5EA1A

Crystal structure of smarca4 bromodomain in complex with mpd
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
114
structure length
114
Chain Sequence
SPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription activator BRG1
publication title High-Throughput Fragment Docking into the BAZ2B Bromodomain: Efficient in Silico Screening for X-Ray Crystallography.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature ec 3.6.4.-:
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ea1A00
4NYWA 4QUTA 4QSPA 5CQTA 3JVKA 3HMFA 4LZRA 4CUSA 5F62A 3UV4A 4HXSA 4LC2A 5E9MA 3DAIA 5IBNA 4PCEA 3UVYA 4TU4A 5LJ2A 5DYCA 4BJXA 4TTEA 5D3RA 4O70A 5K29A 4QR4A 4IR6A 5DYAA 4UYFA 4TYLA 4F3IA 4IR3A 5CUGA 4CL9A 3U5PA 4PCIA 5A83A 5L98A 3O34A 4QUUA 5CZGA 5FE8A 2YQDA 5FE3A 4LDFA 4NYXA 5G4SA 4WIVA 1JSPB 5H1TA 5EU1A 4QEUA 4QSQA 4QB3A 5FE4A 5I7XA 4Q0OA 2DATA 5EK9A 5LKUA 3G0JA 4O7EA 5I83A 4UYFB 5H1UA 2E3KA 5F1LA 3MUKA 4TT6A 5CQ8A 5FH7A 5EISA 5CUBA 5HM0A 5IGLA 4OGIA 5E73A 4HBYA 4TQNA 4A9OA 5EQ1A 4CFKA 3SVFA 4BW4A 4TT2A 1X0JA 4IR5A 5LKZA 5ENBA 5A81A 5E7DA 2R0YA 5D24A 5A5QA 5EICA 4N4IA 4MEQA 4DONA 4LYSA 5FFWA 5I80A 5FBXA 4O7AA 4Q0NA 5E9VA 5G4RA 4YYJA 5FE7A 5I89A 4QNSA 4XY8A 2N9GA 4Z1QA 4QSSA 3UVWA 3UW9A 3I3JA 5ENHA 3NXBA 5H85A 5EA1A 2G4AA 3U5MA 4ALHA 1WUGA 4ALGA 4CURA 5F5ZA 4A9IA 5CGPA 2L85A 4O7BA 2L5EA 4A9LA 2RNWA 4MR3A 5HCLA 5D26A 4O72A 4QSTA 3U5NA 4N4GA 5FE0A 4YK0A 2OO1A 5EWDA 5CQ3A 5ENEA 4A9KA 5A5PA 4WHWA 5EP7A 5DKHA 4ZQLA 5IGKA 5DYXA 4UIZA 4XUAA 5HRXA 4GPJA 5JI8A 3UVXA 4RVRA 5KO4A 3LQJA 4Z93A 3LQHA 5FB0A 5IG6A 4UYEA 4QR5A 5I86A 4HXRA 4N3WA 3U5LA 5HEMA 3QZVA 4KV1A 3O37A 4UITA 5C8GA 4NQMA 5FE5A 5IGNA 4Y03A 4UIYA 2F6JA 5CQ7A 3SVHA 4UIXA 1E6IA 5DX4A 4YYKA 5LVRA 5HELA 4YBSA 4PS5A 5F60A 4TZ8A 4QSXA 4BHWA 5FB1A 5EWCA 5II1A 2YEMA 5FG6A 5L8TA 2DVQA 5E9YA 5BT4A 5DFCA 3JVMA 5L8UA 5A85A 4C67A 4KV4A 2L84A 2R10A 4YAXA 4ZC9A 1F68A 5DKDA 5DFDA 5HENA 4YH3A 5LKXA 4YADA 5EPSA 4QYDA 5ETDA 4YYIA 5EM3A 5I7YA 5F25A 5I29A 4NR4A 5E9IA 5EVAA 4BW3A 3O33A 4PKLA 4A9FA 3TLPA 4MR5A 5FE2A 3ONIA 4NR7A 4MEOA 5DY7A 3P1FA 5EV9A 4HXPA 4A9JA 2E7NA 4YYNA 4PY6A 4IR4A 3G0LA 4IORA 4HXKA 2H60A 5EWWA 3P1EA 5FG4A 2NXBA 4CUUA 4MR4A 5D3SA 3UVDA 5ENCA 4YYGA 4CFLA 4YBMA 5IIDA 4NRCA 4BW1A 4C66A 2GRCA 5CTLA 5DLXA 3U5OA 4NUEA 5CUAA 4O77A 4J0SA 2F6NA 5D3JA 5F2PA 4A9MA 4QZSA 5DLZA 3P1DA 4QYLA 4A9NA 5F63A 5DKCA 5EGUA 5FH6A 5IGMA 5F36A 5CU8A 5DYUA 4YATA 5D3HA 5C4QA 3IU5A 3P5OA 4Z6HA 5C87A 4YY4A 4UYHA 5EPBA 5A5SA 5KTWA 2WP1A 5ACYA 4HBXA 4XYAA 4HXMA 5F3AA 4XUBA 5II2A 3MXFA 4HXNA 4O76A 4LZ2A 5C7NA 4UIWA 3HMHA 4QC1A 4WHUA 5TCMA 1WUMA 4TZ2A 4YY6A 5KU3A 4X2IA 4LRGA 2WP2A 4HXOA 5CFWA 4HXLA 5FDZA 4UYDA 3FKMX 4QSWA 4MR6A 3QZSA 4N4HA 5CQAA 1ZS5A 5E3GA 5CUCA 2DVRA 4PTBA 3O35A 5HFRA 2RNXA 3MB4A 5COIA 3MQMA 3P1CA 5EWHA 4NR8A 4O75A 3AQAA 4YYDA 4MENA 5HQ7A 3UV2A 3RCWA 4NUCA 5E9KA 5ETBA 2R0VA 5KTUA 5A5RA 5HJCA 5J0DA 3QZTA 3LXJA 5HLSA 4NRAA 4OGJA 4UIVA 5C85A 5E3DA 5I1QA 3IU6A 5AD2A 5D0CA 5F1HA 2I7KA 5C89A 4LYWA 4LZSA 5CS8A 5EWVA 2OSSA 2DKWA 2D9EA 2I8NA 4QC3A 4J0RA 4AKNA 4NXJA 3U5JA 5D25A 4Z1SA 5D7XA 3AADA 4MEPA 5ENJA 5LJ0A 4QY4A 4QR3A 4IOQA 4J1PA 5KHMA 4YABA 4A9EA 4KCXA 5FH8A 5D3NA 5FE1A 5LJ1A 5DFBA 2DVSA 4QSRA 4NQNA 2RS9B 5FE9A 2YYNA 5CUEA 4IOOA 4QEVA 4XY9A 5AMFA 2DWWA 4YBTA 5DW2A 5L97A 5I40A 5ENGA 4HBVA 5EPRA 5KTXA 3Q2FA 3UV5A 3K2JA 5E74A 4TT4A 4QSVA 4BW2A 2D82A 5CQ4A 3JVJA 4O7FA 5HRVA 3SVGA 1EQFA 5BT3A 5CPEA 2DVVA 2LSPB 3O36A 2E7OA 2YELA 3JVLA 4E96A 4HBWA 4NR9A 3GG3A 1N72A 4UIUA 5DBMA 5CUDA 4CLBA 5ENIA 4NS5A 5DW1A 1JM4B 4OUFA 4NRBA 5D3PA 2YW5A 5JWMA 2FSAA 5CQ5A 4YH4A 4LR6A 5LUUA 5ENFA 5CRZA 4QBMA 5AMEA 4QSUA 4NR6A 4O78A 3U5KA 3LJWA 4NYVA 2RFJA 3S91A 5CRMA 4NR5A 5F61A 4LYIA 4YYMA 2KTBB 5HRWA 5FFVA 5D3TA 4O74A 4YC9A 4O71A 2OUOA 4A9HA 5L96A 4FLPA 3Q2EA 4UYGA 4N4FA 4QEWA 5A5NA 4CUPA 2RI7A 5LVQA 4J3IA 5EI4A 3S92A 5LKTA 5E0RA 4CUQA 5HFQA 3LQIA 5A5OA 4TS8A 2R0SA 5I88A 3MULA 5A7CA 5FE6A 4O7CA 4TU6A 2RO1A 2MJVB 5CQ6A 2YDWA 5E9LA 4CUTA 5CP5A 5FFYA 3DWYA 4ZW1A 4Z6IA 5AD3A 5HQ5A 2RNYA 5HQ6A 3MB3A 2YEKA 5FG5A 3HMEA 5D3LA 5CY9A 5L99A 4NUDA 5A82A 5H1VA 3ZYUA 4YYHA 3D7CA 5BT5A 5TB6A
chains in the Genus database with same CATH superfamily
4NYWA 4QUTA 4QSPA 5CQTA 3JVKA 3HMFA 4LZRA 4CUSA 5F62A 3UV4A 4HXSA 4LC2A 5E9MA 3DAIA 5IBNA 4PCEA 3UVYA 4TU4A 5LJ2A 5DYCA 4BJXA 4TTEA 5D3RA 4O70A 5K29A 4QR4A 4IR6A 5DYAA 4UYFA 4TYLA 1PUOA 4F3IA 4IR3A 5CUGA 4CL9A 3U5PA 4PCIA 5A83A 5L98A 3O34A 4QUUA 5CZGA 5FE8A 2YQDA 5FE3A 4LDFA 4NYXA 5G4SA 4WIVA 1JSPB 5H1TA 5EU1A 4QEUA 4QSQA 4QB3A 5FE4A 5I7XA 4Q0OA 2DATA 5EK9A 5LKUA 3G0JA 4O7EA 5I83A 4UYFB 5H1UA 2E3KA 5F1LA 3MUKA 4TT6A 5CQ8A 5FH7A 5EISA 5CUBA 5HM0A 5IGLA 4OGIA 5E73A 4HBYA 4TQNA 4A9OA 4AI6A 5EQ1A 4CFKA 3SVFA 4BW4A 4TT2A 1X0JA 4IR5A 5LKZA 5ENBA 5A81A 5E7DA 2R0YA 5D24A 5A5QA 5EICA 4N4IA 4MEQA 4DONA 4LYSA 5FFWA 5I80A 5FBXA 4O7AA 4Q0NA 5E9VA 5G4RA 4YYJA 5FE7A 5I89A 4QNSA 4XY8A 2N9GA 4Z1QA 4QSSA 3UVWA 3UW9A 3I3JA 5ENHA 3NXBA 5H85A 5EA1A 2G4AA 3U5MA 4ALHA 1WUGA 4ALGA 4CURA 5F5ZA 4A9IA 5CGPA 2L85A 4O7BA 2L5EA 4A9LA 2RNWA 4MR3A 5HCLA 5D26A 4O72A 4AKIA 4QSTA 3U5NA 4N4GA 5FE0A 4YK0A 2OO1A 5EWDA 5CQ3A 5ENEA 4A9KA 5A5PA 4WHWA 3D1BA 5DKHA 4ZQLA 5EP7A 5IGKA 5DYXA 4UIZA 4XUAA 5HRXA 4GPJA 5JI8A 3UVXA 4RVRA 5KO4A 3LQJA 4Z93A 3LQHA 5FB0A 5IG6A 4UYEA 4QR5A 5I86A 4HXRA 4N3WA 3U5LA 5HEMA 3QZVA 4KV1A 3O37A 4UITA 5C8GA 4NQMA 5FE5A 5IGNA 4Y03A 4UIYA 2F6JA 5CQ7A 3SVHA 4UIXA 1E6IA 5DX4A 4YYKA 5LVRA 5HELA 4YBSA 4PS5A 5F60A 4TZ8A 4QSXA 4BHWA 5FB1A 5EWCA 5II1A 2YEMA 5FG6A 5L8TA 2DVQA 5E9YA 5BT4A 5DFCA 3JVMA 5L8UA 5A85A 4C67A 4KV4A 2L84A 2R10A 4YAXA 4ZC9A 1F68A 5DKDA 5DFDA 5HENA 4YH3A 5LKXA 4YADA 5EPSA 4QYDA 5ETDA 4YYIA 5EM3A 5I7YA 5F25A 5I29A 4NR4A 5E9IA 5EVAA 4BW3A 3O33A 4PKLA 4A9FA 3TLPA 4MR5A 5FE2A 3ONIA 4NR7A 4MEOA 5DY7A 3P1FA 5EV9A 4HXPA 4A9JA 2E7NA 4YYNA 4PY6A 4IR4A 3G0LA 4IORA 4HXKA 2H60A 5EWWA 3P1EA 5FG4A 2NXBA 4CUUA 4MR4A 5D3SA 3UVDA 5ENCA 4YYGA 4CFLA 4YBMA 5IIDA 4NRCA 4BW1A 4C66A 2GRCA 5CTLA 5DLXA 3U5OA 4NUEA 5CUAA 4O77A 4J0SA 2F6NA 5D3JA 5F2PA 4A9MA 4QZSA 5DLZA 3P1DA 3VKGA 4QYLA 4A9NA 5F63A 5DKCA 5EGUA 5FH6A 5IGMA 5F36A 5CU8A 5DYUA 4YATA 5D3HA 5C4QA 3IU5A 3P5OA 4Z6HA 5C87A 4YY4A 4UYHA 5EPBA 5A5SA 5KTWA 2WP1A 5ACYA 4HBXA 4XYAA 4HXMA 5F3AA 4XUBA 5II2A 3MXFA 4HXNA 4O76A 4LZ2A 5C7NA 4UIWA 3HMHA 4QC1A 4WHUA 5TCMA 1WUMA 4TZ2A 4YY6A 5KU3A 4X2IA 4LRGA 2WP2A 4HXOA 5CFWA 4HXLA 5FDZA 4UYDA 3FKMX 4QSWA 4MR6A 3QZSA 4N4HA 5CQAA 1ZS5A 5E3GA 5CUCA 2DVRA 3ERRA 4PTBA 3O35A 5HFRA 2RNXA 3MB4A 5COIA 3MQMA 3P1CA 5EWHA 4NR8A 4O75A 3AQAA 4YYDA 4MENA 5HQ7A 3UV2A 3RCWA 4NUCA 5E9KA 5ETBA 2R0VA 5KTUA 5A5RA 5HJCA 5J0DA 3QZTA 3LXJA 5HLSA 4NRAA 4OGJA 4UIVA 5C85A 5E3DA 5I1QA 4AKGA 3IU6A 5AD2A 5D0CA 5F1HA 2I7KA 3D1DA 5C89A 4LYWA 4LZSA 5CS8A 5EWVA 2OSSA 2DKWA 2D9EA 2I8NA 4QC3A 4J0RA 4AKNA 4NXJA 3U5JA 5D25A 4Z1SA 5D7XA 3AADA 4MEPA 5ENJA 5LJ0A 4QY4A 4QR3A 4IOQA 4J1PA 5KHMA 4YABA 4A9EA 4KCXA 5FH8A 5D3NA 5FE1A 2EJNA 5LJ1A 5DFBA 2DVSA 4QSRA 4NQNA 2RS9B 5FE9A 2YYNA 5CUEA 4IOOA 4QEVA 4XY9A 5AMFA 2DWWA 4YBTA 5DW2A 5L97A 5I40A 5ENGA 4HBVA 1ZKRA 5EPRA 3Q2FA 5KTXA 3UV5A 3K2JA 5E74A 4TT4A 4AKHA 4QSVA 4BW2A 2D82A 5CQ4A 3JVJA 4O7FA 5HRVA 3SVGA 1EQFA 5BT3A 5CPEA 2DVVA 2LSPB 3O36A 2E7OA 2YELA 3JVLA 4E96A 4HBWA 4NR9A 3GG3A 1N72A 4UIUA 5DBMA 5CUDA 4CLBA 5ENIA 4NS5A 5DW1A 1JM4B 4OUFA 4NRBA 5D3PA 2YW5A 5JWMA 2FSAA 5CQ5A 4YH4A 4LR6A 5LUUA 5ENFA 5CRZA 4QBMA 5AMEA 4QSUA 4NR6A 4O78A 3U5KA 3LJWA 4NYVA 2RFJA 3S91A 5CRMA 4NR5A 5F61A 4LYIA 4YYMA 2KTBB 5HRWA 5FFVA 5D3TA 3VKHA 4O74A 4YC9A 4O71A 2OUOA 4A9HA 5L96A 4FLPA 3Q2EA 4UYGA 4N4FA 4QEWA 5A5NA 4CUPA 2RI7A 5LVQA 4J3IA 5EI4A 3S92A 5LKTA 5E0RA 4CUQA 5HFQA 3LQIA 5A5OA 4TS8A 2R0SA 5I88A 3MULA 5A7CA 5FE6A 4O7CA 4TU6A 2RO1A 2MJVB 5CQ6A 2YDWA 5E9LA 4CUTA 5CP5A 5FFYA 3DWYA 4ZW1A 4Z6IA 5AD3A 5HQ5A 2RNYA 5HQ6A 3MB3A 2YEKA 5FG5A 3HMEA 5D3LA 5CY9A 5L99A 4NUDA 5A82A 5H1VA 3ZYUA 4YYHA 3D7CA 5BT5A 5TB6A
chains in the Genus database with same CATH topology
4NYWA 4QUTA 4QSPA 5CQTA 3JVKA 3HMFA 4LZRA 4CUSA 5F62A 3UV4A 4HXSA 4LC2A 5E9MA 3DAIA 5IBNA 4PCEA 3UVYA 4TU4A 5LJ2A 5DYCA 4BJXA 4TTEA 5D3RA 4O70A 5K29A 4QR4A 4IR6A 5DYAA 4UYFA 4TYLA 4F3IA 4IR3A 5CUGA 4CL9A 3U5PA 4PCIA 5A83A 5L98A 3O34A 4QUUA 5CZGA 5FE8A 2YQDA 5FE3A 4LDFA 4NYXA 5G4SA 4WIVA 1JSPB 5H1TA 5EU1A 4QEUA 4QSQA 4QB3A 5FE4A 5I7XA 4Q0OA 2DATA 5EK9A 5LKUA 3G0JA 4O7EA 5I83A 4UYFB 5H1UA 2E3KA 5F1LA 3MUKA 4TT6A 5CQ8A 5FH7A 5EISA 5CUBA 5HM0A 5IGLA 4OGIA 5E73A 4HBYA 4TQNA 4A9OA 5EQ1A 4CFKA 3SVFA 4BW4A 4TT2A 1X0JA 4IR5A 5LKZA 5ENBA 5A81A 5E7DA 2R0YA 5D24A 5A5QA 5EICA 4N4IA 4MEQA 4DONA 4LYSA 5FFWA 5I80A 5FBXA 4O7AA 4Q0NA 5E9VA 5G4RA 4YYJA 5FE7A 5I89A 4QNSA 4XY8A 2N9GA 4Z1QA 4QSSA 3UVWA 3UW9A 3I3JA 5ENHA 3NXBA 5H85A 5EA1A 2G4AA 3U5MA 4ALHA 1WUGA 4ALGA 4CURA 5F5ZA 4A9IA 5CGPA 2L85A 4O7BA 2L5EA 4A9LA 2RNWA 4MR3A 5HCLA 5D26A 4O72A 4QSTA 3U5NA 4N4GA 5FE0A 4YK0A 2OO1A 5EWDA 5CQ3A 5ENEA 4A9KA 5A5PA 4WHWA 5EP7A 5DKHA 4ZQLA 5IGKA 5DYXA 4UIZA 4XUAA 5HRXA 4GPJA 5JI8A 3UVXA 4RVRA 5KO4A 3LQJA 4Z93A 3LQHA 5FB0A 5IG6A 4UYEA 4QR5A 5I86A 4HXRA 4N3WA 3U5LA 5HEMA 3QZVA 4KV1A 3O37A 4UITA 5C8GA 4NQMA 5FE5A 5IGNA 4Y03A 4UIYA 2F6JA 5CQ7A 3SVHA 4UIXA 1E6IA 5DX4A 4YYKA 5LVRA 5HELA 4YBSA 4PS5A 5F60A 4TZ8A 4QSXA 4BHWA 5FB1A 5EWCA 5II1A 2YEMA 5FG6A 5L8TA 2DVQA 5E9YA 5BT4A 5DFCA 3JVMA 5L8UA 5A85A 4C67A 4KV4A 2L84A 2R10A 4YAXA 4ZC9A 1F68A 5DKDA 5DFDA 5HENA 4YH3A 5LKXA 4YADA 5EPSA 4QYDA 5ETDA 4YYIA 5EM3A 5I7YA 5F25A 5I29A 4NR4A 5E9IA 5EVAA 4BW3A 3O33A 4PKLA 4A9FA 3TLPA 4MR5A 5FE2A 3ONIA 4NR7A 4MEOA 5DY7A 3P1FA 5EV9A 4HXPA 4A9JA 2E7NA 4YYNA 4PY6A 4IR4A 3G0LA 4IORA 4HXKA 2H60A 5EWWA 3P1EA 5FG4A 2NXBA 4CUUA 4MR4A 5D3SA 3UVDA 5ENCA 4YYGA 4CFLA 4YBMA 5IIDA 4NRCA 4BW1A 4C66A 2GRCA 5CTLA 5DLXA 3U5OA 4NUEA 5CUAA 4O77A 4J0SA 2F6NA 5D3JA 5F2PA 4A9MA 4QZSA 5DLZA 3P1DA 4QYLA 4A9NA 5F63A 5DKCA 5EGUA 5FH6A 5IGMA 5F36A 5CU8A 5DYUA 4YATA 5D3HA 5C4QA 3IU5A 3P5OA 4Z6HA 5C87A 4YY4A 4UYHA 5EPBA 5A5SA 5KTWA 2WP1A 5ACYA 4HBXA 4XYAA 4HXMA 5F3AA 4XUBA 5II2A 3MXFA 4HXNA 4O76A 4LZ2A 5C7NA 4UIWA 3HMHA 4QC1A 4WHUA 5TCMA 1WUMA 4TZ2A 4YY6A 5KU3A 4X2IA 4LRGA 2WP2A 4HXOA 5CFWA 4HXLA 5FDZA 4UYDA 3FKMX 4QSWA 4MR6A 3QZSA 4N4HA 5CQAA 1ZS5A 5E3GA 5CUCA 2DVRA 4PTBA 3O35A 5HFRA 2RNXA 3MB4A 5COIA 3MQMA 3P1CA 5EWHA 4NR8A 4O75A 3AQAA 4YYDA 4MENA 5HQ7A 3UV2A 3RCWA 4NUCA 5E9KA 5ETBA 2R0VA 5KTUA 5A5RA 5HJCA 5J0DA 3QZTA 3LXJA 5HLSA 4NRAA 4OGJA 4UIVA 5C85A 5E3DA 5I1QA 3IU6A 5AD2A 5D0CA 5F1HA 2I7KA 5C89A 4LYWA 4LZSA 5CS8A 5EWVA 2OSSA 2DKWA 2D9EA 2I8NA 4QC3A 4J0RA 4AKNA 4NXJA 3U5JA 5D25A 4Z1SA 5D7XA 3AADA 4MEPA 5ENJA 5LJ0A 4QY4A 4QR3A 4IOQA 4J1PA 5KHMA 4YABA 4A9EA 4KCXA 5FH8A 5D3NA 5FE1A 5LJ1A 5DFBA 2DVSA 4QSRA 4NQNA 2RS9B 5FE9A 2YYNA 5CUEA 4IOOA 4QEVA 4XY9A 5AMFA 2DWWA 4YBTA 5DW2A 5L97A 5I40A 5ENGA 4HBVA 5EPRA 5KTXA 3Q2FA 3UV5A 3K2JA 5E74A 4TT4A 4QSVA 4BW2A 2D82A 5CQ4A 3JVJA 4O7FA 5HRVA 3SVGA 1EQFA 5BT3A 5CPEA 2DVVA 2LSPB 3O36A 2E7OA 2YELA 3JVLA 4E96A 4HBWA 4NR9A 3GG3A 1N72A 4UIUA 5DBMA 5CUDA 4CLBA 5ENIA 4NS5A 5DW1A 1JM4B 4OUFA 4NRBA 5D3PA 2YW5A 5JWMA 2FSAA 5CQ5A 4YH4A 4LR6A 5LUUA 5ENFA 5CRZA 4QBMA 5AMEA 4QSUA 4NR6A 4O78A 3U5KA 3LJWA 4NYVA 2RFJA 3S91A 5CRMA 4NR5A 5F61A 4LYIA 4YYMA 2KTBB 5HRWA 5FFVA 5D3TA 4O74A 4YC9A 4O71A 2OUOA 4A9HA 5L96A 4FLPA 3Q2EA 4UYGA 4N4FA 4QEWA 5A5NA 4CUPA 2RI7A 5LVQA 4J3IA 5EI4A 3S92A 5LKTA 5E0RA 4CUQA 5HFQA 3LQIA 5A5OA 4TS8A 2R0SA 5I88A 3MULA 5A7CA 5FE6A 4O7CA 4TU6A 2RO1A 2MJVB 5CQ6A 2YDWA 5E9LA 4CUTA 5CP5A 5FFYA 3DWYA 4ZW1A 4Z6IA 5AD3A 5HQ5A 2RNYA 5HQ6A 3MB3A 2YEKA 5FG5A 3HMEA 5D3LA 5CY9A 5L99A 4NUDA 5A82A 5H1VA 3ZYUA 4YYHA 3D7CA 5BT5A 5TB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NYW A;  4QUT A;  4QSP A;  5CQT A;  3JVK A;  3HMF A;  4LZR A;  4CUS A;  5F62 A;  3UV4 A;  4HXS A;  4LC2 A;  5E9M A;  3DAI A;  5IBN A;  4PCE A;  3UVY A;  4TU4 A;  5LJ2 A;  5DYC A;  4BJX A;  4TTE A;  5D3R A;  4O70 A;  5K29 A;  4QR4 A;  4IR6 A;  5DYA A;  4UYF A;  4TYL A;  4F3I A;  4IR3 A;  5CUG A;  4CL9 A;  3U5P A;  4PCI A;  5A83 A;  5L98 A;  3O34 A;  4QUU A;  5CZG A;  5FE8 A;  2YQD A;  5FE3 A;  4LDF A;  4NYX A;  5G4S A;  4WIV A;  1JSP B;  5H1T A;  5EU1 A;  4QEU A;  4QSQ A;  4QB3 A;  5FE4 A;  5I7X A;  4Q0O A;  2DAT A;  5EK9 A;  5LKU A;  3G0J A;  4O7E A;  5I83 A;  4UYF B;  5H1U A;  2E3K A;  5F1L A;  3MUK A;  4TT6 A;  5CQ8 A;  5FH7 A;  5EIS A;  5CUB A;  5HM0 A;  5IGL A;  4OGI A;  5E73 A;  4HBY A;  4TQN A;  4A9O A;  5EQ1 A;  4CFK A;  3SVF A;  4BW4 A;  4TT2 A;  1X0J A;  4IR5 A;  5LKZ A;  5ENB A;  5A81 A;  5E7D A;  2R0Y A;  5D24 A;  5A5Q A;  5EIC A;  4N4I A;  4MEQ A;  4DON A;  4LYS A;  5FFW A;  5I80 A;  5FBX A;  4O7A A;  4Q0N A;  5E9V A;  5G4R A;  4YYJ A;  5FE7 A;  5I89 A;  4QNS A;  4XY8 A;  2N9G A;  4Z1Q A;  4QSS A;  3UVW A;  3UW9 A;  3I3J A;  5ENH A;  3NXB A;  5H85 A;  5EA1 A;  2G4A A;  3U5M A;  4ALH A;  1WUG A;  4ALG A;  4CUR A;  5F5Z A;  4A9I A;  5CGP A;  2L85 A;  4O7B A;  2L5E A;  4A9L A;  2RNW A;  4MR3 A;  5HCL A;  5D26 A;  4O72 A;  4QST A;  3U5N A;  4N4G A;  5FE0 A;  4YK0 A;  2OO1 A;  5EWD A;  5CQ3 A;  5ENE A;  4A9K A;  5A5P A;  4WHW A;  5EP7 A;  5DKH A;  4ZQL A;  5IGK A;  5DYX A;  4UIZ A;  4XUA A;  5HRX A;  4GPJ A;  5JI8 A;  3UVX A;  4RVR A;  5KO4 A;  3LQJ A;  4Z93 A;  3LQH A;  5FB0 A;  5IG6 A;  4UYE A;  4QR5 A;  5I86 A;  4HXR A;  4N3W A;  3U5L A;  5HEM A;  3QZV A;  4KV1 A;  3O37 A;  4UIT A;  5C8G A;  4NQM A;  5FE5 A;  5IGN A;  4Y03 A;  4UIY A;  2F6J A;  5CQ7 A;  3SVH A;  4UIX A;  1E6I A;  5DX4 A;  4YYK A;  5LVR A;  5HEL A;  4YBS A;  4PS5 A;  5F60 A;  4TZ8 A;  4QSX A;  4BHW A;  5FB1 A;  5EWC A;  5II1 A;  2YEM A;  5FG6 A;  5L8T A;  2DVQ A;  5E9Y A;  5BT4 A;  5DFC A;  3JVM A;  5L8U A;  5A85 A;  4C67 A;  4KV4 A;  2L84 A;  2R10 A;  4YAX A;  4ZC9 A;  1F68 A;  5DKD A;  5DFD A;  5HEN A;  4YH3 A;  5LKX A;  4YAD A;  5EPS A;  4QYD A;  5ETD A;  4YYI A;  5EM3 A;  5I7Y A;  5F25 A;  5I29 A;  4NR4 A;  5E9I A;  5EVA A;  4BW3 A;  3O33 A;  4PKL A;  4A9F A;  3TLP A;  4MR5 A;  5FE2 A;  3ONI A;  4NR7 A;  4MEO A;  5DY7 A;  3P1F A;  5EV9 A;  4HXP A;  4A9J A;  2E7N A;  4YYN A;  4PY6 A;  4IR4 A;  3G0L A;  4IOR A;  4HXK A;  2H60 A;  5EWW A;  3P1E A;  5FG4 A;  2NXB A;  4CUU A;  4MR4 A;  5D3S A;  3UVD A;  5ENC A;  4YYG A;  4CFL A;  4YBM A;  5IID A;  4NRC A;  4BW1 A;  4C66 A;  2GRC A;  5CTL A;  5DLX A;  3U5O A;  4NUE A;  5CUA A;  4O77 A;  4J0S A;  2F6N A;  5D3J A;  5F2P A;  4A9M A;  4QZS A;  5DLZ A;  3P1D A;  4QYL A;  4A9N A;  5F63 A;  5DKC A;  5EGU A;  5FH6 A;  5IGM A;  5F36 A;  5CU8 A;  5DYU A;  4YAT A;  5D3H A;  5C4Q A;  3IU5 A;  3P5O A;  4Z6H A;  5C87 A;  4YY4 A;  4UYH A;  5EPB A;  5A5S A;  5KTW A;  2WP1 A;  5ACY A;  4HBX A;  4XYA A;  4HXM A;  5F3A A;  4XUB A;  5II2 A;  3MXF A;  4HXN A;  4O76 A;  4LZ2 A;  5C7N A;  4UIW A;  3HMH A;  4QC1 A;  4WHU A;  5TCM A;  1WUM A;  4TZ2 A;  4YY6 A;  5KU3 A;  4X2I A;  4LRG A;  2WP2 A;  4HXO A;  5CFW A;  4HXL A;  5FDZ A;  4UYD A;  3FKM X;  4QSW A;  4MR6 A;  3QZS A;  4N4H A;  5CQA A;  1ZS5 A;  5E3G A;  5CUC A;  2DVR A;  4PTB A;  3O35 A;  5HFR A;  2RNX A;  3MB4 A;  5COI A;  3MQM A;  3P1C A;  5EWH A;  4NR8 A;  4O75 A;  3AQA A;  4YYD A;  4MEN A;  5HQ7 A;  3UV2 A;  3RCW A;  4NUC A;  5E9K A;  5ETB A;  2R0V A;  5KTU A;  5A5R A;  5HJC A;  5J0D A;  3QZT A;  3LXJ A;  5HLS A;  4NRA A;  4OGJ A;  4UIV A;  5C85 A;  5E3D A;  5I1Q A;  3IU6 A;  5AD2 A;  5D0C A;  5F1H A;  2I7K A;  5C89 A;  4LYW A;  4LZS A;  5CS8 A;  5EWV A;  2OSS A;  2DKW A;  2D9E A;  2I8N A;  4QC3 A;  4J0R A;  4AKN A;  4NXJ A;  3U5J A;  5D25 A;  4Z1S A;  5D7X A;  3AAD A;  4MEP A;  5ENJ A;  5LJ0 A;  4QY4 A;  4QR3 A;  4IOQ A;  4J1P A;  5KHM A;  4YAB A;  4A9E A;  4KCX A;  5FH8 A;  5D3N A;  5FE1 A;  5LJ1 A;  5DFB A;  2DVS A;  4QSR A;  4NQN A;  2RS9 B;  5FE9 A;  2YYN A;  5CUE A;  4IOO A;  4QEV A;  4XY9 A;  5AMF A;  2DWW A;  4YBT A;  5DW2 A;  5L97 A;  5I40 A;  5ENG A;  4HBV A;  5EPR A;  5KTX A;  3Q2F A;  3UV5 A;  3K2J A;  5E74 A;  4TT4 A;  4QSV A;  4BW2 A;  2D82 A;  5CQ4 A;  3JVJ A;  4O7F A;  5HRV A;  3SVG A;  1EQF A;  5BT3 A;  5CPE A;  2DVV A;  2LSP B;  3O36 A;  2E7O A;  2YEL A;  3JVL A;  4E96 A;  4HBW A;  4NR9 A;  3GG3 A;  1N72 A;  4UIU A;  5DBM A;  5CUD A;  4CLB A;  5ENI A;  4NS5 A;  5DW1 A;  1JM4 B;  4OUF A;  4NRB A;  5D3P A;  2YW5 A;  5JWM A;  2FSA A;  5CQ5 A;  4YH4 A;  4LR6 A;  5LUU A;  5ENF A;  5CRZ A;  4QBM A;  5AME A;  4QSU A;  4NR6 A;  4O78 A;  3U5K A;  3LJW A;  4NYV A;  2RFJ A;  3S91 A;  5CRM A;  4NR5 A;  5F61 A;  4LYI A;  4YYM A;  2KTB B;  5HRW A;  5FFV A;  5D3T A;  4O74 A;  4YC9 A;  4O71 A;  2OUO A;  4A9H A;  5L96 A;  4FLP A;  3Q2E A;  4UYG A;  4N4F A;  4QEW A;  5A5N A;  4CUP A;  2RI7 A;  5LVQ A;  4J3I A;  5EI4 A;  3S92 A;  5LKT A;  5E0R A;  4CUQ A;  5HFQ A;  3LQI A;  5A5O A;  4TS8 A;  2R0S A;  5I88 A;  3MUL A;  5A7C A;  5FE6 A;  4O7C A;  4TU6 A;  2RO1 A;  2MJV B;  5CQ6 A;  2YDW A;  5E9L A;  4CUT A;  5CP5 A;  5FFY A;  3DWY A;  4ZW1 A;  4Z6I A;  5AD3 A;  5HQ5 A;  2RNY A;  5HQ6 A;  3MB3 A;  2YEK A;  5FG5 A;  3HME A;  5D3L A;  5CY9 A;  5L99 A;  4NUD A;  5A82 A;  5H1V A;  3ZYU A;  4YYH A;  3D7C A;  5BT5 A;  5TB6 A; 
#chains in the Genus database with same CATH topology
 4NYW A;  4QUT A;  4QSP A;  5CQT A;  3JVK A;  3HMF A;  4LZR A;  4CUS A;  5F62 A;  3UV4 A;  4HXS A;  4LC2 A;  5E9M A;  3DAI A;  5IBN A;  4PCE A;  3UVY A;  4TU4 A;  5LJ2 A;  5DYC A;  4BJX A;  4TTE A;  5D3R A;  4O70 A;  5K29 A;  4QR4 A;  4IR6 A;  5DYA A;  4UYF A;  4TYL A;  1PUO A;  4F3I A;  4IR3 A;  5CUG A;  4CL9 A;  3U5P A;  4PCI A;  5A83 A;  5L98 A;  3O34 A;  4QUU A;  5CZG A;  5FE8 A;  2YQD A;  5FE3 A;  4LDF A;  4NYX A;  5G4S A;  4WIV A;  1JSP B;  5H1T A;  5EU1 A;  4QEU A;  4QSQ A;  4QB3 A;  5FE4 A;  5I7X A;  4Q0O A;  2DAT A;  5EK9 A;  5LKU A;  3G0J A;  4O7E A;  5I83 A;  4UYF B;  5H1U A;  2E3K A;  5F1L A;  3MUK A;  4TT6 A;  5CQ8 A;  5FH7 A;  5EIS A;  5CUB A;  5HM0 A;  5IGL A;  4OGI A;  5E73 A;  4HBY A;  4TQN A;  4A9O A;  4AI6 A;  5EQ1 A;  4CFK A;  3SVF A;  4BW4 A;  4TT2 A;  1X0J A;  4IR5 A;  5LKZ A;  5ENB A;  5A81 A;  5E7D A;  2R0Y A;  5D24 A;  5A5Q A;  5EIC A;  4N4I A;  4MEQ A;  4DON A;  4LYS A;  5FFW A;  5I80 A;  5FBX A;  4O7A A;  4Q0N A;  5E9V A;  5G4R A;  4YYJ A;  5FE7 A;  5I89 A;  4QNS A;  4XY8 A;  2N9G A;  4Z1Q A;  4QSS A;  3UVW A;  3UW9 A;  3I3J A;  5ENH A;  3NXB A;  5H85 A;  5EA1 A;  2G4A A;  3U5M A;  4ALH A;  1WUG A;  4ALG A;  4CUR A;  5F5Z A;  4A9I A;  5CGP A;  2L85 A;  4O7B A;  2L5E A;  4A9L A;  2RNW A;  4MR3 A;  5HCL A;  5D26 A;  4O72 A;  4AKI A;  4QST A;  3U5N A;  4N4G A;  5FE0 A;  4YK0 A;  2OO1 A;  5EWD A;  5CQ3 A;  5ENE A;  4A9K A;  5A5P A;  4WHW A;  3D1B A;  5DKH A;  4ZQL A;  5EP7 A;  5IGK A;  5DYX A;  4UIZ A;  4XUA A;  5HRX A;  4GPJ A;  5JI8 A;  3UVX A;  4RVR A;  5KO4 A;  3LQJ A;  4Z93 A;  3LQH A;  5FB0 A;  5IG6 A;  4UYE A;  4QR5 A;  5I86 A;  4HXR A;  4N3W A;  3U5L A;  5HEM A;  3QZV A;  4KV1 A;  3O37 A;  4UIT A;  5C8G A;  4NQM A;  5FE5 A;  5IGN A;  4Y03 A;  4UIY A;  2F6J A;  5CQ7 A;  3SVH A;  4UIX A;  1E6I A;  5DX4 A;  4YYK A;  5LVR A;  5HEL A;  4YBS A;  4PS5 A;  5F60 A;  4TZ8 A;  4QSX A;  4BHW A;  5FB1 A;  5EWC A;  5II1 A;  2YEM A;  5FG6 A;  5L8T A;  2DVQ A;  5E9Y A;  5BT4 A;  5DFC A;  3JVM A;  5L8U A;  5A85 A;  4C67 A;  4KV4 A;  2L84 A;  2R10 A;  4YAX A;  4ZC9 A;  1F68 A;  5DKD A;  5DFD A;  5HEN A;  4YH3 A;  5LKX A;  4YAD A;  5EPS A;  4QYD A;  5ETD A;  4YYI A;  5EM3 A;  5I7Y A;  5F25 A;  5I29 A;  4NR4 A;  5E9I A;  5EVA A;  4BW3 A;  3O33 A;  4PKL A;  4A9F A;  3TLP A;  4MR5 A;  5FE2 A;  3ONI A;  4NR7 A;  4MEO A;  5DY7 A;  3P1F A;  5EV9 A;  4HXP A;  4A9J A;  2E7N A;  4YYN A;  4PY6 A;  4IR4 A;  3G0L A;  4IOR A;  4HXK A;  2H60 A;  5EWW A;  3P1E A;  5FG4 A;  2NXB A;  4CUU A;  4MR4 A;  5D3S A;  3UVD A;  5ENC A;  4YYG A;  4CFL A;  4YBM A;  5IID A;  4NRC A;  4BW1 A;  4C66 A;  2GRC A;  5CTL A;  5DLX A;  3U5O A;  4NUE A;  5CUA A;  4O77 A;  4J0S A;  2F6N A;  5D3J A;  5F2P A;  4A9M A;  4QZS A;  5DLZ A;  3P1D A;  3VKG A;  4QYL A;  4A9N A;  5F63 A;  5DKC A;  5EGU A;  5FH6 A;  5IGM A;  5F36 A;  5CU8 A;  5DYU A;  4YAT A;  5D3H A;  5C4Q A;  3IU5 A;  3P5O A;  4Z6H A;  5C87 A;  4YY4 A;  4UYH A;  5EPB A;  5A5S A;  5KTW A;  2WP1 A;  5ACY A;  4HBX A;  4XYA A;  4HXM A;  5F3A A;  4XUB A;  5II2 A;  3MXF A;  4HXN A;  4O76 A;  4LZ2 A;  5C7N A;  4UIW A;  3HMH A;  4QC1 A;  4WHU A;  5TCM A;  1WUM A;  4TZ2 A;  4YY6 A;  5KU3 A;  4X2I A;  4LRG A;  2WP2 A;  4HXO A;  5CFW A;  4HXL A;  5FDZ A;  4UYD A;  3FKM X;  4QSW A;  4MR6 A;  3QZS A;  4N4H A;  5CQA A;  1ZS5 A;  5E3G A;  5CUC A;  2DVR A;  3ERR A;  4PTB A;  3O35 A;  5HFR A;  2RNX A;  3MB4 A;  5COI A;  3MQM A;  3P1C A;  5EWH A;  4NR8 A;  4O75 A;  3AQA A;  4YYD A;  4MEN A;  5HQ7 A;  3UV2 A;  3RCW A;  4NUC A;  5E9K A;  5ETB A;  2R0V A;  5KTU A;  5A5R A;  5HJC A;  5J0D A;  3QZT A;  3LXJ A;  5HLS A;  4NRA A;  4OGJ A;  4UIV A;  5C85 A;  5E3D A;  5I1Q A;  4AKG A;  3IU6 A;  5AD2 A;  5D0C A;  5F1H A;  2I7K A;  3D1D A;  5C89 A;  4LYW A;  4LZS A;  5CS8 A;  5EWV A;  2OSS A;  2DKW A;  2D9E A;  2I8N A;  4QC3 A;  4J0R A;  4AKN A;  4NXJ A;  3U5J A;  5D25 A;  4Z1S A;  5D7X A;  3AAD A;  4MEP A;  5ENJ A;  5LJ0 A;  4QY4 A;  4QR3 A;  4IOQ A;  4J1P A;  5KHM A;  4YAB A;  4A9E A;  4KCX A;  5FH8 A;  5D3N A;  5FE1 A;  2EJN A;  5LJ1 A;  5DFB A;  2DVS A;  4QSR A;  4NQN A;  2RS9 B;  5FE9 A;  2YYN A;  5CUE A;  4IOO A;  4QEV A;  4XY9 A;  5AMF A;  2DWW A;  4YBT A;  5DW2 A;  5L97 A;  5I40 A;  5ENG A;  4HBV A;  1ZKR A;  5EPR A;  3Q2F A;  5KTX A;  3UV5 A;  3K2J A;  5E74 A;  4TT4 A;  4AKH A;  4QSV A;  4BW2 A;  2D82 A;  5CQ4 A;  3JVJ A;  4O7F A;  5HRV A;  3SVG A;  1EQF A;  5BT3 A;  5CPE A;  2DVV A;  2LSP B;  3O36 A;  2E7O A;  2YEL A;  3JVL A;  4E96 A;  4HBW A;  4NR9 A;  3GG3 A;  1N72 A;  4UIU A;  5DBM A;  5CUD A;  4CLB A;  5ENI A;  4NS5 A;  5DW1 A;  1JM4 B;  4OUF A;  4NRB A;  5D3P A;  2YW5 A;  5JWM A;  2FSA A;  5CQ5 A;  4YH4 A;  4LR6 A;  5LUU A;  5ENF A;  5CRZ A;  4QBM A;  5AME A;  4QSU A;  4NR6 A;  4O78 A;  3U5K A;  3LJW A;  4NYV A;  2RFJ A;  3S91 A;  5CRM A;  4NR5 A;  5F61 A;  4LYI A;  4YYM A;  2KTB B;  5HRW A;  5FFV A;  5D3T A;  3VKH A;  4O74 A;  4YC9 A;  4O71 A;  2OUO A;  4A9H A;  5L96 A;  4FLP A;  3Q2E A;  4UYG A;  4N4F A;  4QEW A;  5A5N A;  4CUP A;  2RI7 A;  5LVQ A;  4J3I A;  5EI4 A;  3S92 A;  5LKT A;  5E0R A;  4CUQ A;  5HFQ A;  3LQI A;  5A5O A;  4TS8 A;  2R0S A;  5I88 A;  3MUL A;  5A7C A;  5FE6 A;  4O7C A;  4TU6 A;  2RO1 A;  2MJV B;  5CQ6 A;  2YDW A;  5E9L A;  4CUT A;  5CP5 A;  5FFY A;  3DWY A;  4ZW1 A;  4Z6I A;  5AD3 A;  5HQ5 A;  2RNY A;  5HQ6 A;  3MB3 A;  2YEK A;  5FG5 A;  3HME A;  5D3L A;  5CY9 A;  5L99 A;  4NUD A;  5A82 A;  5H1V A;  3ZYU A;  4YYH A;  3D7C A;  5BT5 A;  5TB6 A; 
#chains in the Genus database with same CATH homology
 4NYW A;  4QUT A;  4QSP A;  5CQT A;  3JVK A;  3HMF A;  4LZR A;  4CUS A;  5F62 A;  3UV4 A;  4HXS A;  4LC2 A;  5E9M A;  3DAI A;  5IBN A;  4PCE A;  3UVY A;  4TU4 A;  5LJ2 A;  5DYC A;  4BJX A;  4TTE A;  5D3R A;  4O70 A;  5K29 A;  4QR4 A;  4IR6 A;  5DYA A;  4UYF A;  4TYL A;  4F3I A;  4IR3 A;  5CUG A;  4CL9 A;  3U5P A;  4PCI A;  5A83 A;  5L98 A;  3O34 A;  4QUU A;  5CZG A;  5FE8 A;  2YQD A;  5FE3 A;  4LDF A;  4NYX A;  5G4S A;  4WIV A;  1JSP B;  5H1T A;  5EU1 A;  4QEU A;  4QSQ A;  4QB3 A;  5FE4 A;  5I7X A;  4Q0O A;  2DAT A;  5EK9 A;  5LKU A;  3G0J A;  4O7E A;  5I83 A;  4UYF B;  5H1U A;  2E3K A;  5F1L A;  3MUK A;  4TT6 A;  5CQ8 A;  5FH7 A;  5EIS A;  5CUB A;  5HM0 A;  5IGL A;  4OGI A;  5E73 A;  4HBY A;  4TQN A;  4A9O A;  5EQ1 A;  4CFK A;  3SVF A;  4BW4 A;  4TT2 A;  1X0J A;  4IR5 A;  5LKZ A;  5ENB A;  5A81 A;  5E7D A;  2R0Y A;  5D24 A;  5A5Q A;  5EIC A;  4N4I A;  4MEQ A;  4DON A;  4LYS A;  5FFW A;  5I80 A;  5FBX A;  4O7A A;  4Q0N A;  5E9V A;  5G4R A;  4YYJ A;  5FE7 A;  5I89 A;  4QNS A;  4XY8 A;  2N9G A;  4Z1Q A;  4QSS A;  3UVW A;  3UW9 A;  3I3J A;  5ENH A;  3NXB A;  5H85 A;  5EA1 A;  2G4A A;  3U5M A;  4ALH A;  1WUG A;  4ALG A;  4CUR A;  5F5Z A;  4A9I A;  5CGP A;  2L85 A;  4O7B A;  2L5E A;  4A9L A;  2RNW A;  4MR3 A;  5HCL A;  5D26 A;  4O72 A;  4QST A;  3U5N A;  4N4G A;  5FE0 A;  4YK0 A;  2OO1 A;  5EWD A;  5CQ3 A;  5ENE A;  4A9K A;  5A5P A;  4WHW A;  5EP7 A;  5DKH A;  4ZQL A;  5IGK A;  5DYX A;  4UIZ A;  4XUA A;  5HRX A;  4GPJ A;  5JI8 A;  3UVX A;  4RVR A;  5KO4 A;  3LQJ A;  4Z93 A;  3LQH A;  5FB0 A;  5IG6 A;  4UYE A;  4QR5 A;  5I86 A;  4HXR A;  4N3W A;  3U5L A;  5HEM A;  3QZV A;  4KV1 A;  3O37 A;  4UIT A;  5C8G A;  4NQM A;  5FE5 A;  5IGN A;  4Y03 A;  4UIY A;  2F6J A;  5CQ7 A;  3SVH A;  4UIX A;  1E6I A;  5DX4 A;  4YYK A;  5LVR A;  5HEL A;  4YBS A;  4PS5 A;  5F60 A;  4TZ8 A;  4QSX A;  4BHW A;  5FB1 A;  5EWC A;  5II1 A;  2YEM A;  5FG6 A;  5L8T A;  2DVQ A;  5E9Y A;  5BT4 A;  5DFC A;  3JVM A;  5L8U A;  5A85 A;  4C67 A;  4KV4 A;  2L84 A;  2R10 A;  4YAX A;  4ZC9 A;  1F68 A;  5DKD A;  5DFD A;  5HEN A;  4YH3 A;  5LKX A;  4YAD A;  5EPS A;  4QYD A;  5ETD A;  4YYI A;  5EM3 A;  5I7Y A;  5F25 A;  5I29 A;  4NR4 A;  5E9I A;  5EVA A;  4BW3 A;  3O33 A;  4PKL A;  4A9F A;  3TLP A;  4MR5 A;  5FE2 A;  3ONI A;  4NR7 A;  4MEO A;  5DY7 A;  3P1F A;  5EV9 A;  4HXP A;  4A9J A;  2E7N A;  4YYN A;  4PY6 A;  4IR4 A;  3G0L A;  4IOR A;  4HXK A;  2H60 A;  5EWW A;  3P1E A;  5FG4 A;  2NXB A;  4CUU A;  4MR4 A;  5D3S A;  3UVD A;  5ENC A;  4YYG A;  4CFL A;  4YBM A;  5IID A;  4NRC A;  4BW1 A;  4C66 A;  2GRC A;  5CTL A;  5DLX A;  3U5O A;  4NUE A;  5CUA A;  4O77 A;  4J0S A;  2F6N A;  5D3J A;  5F2P A;  4A9M A;  4QZS A;  5DLZ A;  3P1D A;  4QYL A;  4A9N A;  5F63 A;  5DKC A;  5EGU A;  5FH6 A;  5IGM A;  5F36 A;  5CU8 A;  5DYU A;  4YAT A;  5D3H A;  5C4Q A;  3IU5 A;  3P5O A;  4Z6H A;  5C87 A;  4YY4 A;  4UYH A;  5EPB A;  5A5S A;  5KTW A;  2WP1 A;  5ACY A;  4HBX A;  4XYA A;  4HXM A;  5F3A A;  4XUB A;  5II2 A;  3MXF A;  4HXN A;  4O76 A;  4LZ2 A;  5C7N A;  4UIW A;  3HMH A;  4QC1 A;  4WHU A;  5TCM A;  1WUM A;  4TZ2 A;  4YY6 A;  5KU3 A;  4X2I A;  4LRG A;  2WP2 A;  4HXO A;  5CFW A;  4HXL A;  5FDZ A;  4UYD A;  3FKM X;  4QSW A;  4MR6 A;  3QZS A;  4N4H A;  5CQA A;  1ZS5 A;  5E3G A;  5CUC A;  2DVR A;  4PTB A;  3O35 A;  5HFR A;  2RNX A;  3MB4 A;  5COI A;  3MQM A;  3P1C A;  5EWH A;  4NR8 A;  4O75 A;  3AQA A;  4YYD A;  4MEN A;  5HQ7 A;  3UV2 A;  3RCW A;  4NUC A;  5E9K A;  5ETB A;  2R0V A;  5KTU A;  5A5R A;  5HJC A;  5J0D A;  3QZT A;  3LXJ A;  5HLS A;  4NRA A;  4OGJ A;  4UIV A;  5C85 A;  5E3D A;  5I1Q A;  3IU6 A;  5AD2 A;  5D0C A;  5F1H A;  2I7K A;  5C89 A;  4LYW A;  4LZS A;  5CS8 A;  5EWV A;  2OSS A;  2DKW A;  2D9E A;  2I8N A;  4QC3 A;  4J0R A;  4AKN A;  4NXJ A;  3U5J A;  5D25 A;  4Z1S A;  5D7X A;  3AAD A;  4MEP A;  5ENJ A;  5LJ0 A;  4QY4 A;  4QR3 A;  4IOQ A;  4J1P A;  5KHM A;  4YAB A;  4A9E A;  4KCX A;  5FH8 A;  5D3N A;  5FE1 A;  5LJ1 A;  5DFB A;  2DVS A;  4QSR A;  4NQN A;  2RS9 B;  5FE9 A;  2YYN A;  5CUE A;  4IOO A;  4QEV A;  4XY9 A;  5AMF A;  2DWW A;  4YBT A;  5DW2 A;  5L97 A;  5I40 A;  5ENG A;  4HBV A;  5EPR A;  5KTX A;  3Q2F A;  3UV5 A;  3K2J A;  5E74 A;  4TT4 A;  4QSV A;  4BW2 A;  2D82 A;  5CQ4 A;  3JVJ A;  4O7F A;  5HRV A;  3SVG A;  1EQF A;  5BT3 A;  5CPE A;  2DVV A;  2LSP B;  3O36 A;  2E7O A;  2YEL A;  3JVL A;  4E96 A;  4HBW A;  4NR9 A;  3GG3 A;  1N72 A;  4UIU A;  5DBM A;  5CUD A;  4CLB A;  5ENI A;  4NS5 A;  5DW1 A;  1JM4 B;  4OUF A;  4NRB A;  5D3P A;  2YW5 A;  5JWM A;  2FSA A;  5CQ5 A;  4YH4 A;  4LR6 A;  5LUU A;  5ENF A;  5CRZ A;  4QBM A;  5AME A;  4QSU A;  4NR6 A;  4O78 A;  3U5K A;  3LJW A;  4NYV A;  2RFJ A;  3S91 A;  5CRM A;  4NR5 A;  5F61 A;  4LYI A;  4YYM A;  2KTB B;  5HRW A;  5FFV A;  5D3T A;  4O74 A;  4YC9 A;  4O71 A;  2OUO A;  4A9H A;  5L96 A;  4FLP A;  3Q2E A;  4UYG A;  4N4F A;  4QEW A;  5A5N A;  4CUP A;  2RI7 A;  5LVQ A;  4J3I A;  5EI4 A;  3S92 A;  5LKT A;  5E0R A;  4CUQ A;  5HFQ A;  3LQI A;  5A5O A;  4TS8 A;  2R0S A;  5I88 A;  3MUL A;  5A7C A;  5FE6 A;  4O7C A;  4TU6 A;  2RO1 A;  2MJV B;  5CQ6 A;  2YDW A;  5E9L A;  4CUT A;  5CP5 A;  5FFY A;  3DWY A;  4ZW1 A;  4Z6I A;  5AD3 A;  5HQ5 A;  2RNY A;  5HQ6 A;  3MB3 A;  2YEK A;  5FG5 A;  3HME A;  5D3L A;  5CY9 A;  5L99 A;  4NUD A;  5A82 A;  5H1V A;  3ZYU A;  4YYH A;  3D7C A;  5BT5 A;  5TB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...