J0SA 5CUAA 5BT3A 4HXMA 4IR4A 4NRAA 4XUAA 4YBTA 5FG6A 4Q0NA 2RNWA 5ENGA 5AD3A 5EI4A 4YC9A 4YY4A 4ZQLA 4LRGA 4O78A 2YEKA 5EPSA 5FFWA 3U5LA 4J3IA 2DKWA 4HXNA 4O72A 4QSUA 5II2A 5H1TA 4LZRA 4NQMA 4NRBA 2E7NA 5F61A 3SVFA 4TZ8A 5IGKA 5J0DA 5TB6A 5LKTA 3O35A 5LVRA 4UYFB 3IU6A 2OO1A 4J0RA 4LZ2A 5D3PA 5FG4A 4RVRA 4AKNA 5EWWA 1F68A 5I40A 4C67A 3LQIA 4TQNA 5FE1A 3G0JA 5I89A 5FDZA 4A9EA 5IIDA 3Q2FA 4YYGA 5E7DA 5CQ5A 5HQ5A 5C8GA 4PS5A 5DW1A 5ENBA 4A9MA 5FE2A 2RO1A 5LKUA 2YYNA 4IOQA 4YBMA 4HXOA 2YDWA 3ZYUA 5ENFA 4XUBA 4LZSA 5CGPA 3P5OA 5E9KA 4BW2A 5BT5A 5DFCA 5ENEA 5FH7A 4QR4A 4LR6A 5CPEA 3D7CA 5I83A 1JM4B 4TU6A 2RNXA 4QUUA 4A9IA 4N4FA 5KTXA 4O74A 4UYGA 5EWCA 5F5ZA 4QB3A 4O7CA 2DVRA 5ETBA 4UYHA 5HFQA 2YW5A 4QNSA 4MENA 5JI8A 5A85A 5E9VA 4OGIA 2DATA 4E96A 3I3JA 5ENCA 1E6IA 3U5MA 4QEWA 4YADA 5DLZA 5HM0A 3P1EA 5D24A 4O7EA 2G4AA 2D82A 5HELA 4N3WA 5HJCA 4CUSA 4O77A 4UIWA 5AMEA 2DVQA 5D7XA 5EGUA 4BW1A 5HQ6A 4TT6A 5A7CA 3HMHA 5DX4A 1EQFA 4J1PA 4TU4A 5FE4A 3JVLA 5I7YA 2DVVA 5JWMA 2F6NA 4CFKA 4NYVA 4NR6A 3UVDA 5C89A 4N4IA 4QY4A 4Z93A 5EU1A 4CFLA 4BW4A 4A9OA 5KTWA 4NRCA 4NUDA 4NS5A 5CQ3A 4Z6IA 2D9EA 3G0LA 4YYDA 4WHUA 1X0JA 5D3LA 5E3DA 5EP7A 2L85A 5FE0A 5FE8A 4YAXA 4O7BA 4A9JA 3MULA 4Q0OA 3LXJA 4QSSA 5DYAA 2RFJA 1WUMA 5HFRA 1WUGA 5DKDA 2WP2A 4UIZA 3U5PA 4TT4A 4PTBA 4A9HA 5E3GA 4C66A 4A9NA 5A82A 5L99A 4NR9A 2KTBB 4WHWA 4F3IA 5H1UA 5HRWA 5DBMA 5FFYA 3SVHA 4TYLA 4QR5A 4Z1QA 5IG6A 3TLPA 3P1CA 2NXBA 4WIVA 4O71A 5EISA 3HMFA 4BJXA 5G4SA 5CUGA 5D3SA 4TTEA 4LYWA 4UIUA 4O75A 4QR3A 5EPRA 5F1LA 4IORA 1JSPB 4CUQA 3LJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YH4 A;  3QZV A;  5L98 A;  4QSW A;  1N72 A;  4QSR A;  3P1F A;  5I1Q A;  4UYE A;  5CUE A;  2E7O A;  5EK9 A;  4A9L A;  5I88 A;  3UVY A;  3UVX A;  4YYI A;  5A5P A;  4NYW A;  5L8T A;  3JVM A;  3UW9 A;  4Z1S A;  3HME A;  5CQ7 A;  2OUO A;  5HLS A;  4QST A;  5EIC A;  5A5Q A;  5LUU A;  5EPB A;  4NR5 A;  2YEM A;  5DKH A;  4O7A A;  2LSP B;  5LJ1 A;  5EVA A;  4YBS A;  4MR3 A;  3P1D A;  5KO4 A;  4QEV A;  4Z6H A;  2R0Y A;  4TT2 A;  4HXL A;  5LKZ A;  3JVK A;  5CFW A;  5A5R A;  3MB3 A;  5CRM A;  5G4R A;  4NXJ A;  4OGJ A;  5L96 A;  5DY7 A;  5EWV A;  5F62 A;  5F63 A;  5DFD A;  4IOO A;  2RS9 B;  4PCE A;  4CUP A;  5D26 A;  5ENI A;  5DLX A;  5E9Y A;  5EA1 A;  3UV4 A;  5A5O A;  4KV4 A;  5DKC A;  4QBM A;  5FH6 A;  3AAD A;  5CP5 A;  4O76 A;  3U5K A;  4GPJ A;  3DAI A;  5EV9 A;  5C87 A;  4NUC A;  5ENJ A;  3LQH A;  5HEN A;  3MUK A;  2GRC A;  4NUE A;  4HXR A;  5HQ7 A;  4PY6 A;  2R0S A;  3O33 A;  4XY9 A;  4HBY A;  5FE3 A;  4QZS A;  5FH8 A;  5D3J A;  1ZS5 A;  5C85 A;  5F1H A;  4BHW A;  4YYM A;  5FB1 A;  3U5N A;  5E9L A;  3ONI A;  5D3H A;  2F6J A;  4YYN A;  3QZS A;  5DYU A;  4UIV A;  5ETD A;  3NXB A;  5CUB A;  3UV5 A;  5H1V A;  3S91 A;  5I7X A;  4MR4 A;  2DWW A;  4QYD A;  2RNY A;  5CS8 A;  5DYX A;  5HEM A;  4QYL A;  5EWD A;  5KU3 A;  5II1 A;  5BT4 A;  2H60 A;  5FE9 A;  3QZT A;  4NR7 A;  4YAT A;  5E9M A;  4DON A;  4QSV A;  5A83 A;  2FSA A;  2MJV B;  3O37 A;  5E0R A;  5CY9 A;  4NYX A;  5CQ6 A;  2I8N A;  5CU8 A;  5ACY A;  5LVQ A;  4MEP A;  5DFB A;  5CUC A;  5IGN A;  3S92 A;  5COI A;  3IU5 A;  5EWH A;  5I80 A;  5D3T A;  4QC1 A;  2E3K A;  5HRV A;  3MQM A;  4PKL A;  4UIX A;  5A5N A;  5FBX A;  3Q2E A;  4HXK A;  3SVG A;  4HXS A;  5I86 A;  5DYC A;  4PCI A;  3LQJ A;  4TZ2 A;  4QEU A;  4MR5 A;  5CQA A;  4QC3 A;  4A9F A;  4Y03 A;  5EM3 A;  4ALH A;  4TS8 A;  4QSQ A;  5KHM A;  5D25 A;  4O7F A;  2L84 A;  4ALG A;  5LJ2 A;  5IGL A;  5F60 A;  4ZW1 A;  4YYK A;  4HBX A;  2I7K A;  5FE5 A;  5A5S A;  5FE7 A;  4N4G A;  5F3A A;  5FB0 A;  5CUD A;  4A9K A;  2L5E A;  3MB4 A;  4LYS A;  4NR8 A;  5D3N A;  5FG5 A;  5TCM A;  4LDF A;  5IGM A;  5CRZ A;  2R10 A;  4KCX A;  3DWY A;  4X2I A;  4YYH A;  5EQ1 A;  4XYA A;  5H85 A;  2RI7 A;  5C4Q A;  5E73 A;  3O34 A;  4YH3 A;  5AMF A;  5CQ8 A;  4UIY A;  5FE6 A;  4QSX A;  3U5O A;  4CUT A;  5L8U A;  4UYF A;  2YEL A;  2YQD A;  5CTL A;  4CLB A;  3UVW A;  4HBW A;  4NR4 A;  5AD2 A;  4XY8 A;  4UIT A;  5CQT A;  4HBV A;  4MEO A;  3AQA A;  4O70 A;  5D3R A;  4BW3 A;  5LJ0 A;  4N4H A;  4LC2 A;  5F2P A;  3K2J A;  4LYI A;  4HXP A;  4KV1 A;  5F25 A;  2OSS A;  3GG3 A;  4QUT A;  5CZG A;  3MXF A;  5DW2 A;  5CQ4 A;  5F36 A;  5IBN A;  5KTU A;  4YY6 A;  4YK0 A;  5E74 A;  5D0C A;  4CUR A;  5LKX A;  5I29 A;  4MR6 A;  4IR5 A;  4NQN A;  2R0V A;  5C7N A;  5E9I A;  5K29 A;  5FFV A;  2WP1 A;  4IR6 A;  3RCW A;  4CUU A;  4OUF A;  3JVJ A;  4UYD A;  4QSP A;  3FKM X;  4YYJ A;  3U5J A;  4YAB A;  5HRX A;  5ENH A;  2N9G A;  4MEQ A;  4ZC9 A;  5L97 A;  3O36 A;  3UV2 A;  4CL9 A;  5A81 A;  2DVS A;  4IR3 A;  4FLP A;  5HCL A;  4J0S A;  5CUA A;  5BT3 A;  4HXM A;  4IR4 A;  4NRA A;  4XUA A;  4YBT A;  5FG6 A;  4Q0N A;  2RNW A;  5ENG A;  5AD3 A;  5EI4 A;  4YC9 A;  4YY4 A;  4ZQL A;  4LRG A;  4O78 A;  2YEK A;  5EPS A;  5FFW A;  3U5L A;  4J3I A;  2DKW A;  4HXN A;  4O72 A;  4QSU A;  5II2 A;  5H1T A;  4LZR A;  4NQM A;  4NRB A;  2E7N A;  5F61 A;  3SVF A;  4TZ8 A;  5IGK A;  5J0D A;  5TB6 A;  5LKT A;  3O35 A;  5LVR A;  4UYF B;  3IU6 A;  2OO1 A;  4J0R A;  4LZ2 A;  5D3P A;  5FG4 A;  4RVR A;  4AKN A;  5EWW A;  1F68 A;  5I40 A;  4C67 A;  3LQI A;  4TQN A;  5FE1 A;  3G0J A;  5I89 A;  5FDZ A;  4A9E A;  5IID A;  3Q2F A;  4YYG A;  5E7D A;  5CQ5 A;  5HQ5 A;  5C8G A;  4PS5 A;  5DW1 A;  5ENB A;  4A9M A;  5FE2 A;  2RO1 A;  5LKU A;  2YYN A;  4IOQ A;  4YBM A;  4HXO A;  2YDW A;  3ZYU A;  5ENF A;  4XUB A;  4LZS A;  5CGP A;  3P5O A;  5E9K A;  4BW2 A;  5BT5 A;  5DFC A;  5ENE A;  5FH7 A;  4QR4 A;  4LR6 A;  5CPE A;  3D7C A;  5I83 A;  1JM4 B;  4TU6 A;  2RNX A;  4QUU A;  4A9I A;  4N4F A;  5KTX A;  4O74 A;  4UYG A;  5EWC A;  5F5Z A;  4QB3 A;  4O7C A;  2DVR A;  5ETB A;  4UYH A;  5HFQ A;  2YW5 A;  4QNS A;  4MEN A;  5JI8 A;  5A85 A;  5E9V A;  4OGI A;  2DAT A;  4E96 A;  3I3J A;  5ENC A;  1E6I A;  3U5M A;  4QEW A;  4YAD A;  5DLZ A;  5HM0 A;  3P1E A;  5D24 A;  4O7E A;  2G4A A;  2D82 A;  5HEL A;  4N3W A;  5HJC A;  4CUS A;  4O77 A;  4UIW A;  5AME A;  2DVQ A;  5D7X A;  5EGU A;  4BW1 A;  5HQ6 A;  4TT6 A;  5A7C A;  3HMH A;  5DX4 A;  1EQF A;  4J1P A;  4TU4 A;  5FE4 A;  3JVL A;  5I7Y A;  2DVV A;  5JWM A;  2F6N A;  4CFK A;  4NYV A;  4NR6 A;  3UVD A;  5C89 A;  4N4I A;  4QY4 A;  4Z93 A;  5EU1 A;  4CFL A;  4BW4 A;  4A9O A;  5KTW A;  4NRC A;  4NUD A;  4NS5 A;  5CQ3 A;  4Z6I A;  2D9E A;  3G0L A;  4YYD A;  4WHU A;  1X0J A;  5D3L A;  5E3D A;  5EP7 A;  2L85 A;  5FE0 A;  5FE8 A;  4YAX A;  4O7B A;  4A9J A;  3MUL A;  4Q0O A;  3LXJ A;  4QSS A;  5DYA A;  2RFJ A;  1WUM A;  5HFR A;  1WUG A;  5DKD A;  2WP2 A;  4UIZ A;  3U5P A;  4TT4 A;  4PTB A;  4A9H A;  5E3G A;  4C66 A;  4A9N A;  5A82 A;  5L99 A;  4NR9 A;  2KTB B;  4WHW A;  4F3I A;  5H1U A;  5HRW A;  5DBM A;  5FFY A;  3SVH A;  4TYL A;  4QR5 A;  4Z1Q A;  5IG6 A;  3TLP A;  3P1C A;  2NXB A;  4WIV A;  4O71 A;  5EIS A;  3HMF A;  4BJX A;  5G4S A;  5CUG A;  5D3S A;  4TTE A;  4LYW A;  4UIU A;  4O75 A;  4QR3 A;  5EPR A;  5F1L A;  4IOR A;  1JSP B;  4CUQ A;  3LJW A; 
#chains in the Genus database with same CATH topology
 4YH4 A;  3QZV A;  5L98 A;  4QSW A;  1N72 A;  4QSR A;  3P1F A;  5I1Q A;  4UYE A;  5CUE A;  2E7O A;  5EK9 A;  4A9L A;  5I88 A;  3UVY A;  3UVX A;  4YYI A;  5A5P A;  4NYW A;  5L8T A;  3JVM A;  3UW9 A;  4Z1S A;  3HME A;  5CQ7 A;  2OUO A;  5HLS A;  4QST A;  5EIC A;  5A5Q A;  5LUU A;  5EPB A;  4NR5 A;  2YEM A;  5DKH A;  4O7A A;  2LSP B;  5LJ1 A;  5EVA A;  4YBS A;  4MR3 A;  3P1D A;  5KO4 A;  4QEV A;  3D1B A;  4Z6H A;  2R0Y A;  4TT2 A;  4HXL A;  5LKZ A;  3JVK A;  5CFW A;  5A5R A;  3MB3 A;  5CRM A;  5G4R A;  4AKH A;  4NXJ A;  4OGJ A;  5L96 A;  5DY7 A;  5EWV A;  5F62 A;  5F63 A;  5DFD A;  4IOO A;  2RS9 B;  4PCE A;  4CUP A;  5D26 A;  5ENI A;  5DLX A;  5E9Y A;  5EA1 A;  3UV4 A;  5A5O A;  4KV4 A;  5DKC A;  4QBM A;  5FH6 A;  3AAD A;  5CP5 A;  4O76 A;  3U5K A;  4GPJ A;  3DAI A;  5EV9 A;  5C87 A;  4NUC A;  5ENJ A;  4AKI A;  3LQH A;  5HEN A;  3MUK A;  2GRC A;  4NUE A;  4HXR A;  5HQ7 A;  4PY6 A;  2R0S A;  3O33 A;  4XY9 A;  4HBY A;  5FE3 A;  4QZS A;  5FH8 A;  5D3J A;  1ZS5 A;  5C85 A;  5F1H A;  4BHW A;  4YYM A;  5FB1 A;  3U5N A;  5E9L A;  3ONI A;  5D3H A;  2F6J A;  4YYN A;  3QZS A;  5DYU A;  4UIV A;  5ETD A;  3NXB A;  5CUB A;  3UV5 A;  5H1V A;  3S91 A;  5I7X A;  4MR4 A;  2DWW A;  4QYD A;  2RNY A;  5CS8 A;  5DYX A;  5HEM A;  4QYL A;  5EWD A;  5KU3 A;  5II1 A;  5BT4 A;  2H60 A;  5FE9 A;  3VKG A;  3QZT A;  4NR7 A;  4YAT A;  5E9M A;  4DON A;  4QSV A;  5A83 A;  2FSA A;  2MJV B;  3O37 A;  5E0R A;  5CY9 A;  4NYX A;  5CQ6 A;  2I8N A;  5CU8 A;  5ACY A;  5LVQ A;  4MEP A;  5DFB A;  5CUC A;  5IGN A;  3S92 A;  5COI A;  3IU5 A;  5EWH A;  5I80 A;  5D3T A;  4QC1 A;  2E3K A;  5HRV A;  3MQM A;  4PKL A;  4UIX A;  5A5N A;  5FBX A;  3Q2E A;  4HXK A;  3SVG A;  4HXS A;  5I86 A;  5DYC A;  4PCI A;  3LQJ A;  4TZ2 A;  4QEU A;  4MR5 A;  3D1D A;  5CQA A;  4QC3 A;  4A9F A;  4Y03 A;  5EM3 A;  4ALH A;  4TS8 A;  4QSQ A;  5KHM A;  5D25 A;  4O7F A;  2L84 A;  4ALG A;  5LJ2 A;  5IGL A;  5F60 A;  4ZW1 A;  4YYK A;  4HBX A;  2I7K A;  5FE5 A;  5A5S A;  5FE7 A;  4N4G A;  5F3A A;  5FB0 A;  5CUD A;  4A9K A;  2L5E A;  3MB4 A;  4LYS A;  4NR8 A;  5D3N A;  5FG5 A;  5TCM A;  4LDF A;  5IGM A;  5CRZ A;  2R10 A;  4KCX A;  3DWY A;  4X2I A;  4YYH A;  5EQ1 A;  4XYA A;  5H85 A;  2RI7 A;  5C4Q A;  5E73 A;  3O34 A;  4YH3 A;  5AMF A;  5CQ8 A;  4UIY A;  5FE6 A;  4QSX A;  3U5O A;  4CUT A;  5L8U A;  4UYF A;  2YEL A;  2YQD A;  5CTL A;  4CLB A;  3UVW A;  4HBW A;  4NR4 A;  5AD2 A;  4XY8 A;  4UIT A;  5CQT A;  4HBV A;  4MEO A;  3AQA A;  4O70 A;  5D3R A;  4BW3 A;  5LJ0 A;  4N4H A;  4LC2 A;  5F2P A;  3K2J A;  4LYI A;  4HXP A;  4KV1 A;  5F25 A;  2OSS A;  3GG3 A;  4QUT A;  5CZG A;  3MXF A;  5DW2 A;  5CQ4 A;  5F36 A;  5IBN A;  5KTU A;  4YY6 A;  4YK0 A;  5E74 A;  5D0C A;  4CUR A;  5LKX A;  5I29 A;  4MR6 A;  4IR5 A;  4NQN A;  2R0V A;  5C7N A;  5E9I A;  5K29 A;  5FFV A;  2WP1 A;  4IR6 A;  3RCW A;  4CUU A;  4OUF A;  3JVJ A;  4UYD A;  4QSP A;  3FKM X;  4YYJ A;  3U5J A;  4YAB A;  5HRX A;  5ENH A;  2N9G A;  4MEQ A;  4ZC9 A;  5L97 A;  3O36 A;  3UV2 A;  4CL9 A;  5A81 A;  2DVS A;  4IR3 A;  4FLP A;  5HCL A;  4J0S A;  5CUA A;  5BT3 A;  4HXM A;  4IR4 A;  4NRA A;  4XUA A;  4YBT A;  5FG6 A;  4Q0N A;  2RNW A;  5ENG A;  5AD3 A;  5EI4 A;  4YC9 A;  4YY4 A;  4ZQL A;  4LRG A;  4O78 A;  2YEK A;  5EPS A;  5FFW A;  3U5L A;  4J3I A;  2DKW A;  4HXN A;  4O72 A;  4QSU A;  5II2 A;  5H1T A;  4LZR A;  4NQM A;  4NRB A;  2E7N A;  5F61 A;  3SVF A;  4TZ8 A;  5IGK A;  5J0D A;  5TB6 A;  5LKT A;  4AI6 A;  3O35 A;  5LVR A;  4UYF B;  3IU6 A;  2OO1 A;  4J0R A;  4LZ2 A;  5D3P A;  5FG4 A;  4RVR A;  4AKN A;  5EWW A;  1F68 A;  5I40 A;  4C67 A;  3LQI A;  4TQN A;  5FE1 A;  3G0J A;  5I89 A;  5FDZ A;  4A9E A;  5IID A;  3Q2F A;  4YYG A;  5E7D A;  5CQ5 A;  5HQ5 A;  5C8G A;  4PS5 A;  5DW1 A;  5ENB A;  4A9M A;  5FE2 A;  2RO1 A;  5LKU A;  2YYN A;  2EJN A;  4IOQ A;  4YBM A;  4HXO A;  2YDW A;  3ZYU A;  5ENF A;  4XUB A;  4LZS A;  5CGP A;  3P5O A;  5E9K A;  4BW2 A;  5BT5 A;  5DFC A;  5ENE A;  5FH7 A;  4QR4 A;  4LR6 A;  5CPE A;  3D7C A;  5I83 A;  1JM4 B;  4TU6 A;  2RNX A;  4QUU A;  4A9I A;  4N4F A;  5KTX A;  4O74 A;  4UYG A;  5EWC A;  5F5Z A;  4QB3 A;  4O7C A;  2DVR A;  5ETB A;  4UYH A;  5HFQ A;  2YW5 A;  4QNS A;  4MEN A;  5JI8 A;  5A85 A;  5E9V A;  4OGI A;  2DAT A;  4E96 A;  3I3J A;  5ENC A;  1E6I A;  3U5M A;  4QEW A;  4YAD A;  5DLZ A;  5HM0 A;  3P1E A;  5D24 A;  4O7E A;  2G4A A;  2D82 A;  5HEL A;  4N3W A;  5HJC A;  4CUS A;  4O77 A;  4UIW A;  5AME A;  2DVQ A;  5D7X A;  5EGU A;  4BW1 A;  5HQ6 A;  1ZKR A;  4TT6 A;  4AKG A;  5A7C A;  3HMH A;  5DX4 A;  1EQF A;  4J1P A;  4TU4 A;  5FE4 A;  3JVL A;  5I7Y A;  2DVV A;  5JWM A;  2F6N A;  4CFK A;  4NYV A;  4NR6 A;  3UVD A;  5C89 A;  4N4I A;  4QY4 A;  4Z93 A;  5EU1 A;  4CFL A;  4BW4 A;  4A9O A;  5KTW A;  4NRC A;  4NUD A;  4NS5 A;  5CQ3 A;  4Z6I A;  2D9E A;  3G0L A;  4YYD A;  4WHU A;  1X0J A;  5D3L A;  5E3D A;  5EP7 A;  2L85 A;  5FE0 A;  5FE8 A;  4YAX A;  3ERR A;  4O7B A;  4A9J A;  3MUL A;  4Q0O A;  3LXJ A;  4QSS A;  5DYA A;  2RFJ A;  1WUM A;  5HFR A;  1WUG A;  5DKD A;  2WP2 A;  4UIZ A;  3U5P A;  4TT4 A;  4PTB A;  4A9H A;  5E3G A;  4C66 A;  4A9N A;  5A82 A;  5L99 A;  4NR9 A;  2KTB B;  4WHW A;  4F3I A;  5H1U A;  5HRW A;  5DBM A;  5FFY A;  3SVH A;  4TYL A;  4QR5 A;  4Z1Q A;  5IG6 A;  3TLP A;  3P1C A;  2NXB A;  4WIV A;  4O71 A;  5EIS A;  3HMF A;  4BJX A;  5G4S A;  5CUG A;  5D3S A;  4TTE A;  4LYW A;  4UIU A;  4O75 A;  1PUO A;  4QR3 A;  5EPR A;  5F1L A;  4IOR A;  1JSP B;  4CUQ A;  3LJW A;  3VKH A; 
#chains in the Genus database with same CATH homology
 4YH4 A;  3QZV A;  5L98 A;  4QSW A;  1N72 A;  4QSR A;  3P1F A;  5I1Q A;  4UYE A;  5CUE A;  2E7O A;  5EK9 A;  4A9L A;  5I88 A;  3UVY A;  3UVX A;  4YYI A;  5A5P A;  4NYW A;  5L8T A;  3JVM A;  3UW9 A;  4Z1S A;  3HME A;  5CQ7 A;  2OUO A;  5HLS A;  4QST A;  5EIC A;  5A5Q A;  5LUU A;  5EPB A;  4NR5 A;  2YEM A;  5DKH A;  4O7A A;  2LSP B;  5LJ1 A;  5EVA A;  4YBS A;  4MR3 A;  3P1D A;  5KO4 A;  4QEV A;  4Z6H A;  2R0Y A;  4TT2 A;  4HXL A;  5LKZ A;  3JVK A;  5CFW A;  5A5R A;  3MB3 A;  5CRM A;  5G4R A;  4NXJ A;  4OGJ A;  5L96 A;  5DY7 A;  5EWV A;  5F62 A;  5F63 A;  5DFD A;  4IOO A;  2RS9 B;  4PCE A;  4CUP A;  5D26 A;  5ENI A;  5DLX A;  5E9Y A;  5EA1 A;  3UV4 A;  5A5O A;  4KV4 A;  5DKC A;  4QBM A;  5FH6 A;  3AAD A;  5CP5 A;  4O76 A;  3U5K A;  4GPJ A;  3DAI A;  5EV9 A;  5C87 A;  4NUC A;  5ENJ A;  3LQH A;  5HEN A;  3MUK A;  2GRC A;  4NUE A;  4HXR A;  5HQ7 A;  4PY6 A;  2R0S A;  3O33 A;  4XY9 A;  4HBY A;  5FE3 A;  4QZS A;  5FH8 A;  5D3J A;  1ZS5 A;  5C85 A;  5F1H A;  4BHW A;  4YYM A;  5FB1 A;  3U5N A;  5E9L A;  3ONI A;  5D3H A;  2F6J A;  4YYN A;  3QZS A;  5DYU A;  4UIV A;  5ETD A;  3NXB A;  5CUB A;  3UV5 A;  5H1V A;  3S91 A;  5I7X A;  4MR4 A;  2DWW A;  4QYD A;  2RNY A;  5CS8 A;  5DYX A;  5HEM A;  4QYL A;  5EWD A;  5KU3 A;  5II1 A;  5BT4 A;  2H60 A;  5FE9 A;  3QZT A;  4NR7 A;  4YAT A;  5E9M A;  4DON A;  4QSV A;  5A83 A;  2FSA A;  2MJV B;  3O37 A;  5E0R A;  5CY9 A;  4NYX A;  5CQ6 A;  2I8N A;  5CU8 A;  5ACY A;  5LVQ A;  4MEP A;  5DFB A;  5CUC A;  5IGN A;  3S92 A;  5COI A;  3IU5 A;  5EWH A;  5I80 A;  5D3T A;  4QC1 A;  2E3K A;  5HRV A;  3MQM A;  4PKL A;  4UIX A;  5A5N A;  5FBX A;  3Q2E A;  4HXK A;  3SVG A;  4HXS A;  5I86 A;  5DYC A;  4PCI A;  3LQJ A;  4TZ2 A;  4QEU A;  4MR5 A;  5CQA A;  4QC3 A;  4A9F A;  4Y03 A;  5EM3 A;  4ALH A;  4TS8 A;  4QSQ A;  5KHM A;  5D25 A;  4O7F A;  2L84 A;  4ALG A;  5LJ2 A;  5IGL A;  5F60 A;  4ZW1 A;  4YYK A;  4HBX A;  2I7K A;  5FE5 A;  5A5S A;  5FE7 A;  4N4G A;  5F3A A;  5FB0 A;  5CUD A;  4A9K A;  2L5E A;  3MB4 A;  4LYS A;  4NR8 A;  5D3N A;  5FG5 A;  5TCM A;  4LDF A;  5IGM A;  5CRZ A;  2R10 A;  4KCX A;  3DWY A;  4X2I A;  4YYH A;  5EQ1 A;  4XYA A;  5H85 A;  2RI7 A;  5C4Q A;  5E73 A;  3O34 A;  4YH3 A;  5AMF A;  5CQ8 A;  4UIY A;  5FE6 A;  4QSX A;  3U5O A;  4CUT A;  5L8U A;  4UYF A;  2YEL A;  2YQD A;  5CTL A;  4CLB A;  3UVW A;  4HBW A;  4NR4 A;  5AD2 A;  4XY8 A;  4UIT A;  5CQT A;  4HBV A;  4MEO A;  3AQA A;  4O70 A;  5D3R A;  4BW3 A;  5LJ0 A;  4N4H A;  4LC2 A;  5F2P A;  3K2J A;  4LYI A;  4HXP A;  4KV1 A;  5F25 A;  2OSS A;  3GG3 A;  4QUT A;  5CZG A;  3MXF A;  5DW2 A;  5CQ4 A;  5F36 A;  5IBN A;  5KTU A;  4YY6 A;  4YK0 A;  5E74 A;  5D0C A;  4CUR A;  5LKX A;  5I29 A;  4MR6 A;  4IR5 A;  4NQN A;  2R0V A;  5C7N A;  5E9I A;  5K29 A;  5FFV A;  2WP1 A;  4IR6 A;  3RCW A;  4CUU A;  4OUF A;  3JVJ A;  4UYD A;  4QSP A;  3FKM X;  4YYJ A;  3U5J A;  4YAB A;  5HRX A;  5ENH A;  2N9G A;  4MEQ A;  4ZC9 A;  5L97 A;  3O36 A;  3UV2 A;  4CL9 A;  5A81 A;  2DVS A;  4IR3 A;  4FLP A;  5HCL A;  4J0S A;  5CUA A;  5BT3 A;  4HXM A;  4IR4 A;  4NRA A;  4XUA A;  4YBT A;  5FG6 A;  4Q0N A;  2RNW A;  5ENG A;  5AD3 A;  5EI4 A;  4YC9 A;  4YY4 A;  4ZQL A;  4LRG A;  4O78 A;  2YEK A;  5EPS A;  5FFW A;  3U5L A;  4J3I A;  2DKW A;  4HXN A;  4O72 A;  4QSU A;  5II2 A;  5H1T A;  4LZR A;  4NQM A;  4NRB A;  2E7N A;  5F61 A;  3SVF A;  4TZ8 A;  5IGK A;  5J0D A;  5TB6 A;  5LKT A;  3O35 A;  5LVR A;  4UYF B;  3IU6 A;  2OO1 A;  4J0R A;  4LZ2 A;  5D3P A;  5FG4 A;  4RVR A;  4AKN A;  5EWW A;  1F68 A;  5I40 A;  4C67 A;  3LQI A;  4TQN A;  5FE1 A;  3G0J A;  5I89 A;  5FDZ A;  4A9E A;  5IID A;  3Q2F A;  4YYG A;  5E7D A;  5CQ5 A;  5HQ5 A;  5C8G A;  4PS5 A;  5DW1 A;  5ENB A;  4A9M A;  5FE2 A;  2RO1 A;  5LKU A;  2YYN A;  4IOQ A;  4YBM A;  4HXO A;  2YDW A;  3ZYU A;  5ENF A;  4XUB A;  4LZS A;  5CGP A;  3P5O A;  5E9K A;  4BW2 A;  5BT5 A;  5DFC A;  5ENE A;  5FH7 A;  4QR4 A;  4LR6 A;  5CPE A;  3D7C A;  5I83 A;  1JM4 B;  4TU6 A;  2RNX A;  4QUU A;  4A9I A;  4N4F A;  5KTX A;  4O74 A;  4UYG A;  5EWC A;  5F5Z A;  4QB3 A;  4O7C A;  2DVR A;  5ETB A;  4UYH A;  5HFQ A;  2YW5 A;  4QNS A;  4MEN A;  5JI8 A;  5A85 A;  5E9V A;  4OGI A;  2DAT A;  4E96 A;  3I3J A;  5ENC A;  1E6I A;  3U5M A;  4QEW A;  4YAD A;  5DLZ A;  5HM0 A;  3P1E A;  5D24 A;  4O7E A;  2G4A A;  2D82 A;  5HEL A;  4N3W A;  5HJC A;  4CUS A;  4O77 A;  4UIW A;  5AME A;  2DVQ A;  5D7X A;  5EGU A;  4BW1 A;  5HQ6 A;  4TT6 A;  5A7C A;  3HMH A;  5DX4 A;  1EQF A;  4J1P A;  4TU4 A;  5FE4 A;  3JVL A;  5I7Y A;  2DVV A;  5JWM A;  2F6N A;  4CFK A;  4NYV A;  4NR6 A;  3UVD A;  5C89 A;  4N4I A;  4QY4 A;  4Z93 A;  5EU1 A;  4CFL A;  4BW4 A;  4A9O A;  5KTW A;  4NRC A;  4NUD A;  4NS5 A;  5CQ3 A;  4Z6I A;  2D9E A;  3G0L A;  4YYD A;  4WHU A;  1X0J A;  5D3L A;  5E3D A;  5EP7 A;  2L85 A;  5FE0 A;  5FE8 A;  4YAX A;  4O7B A;  4A9J A;  3MUL A;  4Q0O A;  3LXJ A;  4QSS A;  5DYA A;  2RFJ A;  1WUM A;  5HFR A;  1WUG A;  5DKD A;  2WP2 A;  4UIZ A;  3U5P A;  4TT4 A;  4PTB A;  4A9H A;  5E3G A;  4C66 A;  4A9N A;  5A82 A;  5L99 A;  4NR9 A;  2KTB B;  4WHW A;  4F3I A;  5H1U A;  5HRW A;  5DBM A;  5FFY A;  3SVH A;  4TYL A;  4QR5 A;  4Z1Q A;  5IG6 A;  3TLP A;  3P1C A;  2NXB A;  4WIV A;  4O71 A;  5EIS A;  3HMF A;  4BJX A;  5G4S A;  5CUG A;  5D3S A;  4TTE A;  4LYW A;  4UIU A;  4O75 A;  4QR3 A;  5EPR A;  5F1L A;  4IOR A;  1JSP B;  4CUQ A;  3LJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...