5EA1A

Crystal structure of smarca4 bromodomain in complex with mpd
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
114
structure length
114
Chain Sequence
b'SPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription activator BRG1
publication title High-Throughput Fragment Docking into the BAZ2B Bromodomain: Efficient in Silico Screening for X-Ray Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 44
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature ec 3.6.4.-:
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ea1A00
5F63A 4IR3A 2D9EA 4O77A 4C67A 5L8UA 4HXOA 4QSUA 4TQNA 4MEOA 5G4SA 5A7CA 4PCIA 4TZ2A 4QZSA 5CP5A 5CFWA 4N4GA 4HXLA 5KTWA 5CGPA 4DONA 4UIVA 4BHWA 4YBSA 2G4AA 4CFKA 2GRCA 5DYXA 3HMEA 5II2A 3RCWA 5IIDA 5H1UA 4XYAA 4UYFA 5EU1A 5D0CA 3U5PA 4QNSA 3P1FA 3DAIA 4O7BA 4PY6A 4HXPA 2YW5A 4KCXA 4N4IA 5C89A 5ENIA 2L84A 4Z1QA 2OUOA 2F6NA 5ENFA 4IOQA 3O36A 5DYUA 1X0JA 4YYDA 3P1DA 3Q2FA 4YATA 5II1A 4BW2A 5HELA 4CL9A 4ZC9A 4QSSA 5HQ6A 5FDZA 3UV2A 4O74A 4ALHA 3MB3A 4NQMA 4UYHA 4O7EA 5HJCA 4O78A 4NUEA 4XUBA 5EM3A 5E3DA 4CUUA 4Y03A 5HFRA 4MR3A 3U5JA 5L99A 4A9EA 5ETBA 4NRBA 2L5EA 4WHWA 5DFCA 4YK0A 5DKDA 3U5LA 3UVDA 5EWCA 3S91A 5CS8A 2YEKA 3LQHA 3ZYUA 4CURA 3U5OA 4O7FA 4QEVA 4NS5A 4F3IA 4OUFA 3DWYA 4LYWA 4OGJA 5IGMA 5FE8A 5DYAA 5I89A 3U5KA 3LQJA 5F5ZA 5FE9A 3FKMX 2LSPB 5HENA 5E3GA 3UVYA 5D3JA 5CZGA 4Q0OA 5KTXA 5FB1A 5A5QA 5ETDA 5F3AA 4QEUA 3JVKA 4MENA 5EPBA 4E96A 5HQ7A 4O70A 5DFDA 5F1HA 4QY4A 4PS5A 2RO1A 2R0YA 3AQAA 3D7CA 3MULA 4QUUA 5DKCA 5FG4A 5FG5A 5A5NA 5CUAA 4CUSA 4UIWA 5CQTA 4QUTA 5DKHA 4YAXA 4QYLA 5LJ0A 4YYMA 4XY9A 5E0RA 5C87A 4MEPA 4YYHA 3TLPA 2NXBA 4NRAA 4YYKA 5F60A 4QC1A 4QEWA 3K2JA 5IGLA 3LXJA 5E9KA 2DVRA 2DATA 2OO1A 5EPSA 4HXKA 5H85A 5A5SA 5EWDA 5ENBA 4NQNA 3HMFA 4ZQLA 4ZW1A 3UVXA 5CY9A 4NUCA 4YYNA 5IG6A 5BT3A 4FLPA 5CQ6A 5DLXA 5FFWA 3I3JA 4J3IA 3U5NA 4NYXA 4LZSA 3MQMA 4TYLA 5FB0A 2DVSA 3P1CA 5D7XA 5CUDA 4CUQA 5FE0A 2YQDA 4NYWA 4UYDA 5E9YA 2YELA 3JVLA 3UVWA 4J0RA 5DY7A 4A9IA 5JI8A 5H1TA 2R0VA 2I7KA 5HRWA 5CQ7A 4MEQA 5EWWA 5HFQA 3IU5A 5EI4A 5COIA 3MUKA 5EVAA 3U5MA 5G4RA 5E7DA 5CUEA 4BW1A 5A5RA 3G0JA 4HXNA 5F25A 4NR9A 3O37A 4TU6A 4IR5A 1ZS5A 5EISA 2RS9B 5K29A 4QYDA 4KV4A 4TS8A 4QSPA 4IOOA 3JVMA 4LRGA 5EP7A 4LR6A 5FH8A 5CQ4A 5I7XA 5EQ1A 4QSXA 4A9FA 4QC3A 4LC2A 4QSRA 5CRZA 4YADA 4CFLA 2WP1A 2E7OA 5DW2A 5C4QA 4WIVA 5I1QA 4QSWA 5BT5A 3O35A 4BW3A 1WUMA 4IR6A 5E9VA 4CUTA 3UV4A 5I29A 5I40A 3NXBA 2D82A 3UW9A 4N4FA 5E9LA 4HXMA 5F2PA 4NR4A 2E7NA 2L85A 5H1VA 4QBMA 4TZ8A 1EQFA 4YYIA 4TT2A 4A9HA 4YBMA 2F6JA 5CRMA 4NRCA 4N4HA 4UYGA 5E73A 3QZSA 2DWWA 5EPRA 4HBXA 4C66A 5AMFA 4O71A 2DVQA 5F1LA 1F68A 5FH6A 5ENHA 3HMHA 2N9GA 5C8GA 5CUCA 5HEMA 5EA1A 4YYGA 4WHUA 5IGNA 5CUBA 4CLBA 3ONIA 4A9MA 2RI7A 5CQ3A 5I88A 4A9JA 4GPJA 4AKNA 5FE5A 3Q2EA 4LZ2A 3IU6A 5F61A 5L96A 4QR3A 4A9NA 5A81A 5AD3A 4O7AA 1JM4B 1JSPB 4XUAA 5KTUA 5FFVA 5DBMA 3QZTA 4A9OA 5L98A 4BJXA 4UITA 4X2IA 4A9LA 5E9MA 3P1EA 5D3PA 5EWVA 4MR5A 5CU8A 2RNYA 4N3WA 5D24A 5I80A 4MR4A 3P5OA 4NR7A 5FBXA 5TB6A 4NR8A 5C7NA 4O72A 2FSAA 2KTBB 5L8TA 4YBTA 4TU4A 4HBWA 5CQ8A 4NR6A 5HM0A 4O7CA 2WP2A 5A5PA 2I8NA 4IR4A 5BT4A 4OGIA 5FE3A 4KV1A 5DW1A 4UIZA 2DVVA 4J0SA 4Z6IA 5FE4A 5DX4A 4NUDA 5C85A 5DFBA 5JWMA 4QR5A 3SVGA 3AADA 5DYCA 4IORA 2RFJA 5A85A 5AMEA 5ACYA 4HBYA 5LKTA 5A5OA 4HBVA 4UIXA 5DLZA 2DKWA 5A82A 5I83A 5KU3A 4XY8A 3MXFA 4LYIA 5F62A 5EWHA 5F36A 5LKXA 5D3NA 5LVRA 5FE1A 5IBNA 3SVHA 5D3HA 4PTBA 5HLSA 5ENCA 4YY4A 4RVRA 4UIUA 5HCLA 3QZVA 2R0SA 4J1PA 5EICA 2YEMA 5ENEA 4NXJA 5KHMA 3S92A 5CPEA 4LZRA 4NYVA 5E74A 1N72A 5ENJA 4LDFA 5HQ5A 5E9IA 4HXSA 4Q0NA 5EGUA 5D3TA 4O76A 5CQ5A 4YY6A 4QB3A 5FFYA 5LKUA 4TTEA 5I7YA 5D25A 4CUPA 5LJ1A 4YABA 4QSQA 4YC9A 2RNXA 5TCMA 5KO4A 4NR5A 2MJVB 4Z93A 5FE6A 2R10A 5CTLA 4Z6HA 4HXRA 4YH3A 5I86A 5LJ2A 5LKZA 3LJWA 3GG3A 2E3KA 4A9KA 2YYNA 5CUGA 5J0DA 5EK9A 4LYSA 5D3RA 3SVFA 5LUUA 4ALGA 4MR6A 4O75A 4QSTA 4YH4A 4YYJA 2YDWA 5HRVA 1WUGA 3UV5A 5D3SA 3LQIA 5D3LA 4UIYA 5LVQA 4TT4A 3G0LA 5A83A 4QR4A 1E6IA 5L97A 4Z1SA 4PKLA 5AD2A 5FG6A 4UYFB 2H60A 3O33A 2OSSA 4TT6A 5HRXA 5FE2A 3O34A 4QSVA 2RNWA 4PCEA 3MB4A 4BW4A 4UYEA 5ENGA 5EV9A 5FH7A 5IGKA 3JVJA 5D26A 5CQAA 5FE7A
chains in the Genus database with same CATH superfamily
5F63A 4IR3A 2D9EA 4O77A 4C67A 5L8UA 4HXOA 4QSUA 4TQNA 4MEOA 5G4SA 5A7CA 4PCIA 4TZ2A 4QZSA 5CP5A 5CFWA 4N4GA 4HXLA 5KTWA 5CGPA 4DONA 4UIVA 4BHWA 4YBSA 2G4AA 4CFKA 2GRCA 4AKGA 5DYXA 3HMEA 5II2A 3RCWA 5IIDA 5H1UA 4XYAA 1ZKRA 4UYFA 5EU1A 5D0CA 3U5PA 4QNSA 3P1FA 3DAIA 4O7BA 4PY6A 4HXPA 2YW5A 4KCXA 4N4IA 5C89A 5ENIA 2L84A 4Z1QA 2OUOA 2F6NA 5ENFA 4IOQA 3O36A 5DYUA 1X0JA 4YYDA 3P1DA 3Q2FA 4YATA 5II1A 4BW2A 5HELA 4CL9A 4ZC9A 4QSSA 5HQ6A 5FDZA 3UV2A 4O74A 4ALHA 3MB3A 4NQMA 4UYHA 4O7EA 5HJCA 4O78A 4NUEA 4XUBA 5EM3A 5E3DA 4CUUA 4Y03A 5HFRA 4MR3A 3U5JA 5L99A 4A9EA 5ETBA 4NRBA 2L5EA 3ERRA 4WHWA 5DFCA 4YK0A 5DKDA 3U5LA 3UVDA 5EWCA 3S91A 5CS8A 2YEKA 3LQHA 3ZYUA 4CURA 3U5OA 4O7FA 4QEVA 4NS5A 4F3IA 4OUFA 2EJNA 3DWYA 4LYWA 4OGJA 5IGMA 5FE8A 5DYAA 5I89A 3U5KA 3LQJA 5F5ZA 5FE9A 3FKMX 2LSPB 5HENA 5E3GA 3UVYA 5D3JA 5CZGA 4Q0OA 5KTXA 5FB1A 5A5QA 5ETDA 5F3AA 4QEUA 3JVKA 4MENA 5EPBA 4E96A 5HQ7A 4O70A 5DFDA 5F1HA 4QY4A 4PS5A 2RO1A 2R0YA 3AQAA 3D7CA 3MULA 4QUUA 5DKCA 5FG4A 5FG5A 5A5NA 5CUAA 4CUSA 4UIWA 5CQTA 4QUTA 5DKHA 4YAXA 4QYLA 5LJ0A 4YYMA 4XY9A 5E0RA 5C87A 4MEPA 4YYHA 3TLPA 2NXBA 4NRAA 4YYKA 5F60A 4QC1A 4QEWA 3K2JA 5IGLA 3LXJA 5E9KA 2DVRA 2DATA 2OO1A 5EPSA 4HXKA 5H85A 5A5SA 5EWDA 5ENBA 4NQNA 3HMFA 4ZQLA 4ZW1A 3UVXA 5CY9A 4NUCA 4YYNA 5IG6A 5BT3A 3D1DA 4FLPA 5CQ6A 5DLXA 5FFWA 3I3JA 4J3IA 3U5NA 4NYXA 4LZSA 3MQMA 4TYLA 5FB0A 2DVSA 3P1CA 5D7XA 5CUDA 4CUQA 5FE0A 2YQDA 4NYWA 4UYDA 5E9YA 2YELA 3JVLA 3UVWA 4J0RA 5DY7A 4A9IA 5JI8A 5H1TA 2R0VA 2I7KA 5HRWA 5CQ7A 4MEQA 5EWWA 5HFQA 3IU5A 5EI4A 5COIA 3MUKA 5EVAA 3U5MA 5G4RA 5E7DA 5CUEA 4BW1A 5A5RA 3G0JA 4HXNA 5F25A 4NR9A 3O37A 4TU6A 4IR5A 1ZS5A 5EISA 2RS9B 5K29A 4QYDA 4KV4A 4TS8A 4QSPA 4IOOA 3JVMA 4LRGA 5EP7A 4LR6A 5FH8A 5CQ4A 5I7XA 4AKIA 5EQ1A 4QSXA 4A9FA 4QC3A 4LC2A 4QSRA 5CRZA 4AI6A 4YADA 4CFLA 2WP1A 2E7OA 5DW2A 5C4QA 4WIVA 5I1QA 4QSWA 5BT5A 3O35A 4BW3A 1WUMA 4IR6A 5E9VA 4CUTA 3UV4A 5I29A 5I40A 3NXBA 2D82A 3UW9A 4N4FA 5E9LA 4HXMA 5F2PA 4NR4A 2E7NA 2L85A 5H1VA 4QBMA 4TZ8A 1EQFA 4YYIA 4TT2A 4A9HA 4YBMA 2F6JA 5CRMA 3D1BA 4NRCA 4N4HA 4UYGA 5E73A 3QZSA 2DWWA 5EPRA 4HBXA 4C66A 5AMFA 4O71A 2DVQA 5F1LA 1F68A 5FH6A 5ENHA 3HMHA 2N9GA 5C8GA 5CUCA 5HEMA 5EA1A 4YYGA 4WHUA 5IGNA 5CUBA 4CLBA 3ONIA 4A9MA 2RI7A 5CQ3A 5I88A 4A9JA 4GPJA 4AKNA 5FE5A 3Q2EA 4LZ2A 3IU6A 5F61A 5L96A 4QR3A 4A9NA 5A81A 5AD3A 4O7AA 1JM4B 1JSPB 4XUAA 5KTUA 5FFVA 5DBMA 3QZTA 4A9OA 5L98A 4BJXA 4UITA 4X2IA 1PUOA 4A9LA 5E9MA 3P1EA 5D3PA 5EWVA 4MR5A 5CU8A 3VKHA 2RNYA 4N3WA 5D24A 5I80A 4MR4A 3P5OA 4NR7A 5FBXA 5TB6A 4NR8A 5C7NA 4O72A 2FSAA 2KTBB 5L8TA 4YBTA 4TU4A 4HBWA 5CQ8A 4NR6A 5HM0A 4O7CA 2WP2A 5A5PA 2I8NA 4IR4A 5BT4A 4OGIA 5FE3A 4KV1A 5DW1A 4UIZA 2DVVA 4J0SA 4Z6IA 5FE4A 5DX4A 4NUDA 5C85A 5DFBA 5JWMA 4QR5A 3SVGA 3AADA 5DYCA 4IORA 2RFJA 5A85A 5AMEA 5ACYA 4HBYA 5LKTA 5A5OA 4HBVA 4UIXA 5DLZA 2DKWA 5A82A 5I83A 5KU3A 4XY8A 3MXFA 4LYIA 5F62A 5EWHA 5F36A 5LKXA 5D3NA 5LVRA 5FE1A 5IBNA 3SVHA 5D3HA 4PTBA 5HLSA 5ENCA 4YY4A 4RVRA 4UIUA 5HCLA 3QZVA 2R0SA 4J1PA 5EICA 2YEMA 5ENEA 4NXJA 5KHMA 3S92A 5CPEA 4LZRA 4NYVA 5E74A 1N72A 5ENJA 4LDFA 5HQ5A 5E9IA 4HXSA 4Q0NA 5EGUA 5D3TA 4O76A 5CQ5A 4YY6A 4QB3A 5FFYA 5LKUA 4TTEA 5I7YA 5D25A 4CUPA 5LJ1A 4YABA 4QSQA 4YC9A 2RNXA 5TCMA 4AKHA 5KO4A 4NR5A 2MJVB 4Z93A 5FE6A 2R10A 5CTLA 4Z6HA 4HXRA 4YH3A 5I86A 5LJ2A 5LKZA 3LJWA 3GG3A 2E3KA 4A9KA 2YYNA 5CUGA 5J0DA 5EK9A 4LYSA 5D3RA 3SVFA 5LUUA 4ALGA 4MR6A 4O75A 4QSTA 4YH4A 4YYJA 2YDWA 5HRVA 1WUGA 3UV5A 5D3SA 3LQIA 5D3LA 4UIYA 5LVQA 4TT4A 3G0LA 5A83A 4QR4A 1E6IA 5L97A 4Z1SA 4PKLA 5AD2A 5FG6A 4UYFB 2H60A 3O33A 3VKGA 2OSSA 4TT6A 5HRXA 5FE2A 3O34A 4QSVA 2RNWA 4PCEA 3MB4A 4BW4A 4UYEA 5ENGA 5EV9A 5FH7A 5IGKA 3JVJA 5D26A 5CQAA 5FE7A
chains in the Genus database with same CATH topology
5F63A 4IR3A 2D9EA 4O77A 4C67A 5L8UA 4HXOA 4QSUA 4TQNA 4MEOA 5G4SA 5A7CA 4PCIA 4TZ2A 4QZSA 5CP5A 5CFWA 4N4GA 4HXLA 5KTWA 5CGPA 4DONA 4UIVA 4BHWA 4YBSA 2G4AA 4CFKA 2GRCA 5DYXA 3HMEA 5II2A 3RCWA 5IIDA 5H1UA 4XYAA 4UYFA 5EU1A 5D0CA 3U5PA 4QNSA 3P1FA 3DAIA 4O7BA 4PY6A 4HXPA 2YW5A 4KCXA 4N4IA 5C89A 5ENIA 2L84A 4Z1QA 2OUOA 2F6NA 5ENFA 4IOQA 3O36A 5DYUA 1X0JA 4YYDA 3P1DA 3Q2FA 4YATA 5II1A 4BW2A 5HELA 4CL9A 4ZC9A 4QSSA 5HQ6A 5FDZA 3UV2A 4O74A 4ALHA 3MB3A 4NQMA 4UYHA 4O7EA 5HJCA 4O78A 4NUEA 4XUBA 5EM3A 5E3DA 4CUUA 4Y03A 5HFRA 4MR3A 3U5JA 5L99A 4A9EA 5ETBA 4NRBA 2L5EA 4WHWA 5DFCA 4YK0A 5DKDA 3U5LA 3UVDA 5EWCA 3S91A 5CS8A 2YEKA 3LQHA 3ZYUA 4CURA 3U5OA 4O7FA 4QEVA 4NS5A 4F3IA 4OUFA 3DWYA 4LYWA 4OGJA 5IGMA 5FE8A 5DYAA 5I89A 3U5KA 3LQJA 5F5ZA 5FE9A 3FKMX 2LSPB 5HENA 5E3GA 3UVYA 5D3JA 5CZGA 4Q0OA 5KTXA 5FB1A 5A5QA 5ETDA 5F3AA 4QEUA 3JVKA 4MENA 5EPBA 4E96A 5HQ7A 4O70A 5DFDA 5F1HA 4QY4A 4PS5A 2RO1A 2R0YA 3AQAA 3D7CA 3MULA 4QUUA 5DKCA 5FG4A 5FG5A 5A5NA 5CUAA 4CUSA 4UIWA 5CQTA 4QUTA 5DKHA 4YAXA 4QYLA 5LJ0A 4YYMA 4XY9A 5E0RA 5C87A 4MEPA 4YYHA 3TLPA 2NXBA 4NRAA 4YYKA 5F60A 4QC1A 4QEWA 3K2JA 5IGLA 3LXJA 5E9KA 2DVRA 2DATA 2OO1A 5EPSA 4HXKA 5H85A 5A5SA 5EWDA 5ENBA 4NQNA 3HMFA 4ZQLA 4ZW1A 3UVXA 5CY9A 4NUCA 4YYNA 5IG6A 5BT3A 4FLPA 5CQ6A 5DLXA 5FFWA 3I3JA 4J3IA 3U5NA 4NYXA 4LZSA 3MQMA 4TYLA 5FB0A 2DVSA 3P1CA 5D7XA 5CUDA 4CUQA 5FE0A 2YQDA 4NYWA 4UYDA 5E9YA 2YELA 3JVLA 3UVWA 4J0RA 5DY7A 4A9IA 5JI8A 5H1TA 2R0VA 2I7KA 5HRWA 5CQ7A 4MEQA 5EWWA 5HFQA 3IU5A 5EI4A 5COIA 3MUKA 5EVAA 3U5MA 5G4RA 5E7DA 5CUEA 4BW1A 5A5RA 3G0JA 4HXNA 5F25A 4NR9A 3O37A 4TU6A 4IR5A 1ZS5A 5EISA 2RS9B 5K29A 4QYDA 4KV4A 4TS8A 4QSPA 4IOOA 3JVMA 4LRGA 5EP7A 4LR6A 5FH8A 5CQ4A 5I7XA 5EQ1A 4QSXA 4A9FA 4QC3A 4LC2A 4QSRA 5CRZA 4YADA 4CFLA 2WP1A 2E7OA 5DW2A 5C4QA 4WIVA 5I1QA 4QSWA 5BT5A 3O35A 4BW3A 1WUMA 4IR6A 5E9VA 4CUTA 3UV4A 5I29A 5I40A 3NXBA 2D82A 3UW9A 4N4FA 5E9LA 4HXMA 5F2PA 4NR4A 2E7NA 2L85A 5H1VA 4QBMA 4TZ8A 1EQFA 4YYIA 4TT2A 4A9HA 4YBMA 2F6JA 5CRMA 4NRCA 4N4HA 4UYGA 5E73A 3QZSA 2DWWA 5EPRA 4HBXA 4C66A 5AMFA 4O71A 2DVQA 5F1LA 1F68A 5FH6A 5ENHA 3HMHA 2N9GA 5C8GA 5CUCA 5HEMA 5EA1A 4YYGA 4WHUA 5IGNA 5CUBA 4CLBA 3ONIA 4A9MA 2RI7A 5CQ3A 5I88A 4A9JA 4GPJA 4AKNA 5FE5A 3Q2EA 4LZ2A 3IU6A 5F61A 5L96A 4QR3A 4A9NA 5A81A 5AD3A 4O7AA 1JM4B 1JSPB 4XUAA 5KTUA 5FFVA 5DBMA 3QZTA 4A9OA 5L98A 4BJXA 4UITA 4X2IA 4A9LA 5E9MA 3P1EA 5D3PA 5EWVA 4MR5A 5CU8A 2RNYA 4N3WA 5D24A 5I80A 4MR4A 3P5OA 4NR7A 5FBXA 5TB6A 4NR8A 5C7NA 4O72A 2FSAA 2KTBB 5L8TA 4YBTA 4TU4A 4HBWA 5CQ8A 4NR6A 5HM0A 4O7CA 2WP2A 5A5PA 2I8NA 4IR4A 5BT4A 4OGIA 5FE3A 4KV1A 5DW1A 4UIZA 2DVVA 4J0SA 4Z6IA 5FE4A 5DX4A 4NUDA 5C85A 5DFBA 5JWMA 4QR5A 3SVGA 3AADA 5DYCA 4IORA 2RFJA 5A85A 5AMEA 5ACYA 4HBYA 5LKTA 5A5OA 4HBVA 4UIXA 5DLZA 2DKWA 5A82A 5I83A 5KU3A 4XY8A 3MXFA 4LYIA 5F62A 5EWHA 5F36A 5LKXA 5D3NA 5LVRA 5FE1A 5IBNA 3SVHA 5D3HA 4PTBA 5HLSA 5ENCA 4YY4A 4RVRA 4UIUA 5HCLA 3QZVA 2R0SA 4J1PA 5EICA 2YEMA 5ENEA 4NXJA 5KHMA 3S92A 5CPEA 4LZRA 4NYVA 5E74A 1N72A 5ENJA 4LDFA 5HQ5A 5E9IA 4HXSA 4Q0NA 5EGUA 5D3TA 4O76A 5CQ5A 4YY6A 4QB3A 5FFYA 5LKUA 4TTEA 5I7YA 5D25A 4CUPA 5LJ1A 4YABA 4QSQA 4YC9A 2RNXA 5TCMA 5KO4A 4NR5A 2MJVB 4Z93A 5FE6A 2R10A 5CTLA 4Z6HA 4HXRA 4YH3A 5I86A 5LJ2A 5LKZA 3LJWA 3GG3A 2E3KA 4A9KA 2YYNA 5CUGA 5J0DA 5EK9A 4LYSA 5D3RA 3SVFA 5LUUA 4ALGA 4MR6A 4O75A 4QSTA 4YH4A 4YYJA 2YDWA 5HRVA 1WUGA 3UV5A 5D3SA 3LQIA 5D3LA 4UIYA 5LVQA 4TT4A 3G0LA 5A83A 4QR4A 1E6IA 5L97A 4Z1SA 4PKLA 5AD2A 5FG6A 4UYFB 2H60A 3O33A 2OSSA 4TT6A 5HRXA 5FE2A 3O34A 4QSVA 2RNWA 4PCEA 3MB4A 4BW4A 4UYEA 5ENGA 5EV9A 5FH7A 5IGKA 3JVJA 5D26A 5CQAA 5FE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F63 A;  4IR3 A;  2D9E A;  4O77 A;  4C67 A;  5L8U A;  4HXO A;  4QSU A;  4TQN A;  4MEO A;  5G4S A;  5A7C A;  4PCI A;  4TZ2 A;  4QZS A;  5CP5 A;  5CFW A;  4N4G A;  4HXL A;  5KTW A;  5CGP A;  4DON A;  4UIV A;  4BHW A;  4YBS A;  2G4A A;  4CFK A;  2GRC A;  5DYX A;  3HME A;  5II2 A;  3RCW A;  5IID A;  5H1U A;  4XYA A;  4UYF A;  5EU1 A;  5D0C A;  3U5P A;  4QNS A;  3P1F A;  3DAI A;  4O7B A;  4PY6 A;  4HXP A;  2YW5 A;  4KCX A;  4N4I A;  5C89 A;  5ENI A;  2L84 A;  4Z1Q A;  2OUO A;  2F6N A;  5ENF A;  4IOQ A;  3O36 A;  5DYU A;  1X0J A;  4YYD A;  3P1D A;  3Q2F A;  4YAT A;  5II1 A;  4BW2 A;  5HEL A;  4CL9 A;  4ZC9 A;  4QSS A;  5HQ6 A;  5FDZ A;  3UV2 A;  4O74 A;  4ALH A;  3MB3 A;  4NQM A;  4UYH A;  4O7E A;  5HJC A;  4O78 A;  4NUE A;  4XUB A;  5EM3 A;  5E3D A;  4CUU A;  4Y03 A;  5HFR A;  4MR3 A;  3U5J A;  5L99 A;  4A9E A;  5ETB A;  4NRB A;  2L5E A;  4WHW A;  5DFC A;  4YK0 A;  5DKD A;  3U5L A;  3UVD A;  5EWC A;  3S91 A;  5CS8 A;  2YEK A;  3LQH A;  3ZYU A;  4CUR A;  3U5O A;  4O7F A;  4QEV A;  4NS5 A;  4F3I A;  4OUF A;  3DWY A;  4LYW A;  4OGJ A;  5IGM A;  5FE8 A;  5DYA A;  5I89 A;  3U5K A;  3LQJ A;  5F5Z A;  5FE9 A;  3FKM X;  2LSP B;  5HEN A;  5E3G A;  3UVY A;  5D3J A;  5CZG A;  4Q0O A;  5KTX A;  5FB1 A;  5A5Q A;  5ETD A;  5F3A A;  4QEU A;  3JVK A;  4MEN A;  5EPB A;  4E96 A;  5HQ7 A;  4O70 A;  5DFD A;  5F1H A;  4QY4 A;  4PS5 A;  2RO1 A;  2R0Y A;  3AQA A;  3D7C A;  3MUL A;  4QUU A;  5DKC A;  5FG4 A;  5FG5 A;  5A5N A;  5CUA A;  4CUS A;  4UIW A;  5CQT A;  4QUT A;  5DKH A;  4YAX A;  4QYL A;  5LJ0 A;  4YYM A;  4XY9 A;  5E0R A;  5C87 A;  4MEP A;  4YYH A;  3TLP A;  2NXB A;  4NRA A;  4YYK A;  5F60 A;  4QC1 A;  4QEW A;  3K2J A;  5IGL A;  3LXJ A;  5E9K A;  2DVR A;  2DAT A;  2OO1 A;  5EPS A;  4HXK A;  5H85 A;  5A5S A;  5EWD A;  5ENB A;  4NQN A;  3HMF A;  4ZQL A;  4ZW1 A;  3UVX A;  5CY9 A;  4NUC A;  4YYN A;  5IG6 A;  5BT3 A;  4FLP A;  5CQ6 A;  5DLX A;  5FFW A;  3I3J A;  4J3I A;  3U5N A;  4NYX A;  4LZS A;  3MQM A;  4TYL A;  5FB0 A;  2DVS A;  3P1C A;  5D7X A;  5CUD A;  4CUQ A;  5FE0 A;  2YQD A;  4NYW A;  4UYD A;  5E9Y A;  2YEL A;  3JVL A;  3UVW A;  4J0R A;  5DY7 A;  4A9I A;  5JI8 A;  5H1T A;  2R0V A;  2I7K A;  5HRW A;  5CQ7 A;  4MEQ A;  5EWW A;  5HFQ A;  3IU5 A;  5EI4 A;  5COI A;  3MUK A;  5EVA A;  3U5M A;  5G4R A;  5E7D A;  5CUE A;  4BW1 A;  5A5R A;  3G0J A;  4HXN A;  5F25 A;  4NR9 A;  3O37 A;  4TU6 A;  4IR5 A;  1ZS5 A;  5EIS A;  2RS9 B;  5K29 A;  4QYD A;  4KV4 A;  4TS8 A;  4QSP A;  4IOO A;  3JVM A;  4LRG A;  5EP7 A;  4LR6 A;  5FH8 A;  5CQ4 A;  5I7X A;  5EQ1 A;  4QSX A;  4A9F A;  4QC3 A;  4LC2 A;  4QSR A;  5CRZ A;  4YAD A;  4CFL A;  2WP1 A;  2E7O A;  5DW2 A;  5C4Q A;  4WIV A;  5I1Q A;  4QSW A;  5BT5 A;  3O35 A;  4BW3 A;  1WUM A;  4IR6 A;  5E9V A;  4CUT A;  3UV4 A;  5I29 A;  5I40 A;  3NXB A;  2D82 A;  3UW9 A;  4N4F A;  5E9L A;  4HXM A;  5F2P A;  4NR4 A;  2E7N A;  2L85 A;  5H1V A;  4QBM A;  4TZ8 A;  1EQF A;  4YYI A;  4TT2 A;  4A9H A;  4YBM A;  2F6J A;  5CRM A;  4NRC A;  4N4H A;  4UYG A;  5E73 A;  3QZS A;  2DWW A;  5EPR A;  4HBX A;  4C66 A;  5AMF A;  4O71 A;  2DVQ A;  5F1L A;  1F68 A;  5FH6 A;  5ENH A;  3HMH A;  2N9G A;  5C8G A;  5CUC A;  5HEM A;  5EA1 A;  4YYG A;  4WHU A;  5IGN A;  5CUB A;  4CLB A;  3ONI A;  4A9M A;  2RI7 A;  5CQ3 A;  5I88 A;  4A9J A;  4GPJ A;  4AKN A;  5FE5 A;  3Q2E A;  4LZ2 A;  3IU6 A;  5F61 A;  5L96 A;  4QR3 A;  4A9N A;  5A81 A;  5AD3 A;  4O7A A;  1JM4 B;  1JSP B;  4XUA A;  5KTU A;  5FFV A;  5DBM A;  3QZT A;  4A9O A;  5L98 A;  4BJX A;  4UIT A;  4X2I A;  4A9L A;  5E9M A;  3P1E A;  5D3P A;  5EWV A;  4MR5 A;  5CU8 A;  2RNY A;  4N3W A;  5D24 A;  5I80 A;  4MR4 A;  3P5O A;  4NR7 A;  5FBX A;  5TB6 A;  4NR8 A;  5C7N A;  4O72 A;  2FSA A;  2KTB B;  5L8T A;  4YBT A;  4TU4 A;  4HBW A;  5CQ8 A;  4NR6 A;  5HM0 A;  4O7C A;  2WP2 A;  5A5P A;  2I8N A;  4IR4 A;  5BT4 A;  4OGI A;  5FE3 A;  4KV1 A;  5DW1 A;  4UIZ A;  2DVV A;  4J0S A;  4Z6I A;  5FE4 A;  5DX4 A;  4NUD A;  5C85 A;  5DFB A;  5JWM A;  4QR5 A;  3SVG A;  3AAD A;  5DYC A;  4IOR A;  2RFJ A;  5A85 A;  5AME A;  5ACY A;  4HBY A;  5LKT A;  5A5O A;  4HBV A;  4UIX A;  5DLZ A;  2DKW A;  5A82 A;  5I83 A;  5KU3 A;  4XY8 A;  3MXF A;  4LYI A;  5F62 A;  5EWH A;  5F36 A;  5LKX A;  5D3N A;  5LVR A;  5FE1 A;  5IBN A;  3SVH A;  5D3H A;  4PTB A;  5HLS A;  5ENC A;  4YY4 A;  4RVR A;  4UIU A;  5HCL A;  3QZV A;  2R0S A;  4J1P A;  5EIC A;  2YEM A;  5ENE A;  4NXJ A;  5KHM A;  3S92 A;  5CPE A;  4LZR A;  4NYV A;  5E74 A;  1N72 A;  5ENJ A;  4LDF A;  5HQ5 A;  5E9I A;  4HXS A;  4Q0N A;  5EGU A;  5D3T A;  4O76 A;  5CQ5 A;  4YY6 A;  4QB3 A;  5FFY A;  5LKU A;  4TTE A;  5I7Y A;  5D25 A;  4CUP A;  5LJ1 A;  4YAB A;  4QSQ A;  4YC9 A;  2RNX A;  5TCM A;  5KO4 A;  4NR5 A;  2MJV B;  4Z93 A;  5FE6 A;  2R10 A;  5CTL A;  4Z6H A;  4HXR A;  4YH3 A;  5I86 A;  5LJ2 A;  5LKZ A;  3LJW A;  3GG3 A;  2E3K A;  4A9K A;  2YYN A;  5CUG A;  5J0D A;  5EK9 A;  4LYS A;  5D3R A;  3SVF A;  5LUU A;  4ALG A;  4MR6 A;  4O75 A;  4QST A;  4YH4 A;  4YYJ A;  2YDW A;  5HRV A;  1WUG A;  3UV5 A;  5D3S A;  3LQI A;  5D3L A;  4UIY A;  5LVQ A;  4TT4 A;  3G0L A;  5A83 A;  4QR4 A;  1E6I A;  5L97 A;  4Z1S A;  4PKL A;  5AD2 A;  5FG6 A;  4UYF B;  2H60 A;  3O33 A;  2OSS A;  4TT6 A;  5HRX A;  5FE2 A;  3O34 A;  4QSV A;  2RNW A;  4PCE A;  3MB4 A;  4BW4 A;  4UYE A;  5ENG A;  5EV9 A;  5FH7 A;  5IGK A;  3JVJ A;  5D26 A;  5CQA A;  5FE7 A; 
#chains in the Genus database with same CATH topology
 5F63 A;  4IR3 A;  2D9E A;  4O77 A;  4C67 A;  5L8U A;  4HXO A;  4QSU A;  4TQN A;  4MEO A;  5G4S A;  5A7C A;  4PCI A;  4TZ2 A;  4QZS A;  5CP5 A;  5CFW A;  4N4G A;  4HXL A;  5KTW A;  5CGP A;  4DON A;  4UIV A;  4BHW A;  4YBS A;  2G4A A;  4CFK A;  2GRC A;  4AKG A;  5DYX A;  3HME A;  5II2 A;  3RCW A;  5IID A;  5H1U A;  4XYA A;  1ZKR A;  4UYF A;  5EU1 A;  5D0C A;  3U5P A;  4QNS A;  3P1F A;  3DAI A;  4O7B A;  4PY6 A;  4HXP A;  2YW5 A;  4KCX A;  4N4I A;  5C89 A;  5ENI A;  2L84 A;  4Z1Q A;  2OUO A;  2F6N A;  5ENF A;  4IOQ A;  3O36 A;  5DYU A;  1X0J A;  4YYD A;  3P1D A;  3Q2F A;  4YAT A;  5II1 A;  4BW2 A;  5HEL A;  4CL9 A;  4ZC9 A;  4QSS A;  5HQ6 A;  5FDZ A;  3UV2 A;  4O74 A;  4ALH A;  3MB3 A;  4NQM A;  4UYH A;  4O7E A;  5HJC A;  4O78 A;  4NUE A;  4XUB A;  5EM3 A;  5E3D A;  4CUU A;  4Y03 A;  5HFR A;  4MR3 A;  3U5J A;  5L99 A;  4A9E A;  5ETB A;  4NRB A;  2L5E A;  3ERR A;  4WHW A;  5DFC A;  4YK0 A;  5DKD A;  3U5L A;  3UVD A;  5EWC A;  3S91 A;  5CS8 A;  2YEK A;  3LQH A;  3ZYU A;  4CUR A;  3U5O A;  4O7F A;  4QEV A;  4NS5 A;  4F3I A;  4OUF A;  2EJN A;  3DWY A;  4LYW A;  4OGJ A;  5IGM A;  5FE8 A;  5DYA A;  5I89 A;  3U5K A;  3LQJ A;  5F5Z A;  5FE9 A;  3FKM X;  2LSP B;  5HEN A;  5E3G A;  3UVY A;  5D3J A;  5CZG A;  4Q0O A;  5KTX A;  5FB1 A;  5A5Q A;  5ETD A;  5F3A A;  4QEU A;  3JVK A;  4MEN A;  5EPB A;  4E96 A;  5HQ7 A;  4O70 A;  5DFD A;  5F1H A;  4QY4 A;  4PS5 A;  2RO1 A;  2R0Y A;  3AQA A;  3D7C A;  3MUL A;  4QUU A;  5DKC A;  5FG4 A;  5FG5 A;  5A5N A;  5CUA A;  4CUS A;  4UIW A;  5CQT A;  4QUT A;  5DKH A;  4YAX A;  4QYL A;  5LJ0 A;  4YYM A;  4XY9 A;  5E0R A;  5C87 A;  4MEP A;  4YYH A;  3TLP A;  2NXB A;  4NRA A;  4YYK A;  5F60 A;  4QC1 A;  4QEW A;  3K2J A;  5IGL A;  3LXJ A;  5E9K A;  2DVR A;  2DAT A;  2OO1 A;  5EPS A;  4HXK A;  5H85 A;  5A5S A;  5EWD A;  5ENB A;  4NQN A;  3HMF A;  4ZQL A;  4ZW1 A;  3UVX A;  5CY9 A;  4NUC A;  4YYN A;  5IG6 A;  5BT3 A;  3D1D A;  4FLP A;  5CQ6 A;  5DLX A;  5FFW A;  3I3J A;  4J3I A;  3U5N A;  4NYX A;  4LZS A;  3MQM A;  4TYL A;  5FB0 A;  2DVS A;  3P1C A;  5D7X A;  5CUD A;  4CUQ A;  5FE0 A;  2YQD A;  4NYW A;  4UYD A;  5E9Y A;  2YEL A;  3JVL A;  3UVW A;  4J0R A;  5DY7 A;  4A9I A;  5JI8 A;  5H1T A;  2R0V A;  2I7K A;  5HRW A;  5CQ7 A;  4MEQ A;  5EWW A;  5HFQ A;  3IU5 A;  5EI4 A;  5COI A;  3MUK A;  5EVA A;  3U5M A;  5G4R A;  5E7D A;  5CUE A;  4BW1 A;  5A5R A;  3G0J A;  4HXN A;  5F25 A;  4NR9 A;  3O37 A;  4TU6 A;  4IR5 A;  1ZS5 A;  5EIS A;  2RS9 B;  5K29 A;  4QYD A;  4KV4 A;  4TS8 A;  4QSP A;  4IOO A;  3JVM A;  4LRG A;  5EP7 A;  4LR6 A;  5FH8 A;  5CQ4 A;  5I7X A;  4AKI A;  5EQ1 A;  4QSX A;  4A9F A;  4QC3 A;  4LC2 A;  4QSR A;  5CRZ A;  4AI6 A;  4YAD A;  4CFL A;  2WP1 A;  2E7O A;  5DW2 A;  5C4Q A;  4WIV A;  5I1Q A;  4QSW A;  5BT5 A;  3O35 A;  4BW3 A;  1WUM A;  4IR6 A;  5E9V A;  4CUT A;  3UV4 A;  5I29 A;  5I40 A;  3NXB A;  2D82 A;  3UW9 A;  4N4F A;  5E9L A;  4HXM A;  5F2P A;  4NR4 A;  2E7N A;  2L85 A;  5H1V A;  4QBM A;  4TZ8 A;  1EQF A;  4YYI A;  4TT2 A;  4A9H A;  4YBM A;  2F6J A;  5CRM A;  3D1B A;  4NRC A;  4N4H A;  4UYG A;  5E73 A;  3QZS A;  2DWW A;  5EPR A;  4HBX A;  4C66 A;  5AMF A;  4O71 A;  2DVQ A;  5F1L A;  1F68 A;  5FH6 A;  5ENH A;  3HMH A;  2N9G A;  5C8G A;  5CUC A;  5HEM A;  5EA1 A;  4YYG A;  4WHU A;  5IGN A;  5CUB A;  4CLB A;  3ONI A;  4A9M A;  2RI7 A;  5CQ3 A;  5I88 A;  4A9J A;  4GPJ A;  4AKN A;  5FE5 A;  3Q2E A;  4LZ2 A;  3IU6 A;  5F61 A;  5L96 A;  4QR3 A;  4A9N A;  5A81 A;  5AD3 A;  4O7A A;  1JM4 B;  1JSP B;  4XUA A;  5KTU A;  5FFV A;  5DBM A;  3QZT A;  4A9O A;  5L98 A;  4BJX A;  4UIT A;  4X2I A;  1PUO A;  4A9L A;  5E9M A;  3P1E A;  5D3P A;  5EWV A;  4MR5 A;  5CU8 A;  3VKH A;  2RNY A;  4N3W A;  5D24 A;  5I80 A;  4MR4 A;  3P5O A;  4NR7 A;  5FBX A;  5TB6 A;  4NR8 A;  5C7N A;  4O72 A;  2FSA A;  2KTB B;  5L8T A;  4YBT A;  4TU4 A;  4HBW A;  5CQ8 A;  4NR6 A;  5HM0 A;  4O7C A;  2WP2 A;  5A5P A;  2I8N A;  4IR4 A;  5BT4 A;  4OGI A;  5FE3 A;  4KV1 A;  5DW1 A;  4UIZ A;  2DVV A;  4J0S A;  4Z6I A;  5FE4 A;  5DX4 A;  4NUD A;  5C85 A;  5DFB A;  5JWM A;  4QR5 A;  3SVG A;  3AAD A;  5DYC A;  4IOR A;  2RFJ A;  5A85 A;  5AME A;  5ACY A;  4HBY A;  5LKT A;  5A5O A;  4HBV A;  4UIX A;  5DLZ A;  2DKW A;  5A82 A;  5I83 A;  5KU3 A;  4XY8 A;  3MXF A;  4LYI A;  5F62 A;  5EWH A;  5F36 A;  5LKX A;  5D3N A;  5LVR A;  5FE1 A;  5IBN A;  3SVH A;  5D3H A;  4PTB A;  5HLS A;  5ENC A;  4YY4 A;  4RVR A;  4UIU A;  5HCL A;  3QZV A;  2R0S A;  4J1P A;  5EIC A;  2YEM A;  5ENE A;  4NXJ A;  5KHM A;  3S92 A;  5CPE A;  4LZR A;  4NYV A;  5E74 A;  1N72 A;  5ENJ A;  4LDF A;  5HQ5 A;  5E9I A;  4HXS A;  4Q0N A;  5EGU A;  5D3T A;  4O76 A;  5CQ5 A;  4YY6 A;  4QB3 A;  5FFY A;  5LKU A;  4TTE A;  5I7Y A;  5D25 A;  4CUP A;  5LJ1 A;  4YAB A;  4QSQ A;  4YC9 A;  2RNX A;  5TCM A;  4AKH A;  5KO4 A;  4NR5 A;  2MJV B;  4Z93 A;  5FE6 A;  2R10 A;  5CTL A;  4Z6H A;  4HXR A;  4YH3 A;  5I86 A;  5LJ2 A;  5LKZ A;  3LJW A;  3GG3 A;  2E3K A;  4A9K A;  2YYN A;  5CUG A;  5J0D A;  5EK9 A;  4LYS A;  5D3R A;  3SVF A;  5LUU A;  4ALG A;  4MR6 A;  4O75 A;  4QST A;  4YH4 A;  4YYJ A;  2YDW A;  5HRV A;  1WUG A;  3UV5 A;  5D3S A;  3LQI A;  5D3L A;  4UIY A;  5LVQ A;  4TT4 A;  3G0L A;  5A83 A;  4QR4 A;  1E6I A;  5L97 A;  4Z1S A;  4PKL A;  5AD2 A;  5FG6 A;  4UYF B;  2H60 A;  3O33 A;  3VKG A;  2OSS A;  4TT6 A;  5HRX A;  5FE2 A;  3O34 A;  4QSV A;  2RNW A;  4PCE A;  3MB4 A;  4BW4 A;  4UYE A;  5ENG A;  5EV9 A;  5FH7 A;  5IGK A;  3JVJ A;  5D26 A;  5CQA A;  5FE7 A; 
#chains in the Genus database with same CATH homology
 5F63 A;  4IR3 A;  2D9E A;  4O77 A;  4C67 A;  5L8U A;  4HXO A;  4QSU A;  4TQN A;  4MEO A;  5G4S A;  5A7C A;  4PCI A;  4TZ2 A;  4QZS A;  5CP5 A;  5CFW A;  4N4G A;  4HXL A;  5KTW A;  5CGP A;  4DON A;  4UIV A;  4BHW A;  4YBS A;  2G4A A;  4CFK A;  2GRC A;  5DYX A;  3HME A;  5II2 A;  3RCW A;  5IID A;  5H1U A;  4XYA A;  4UYF A;  5EU1 A;  5D0C A;  3U5P A;  4QNS A;  3P1F A;  3DAI A;  4O7B A;  4PY6 A;  4HXP A;  2YW5 A;  4KCX A;  4N4I A;  5C89 A;  5ENI A;  2L84 A;  4Z1Q A;  2OUO A;  2F6N A;  5ENF A;  4IOQ A;  3O36 A;  5DYU A;  1X0J A;  4YYD A;  3P1D A;  3Q2F A;  4YAT A;  5II1 A;  4BW2 A;  5HEL A;  4CL9 A;  4ZC9 A;  4QSS A;  5HQ6 A;  5FDZ A;  3UV2 A;  4O74 A;  4ALH A;  3MB3 A;  4NQM A;  4UYH A;  4O7E A;  5HJC A;  4O78 A;  4NUE A;  4XUB A;  5EM3 A;  5E3D A;  4CUU A;  4Y03 A;  5HFR A;  4MR3 A;  3U5J A;  5L99 A;  4A9E A;  5ETB A;  4NRB A;  2L5E A;  4WHW A;  5DFC A;  4YK0 A;  5DKD A;  3U5L A;  3UVD A;  5EWC A;  3S91 A;  5CS8 A;  2YEK A;  3LQH A;  3ZYU A;  4CUR A;  3U5O A;  4O7F A;  4QEV A;  4NS5 A;  4F3I A;  4OUF A;  3DWY A;  4LYW A;  4OGJ A;  5IGM A;  5FE8 A;  5DYA A;  5I89 A;  3U5K A;  3LQJ A;  5F5Z A;  5FE9 A;  3FKM X;  2LSP B;  5HEN A;  5E3G A;  3UVY A;  5D3J A;  5CZG A;  4Q0O A;  5KTX A;  5FB1 A;  5A5Q A;  5ETD A;  5F3A A;  4QEU A;  3JVK A;  4MEN A;  5EPB A;  4E96 A;  5HQ7 A;  4O70 A;  5DFD A;  5F1H A;  4QY4 A;  4PS5 A;  2RO1 A;  2R0Y A;  3AQA A;  3D7C A;  3MUL A;  4QUU A;  5DKC A;  5FG4 A;  5FG5 A;  5A5N A;  5CUA A;  4CUS A;  4UIW A;  5CQT A;  4QUT A;  5DKH A;  4YAX A;  4QYL A;  5LJ0 A;  4YYM A;  4XY9 A;  5E0R A;  5C87 A;  4MEP A;  4YYH A;  3TLP A;  2NXB A;  4NRA A;  4YYK A;  5F60 A;  4QC1 A;  4QEW A;  3K2J A;  5IGL A;  3LXJ A;  5E9K A;  2DVR A;  2DAT A;  2OO1 A;  5EPS A;  4HXK A;  5H85 A;  5A5S A;  5EWD A;  5ENB A;  4NQN A;  3HMF A;  4ZQL A;  4ZW1 A;  3UVX A;  5CY9 A;  4NUC A;  4YYN A;  5IG6 A;  5BT3 A;  4FLP A;  5CQ6 A;  5DLX A;  5FFW A;  3I3J A;  4J3I A;  3U5N A;  4NYX A;  4LZS A;  3MQM A;  4TYL A;  5FB0 A;  2DVS A;  3P1C A;  5D7X A;  5CUD A;  4CUQ A;  5FE0 A;  2YQD A;  4NYW A;  4UYD A;  5E9Y A;  2YEL A;  3JVL A;  3UVW A;  4J0R A;  5DY7 A;  4A9I A;  5JI8 A;  5H1T A;  2R0V A;  2I7K A;  5HRW A;  5CQ7 A;  4MEQ A;  5EWW A;  5HFQ A;  3IU5 A;  5EI4 A;  5COI A;  3MUK A;  5EVA A;  3U5M A;  5G4R A;  5E7D A;  5CUE A;  4BW1 A;  5A5R A;  3G0J A;  4HXN A;  5F25 A;  4NR9 A;  3O37 A;  4TU6 A;  4IR5 A;  1ZS5 A;  5EIS A;  2RS9 B;  5K29 A;  4QYD A;  4KV4 A;  4TS8 A;  4QSP A;  4IOO A;  3JVM A;  4LRG A;  5EP7 A;  4LR6 A;  5FH8 A;  5CQ4 A;  5I7X A;  5EQ1 A;  4QSX A;  4A9F A;  4QC3 A;  4LC2 A;  4QSR A;  5CRZ A;  4YAD A;  4CFL A;  2WP1 A;  2E7O A;  5DW2 A;  5C4Q A;  4WIV A;  5I1Q A;  4QSW A;  5BT5 A;  3O35 A;  4BW3 A;  1WUM A;  4IR6 A;  5E9V A;  4CUT A;  3UV4 A;  5I29 A;  5I40 A;  3NXB A;  2D82 A;  3UW9 A;  4N4F A;  5E9L A;  4HXM A;  5F2P A;  4NR4 A;  2E7N A;  2L85 A;  5H1V A;  4QBM A;  4TZ8 A;  1EQF A;  4YYI A;  4TT2 A;  4A9H A;  4YBM A;  2F6J A;  5CRM A;  4NRC A;  4N4H A;  4UYG A;  5E73 A;  3QZS A;  2DWW A;  5EPR A;  4HBX A;  4C66 A;  5AMF A;  4O71 A;  2DVQ A;  5F1L A;  1F68 A;  5FH6 A;  5ENH A;  3HMH A;  2N9G A;  5C8G A;  5CUC A;  5HEM A;  5EA1 A;  4YYG A;  4WHU A;  5IGN A;  5CUB A;  4CLB A;  3ONI A;  4A9M A;  2RI7 A;  5CQ3 A;  5I88 A;  4A9J A;  4GPJ A;  4AKN A;  5FE5 A;  3Q2E A;  4LZ2 A;  3IU6 A;  5F61 A;  5L96 A;  4QR3 A;  4A9N A;  5A81 A;  5AD3 A;  4O7A A;  1JM4 B;  1JSP B;  4XUA A;  5KTU A;  5FFV A;  5DBM A;  3QZT A;  4A9O A;  5L98 A;  4BJX A;  4UIT A;  4X2I A;  4A9L A;  5E9M A;  3P1E A;  5D3P A;  5EWV A;  4MR5 A;  5CU8 A;  2RNY A;  4N3W A;  5D24 A;  5I80 A;  4MR4 A;  3P5O A;  4NR7 A;  5FBX A;  5TB6 A;  4NR8 A;  5C7N A;  4O72 A;  2FSA A;  2KTB B;  5L8T A;  4YBT A;  4TU4 A;  4HBW A;  5CQ8 A;  4NR6 A;  5HM0 A;  4O7C A;  2WP2 A;  5A5P A;  2I8N A;  4IR4 A;  5BT4 A;  4OGI A;  5FE3 A;  4KV1 A;  5DW1 A;  4UIZ A;  2DVV A;  4J0S A;  4Z6I A;  5FE4 A;  5DX4 A;  4NUD A;  5C85 A;  5DFB A;  5JWM A;  4QR5 A;  3SVG A;  3AAD A;  5DYC A;  4IOR A;  2RFJ A;  5A85 A;  5AME A;  5ACY A;  4HBY A;  5LKT A;  5A5O A;  4HBV A;  4UIX A;  5DLZ A;  2DKW A;  5A82 A;  5I83 A;  5KU3 A;  4XY8 A;  3MXF A;  4LYI A;  5F62 A;  5EWH A;  5F36 A;  5LKX A;  5D3N A;  5LVR A;  5FE1 A;  5IBN A;  3SVH A;  5D3H A;  4PTB A;  5HLS A;  5ENC A;  4YY4 A;  4RVR A;  4UIU A;  5HCL A;  3QZV A;  2R0S A;  4J1P A;  5EIC A;  2YEM A;  5ENE A;  4NXJ A;  5KHM A;  3S92 A;  5CPE A;  4LZR A;  4NYV A;  5E74 A;  1N72 A;  5ENJ A;  4LDF A;  5HQ5 A;  5E9I A;  4HXS A;  4Q0N A;  5EGU A;  5D3T A;  4O76 A;  5CQ5 A;  4YY6 A;  4QB3 A;  5FFY A;  5LKU A;  4TTE A;  5I7Y A;  5D25 A;  4CUP A;  5LJ1 A;  4YAB A;  4QSQ A;  4YC9 A;  2RNX A;  5TCM A;  5KO4 A;  4NR5 A;  2MJV B;  4Z93 A;  5FE6 A;  2R10 A;  5CTL A;  4Z6H A;  4HXR A;  4YH3 A;  5I86 A;  5LJ2 A;  5LKZ A;  3LJW A;  3GG3 A;  2E3K A;  4A9K A;  2YYN A;  5CUG A;  5J0D A;  5EK9 A;  4LYS A;  5D3R A;  3SVF A;  5LUU A;  4ALG A;  4MR6 A;  4O75 A;  4QST A;  4YH4 A;  4YYJ A;  2YDW A;  5HRV A;  1WUG A;  3UV5 A;  5D3S A;  3LQI A;  5D3L A;  4UIY A;  5LVQ A;  4TT4 A;  3G0L A;  5A83 A;  4QR4 A;  1E6I A;  5L97 A;  4Z1S A;  4PKL A;  5AD2 A;  5FG6 A;  4UYF B;  2H60 A;  3O33 A;  2OSS A;  4TT6 A;  5HRX A;  5FE2 A;  3O34 A;  4QSV A;  2RNW A;  4PCE A;  3MB4 A;  4BW4 A;  4UYE A;  5ENG A;  5EV9 A;  5FH7 A;  5IGK A;  3JVJ A;  5D26 A;  5CQA A;  5FE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...