3HMHA

Crystal structure of the second bromodomain of human tbp-associated factor rna polymerase 1-like (taf1l)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
139
structure length
139
Chain Sequence
GTENLYFQSMQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTAKEAALEEAELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID 210 kDa subunit
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 57
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3hmhA00
5DFCA 3D7CA 5ENHA 4TU4A 4LC2A 4QR5A 5HRWA 4TT4A 4MEQA 4O71A 5FE2A 5CQ6A 2G4AA 4BHWA 5H1TA 5IGMA 4Q0OA 5KHMA 5L98A 4TT2A 4YBMA 5IGLA 4YADA 5EQ1A 4NR4A 4UIVA 3UV4A 4IOQA 5EICA 5KTWA 3G0JA 5DYCA 3P1EA 4BW2A 5I1QA 5CY9A 4CUUA 3UVWA 5E9LA 4MEPA 4A9JA 4QC1A 5FG5A 5EU1A 5FG6A 4HBWA 3QZTA 1E6IA 4TQNA 1F68A 4YYDA 4O74A 5EWVA 5HENA 4QSVA 4ALGA 4CUPA 5DKCA 4UYFA 4QUUA 5EWCA 5FH8A 5DKDA 4BW4A 4PCIA 4NQNA 3JVKA 2FSAA 4UIYA 5EWWA 5CQ4A 5E9YA 5F63A 4QSXA 4N3WA 2DWWA 5HELA 5E74A 5TCMA 3HMEA 5F62A 2E7NA 4UIZA 3UVDA 5ETBA 3IU5A 5CQ8A 4OUFA 3DWYA 5FDZA 5D3PA 4PTBA 2WP2A 3O35A 3UV5A 5L8UA 4QBMA 5A83A 5DYAA 4LYIA 3P1FA 4LZSA 5D3RA 2I8NA 4MR3A 5C89A 5A5NA 4CFKA 3U5JA 4YYMA 5CU8A 5EK9A 5EWDA 5HM0A 5C4QA 4KV4A 4QSRA 5FB1A 5G4SA 4Z6HA 5FE7A 1JM4B 5EPRA 3LQHA 4HXNA 5D3JA 5G4RA 4J1PA 4J3IA 5LKXA 5FH7A 2RS9B 4LDFA 2L5EA 4BW1A 4NQMA 5L96A 5CUBA 4YBSA 4IOOA 4HXRA 5DW1A 4LZ2A 5I29A 4Q0NA 3NXBA 4YYIA 5A5OA 4QSUA 4TU6A 2YDWA 4A9MA 5FBXA 2YELA 5CZGA 5EPBA 3DAIA 5HFRA 5I40A 3MB4A 5E9KA 3MUKA 4NYVA 5FE4A 4CURA 2OO1A 4HXPA 5COIA 5D3LA 2OSSA 4QSWA 5F61A 4A9LA 3MULA 2H60A 4IR5A 4TYLA 5I7XA 5H85A 3ZYUA 4QYDA 2F6NA 2RNXA 5ENBA 1EQFA 4TZ2A 4PS5A 5KU3A 4TS8A 5EGUA 4ZW1A 4C66A 5FH6A 3P5OA 5DBMA 4A9OA 4A9KA 4YH3A 4A9HA 4UYHA 3U5KA 5A82A 5L97A 5I83A 4AKNA 1WUGA 5E73A 1WUMA 4NS5A 5TB6A 5HFQA 4QZSA 2DVRA 4Z93A 5JWMA 2OUOA 2WP1A 4IORA 4OGIA 5CS8A 4QNSA 3MQMA 5LVRA 5DYUA 3Q2EA 5D7XA 2KTBB 5LKTA 3RCWA 5HQ7A 3SVFA 3UW9A 3U5PA 4CUTA 4N4GA 5F2PA 2R0YA 5EVAA 2DKWA 5H1VA 5IGNA 5LUUA 1JSPB 4NR8A 5CPEA 5BT3A 4C67A 4NRAA 5DY7A 5E9MA 4ZQLA 4O7EA 5LJ2A 5HQ6A 5C8GA 4IR3A 4O7AA 4PCEA 2YW5A 4QYLA 4O7BA 5HLSA 3U5NA 2I7KA 2RNYA 3I3JA 4NXJA 5CUGA 3JVMA 4NR7A 3P1CA 4NUEA 4IR4A 4HXSA 5CFWA 3K2JA 3HMFA 2DVSA 3G0LA 3IU6A 4LZRA 5DYXA 2LSPB 4BJXA 4YC9A 3O36A 5IGKA 5FFWA 4YY6A 4ALHA 4QEUA 5LJ0A 5F5ZA 5E0RA 4UYDA 4O70A 5DLXA 5FE0A 5HQ5A 5D0CA 5DX4A 4J0SA 2GRCA 5IG6A 4LYWA 4XYAA 2F6JA 5CP5A 4QSPA 5ENEA 5BT5A 4QSQA 3SVHA 3GG3A 4YY4A 4WHUA 4IR6A 5IIDA 4HXOA 5F25A 1N72A 4YABA 4UYEA 4NYXA 5ETDA 2R0SA 5C87A 4UIXA 4N4IA 4BW3A 2DVVA 5J0DA 3AQAA 5CUEA 4O7FA 2YYNA 4XUBA 5C85A 2N9GA 4UITA 4QC3A 5HJCA 4XY9A 4N4FA 5LKZA 4HXLA 5I88A 4HBXA 4HXKA 5FFYA 4A9FA 2D82A 5F60A 2D9EA 5ENCA 5FE9A 5I7YA 4UIUA 3JVLA 4WIVA 3LXJA 3O37A 2RNWA 2YEKA 4LR6A 5CUAA 5CQ3A 3ONIA 4RVRA 4QR4A 5FFVA 2YEMA 4YATA 3O34A 5LKUA 3HMHA 5A5SA 5HRXA 2L85A 5CUCA 3LQIA 5DW2A 3UV2A 5EV9A 2RO1A 5FG4A 4MENA 4J0RA 4OGJA 5KTXA 5AD2A 5DFDA 5FE1A 5A5QA 5HCLA 3TLPA 5EPSA 2YQDA 4F3IA 5F1HA 5E7DA 4O75A 4X2IA 5KTUA 4NR5A 4CL9A 4PY6A 4MR4A 4O72A 5EI4A 3UVXA 4YYNA 5C7NA 3MXFA 5F36A 5H1UA 4YYJA 3S92A 5CUDA 4TZ8A 5D25A 4O77A 4N4HA 5FE5A 5CRZA 3MB3A 2RFJA 3QZSA 5BT4A 5CQTA 4NUCA 5IBNA 3SVGA 2DATA 5KO4A 3S91A 5ACYA 5AMFA 4NRBA 4YYKA 4DONA 4QB3A 5E3DA 5II2A 2MJVB 3AADA 5EA1A 5D3NA 4QR3A 3LJWA 3QZVA 5I86A 3JVJA 4TT6A 5EWHA 2E3KA 4XY8A 5CTLA 5EM3A 5CQ7A 5D3HA 5DLZA 4NR9A 4LYSA 5E3GA 5CGPA 5I89A 2E7OA 4NR6A 4CUSA 4UYGA 4XUAA 3U5LA 4YK0A 4MR6A 4QEWA 4Z6IA 5E9IA 3LQJA 5AD3A 5EP7A 4MEOA 4TTEA 5JI8A 5ENGA 5L8TA 3FKMX 5E9VA 5I80A 5ENFA 4WHWA 5F3AA 4NRCA 5D3SA 5CQAA 4Z1QA 2R0VA 4YAXA 5AMEA 5ENJA 3U5MA 4O7CA 5A5RA 4A9IA 4E96A 4KV1A 5D3TA 2DVQA 4HBVA 5D26A 1X0JA 4QSSA 5D24A 5DFBA 4HXMA 5FB0A 5A7CA 5FE3A 5HRVA 5A85A 4UIWA 4HBYA 4Z1SA 2RI7A 4QY4A 3O33A 4YH4A 5F1LA 5FE6A 4LRGA 4YYGA 3U5OA 4QEVA 4YYHA 3P1DA 4A9NA 5CRMA 5L99A 4QUTA 5CQ5A 4A9EA 4UYFB 4O76A 3Q2FA 5A5PA 5FE8A 5DKHA 4PKLA 4KCXA 4NUDA 2L84A 4YBTA 5LJ1A 5II1A 2NXBA 4ZC9A 4QSTA 4FLPA 4CUQA 5EISA 5A81A 4Y03A 4CLBA 1ZS5A 4GPJA 4MR5A 4O78A 2R10A 5K29A 5LVQA 3UVYA 4CFLA 4NYWA 5HEMA 5ENIA
chains in the Genus database with same CATH superfamily
5DFCA 3D7CA 3D1BA 5ENHA 4TU4A 4LC2A 4QR5A 5HRWA 4TT4A 4MEQA 4O71A 5FE2A 5CQ6A 2G4AA 4BHWA 3D1DA 5H1TA 5IGMA 4Q0OA 5KHMA 5L98A 4TT2A 1PUOA 4YBMA 5IGLA 4YADA 5EQ1A 4NR4A 4UIVA 3UV4A 4IOQA 5EICA 5KTWA 3G0JA 5DYCA 3P1EA 4BW2A 5I1QA 5CY9A 4CUUA 3UVWA 5E9LA 4MEPA 4A9JA 4QC1A 5FG5A 5EU1A 5FG6A 4HBWA 3QZTA 1E6IA 4TQNA 1F68A 4YYDA 4O74A 5EWVA 5HENA 4QSVA 4ALGA 4CUPA 5DKCA 4UYFA 4QUUA 5EWCA 5FH8A 5DKDA 4BW4A 4PCIA 4NQNA 3JVKA 2FSAA 4UIYA 5EWWA 5CQ4A 5E9YA 5F63A 4QSXA 4N3WA 2DWWA 5HELA 5E74A 5TCMA 3HMEA 5F62A 2E7NA 4UIZA 3UVDA 5ETBA 3IU5A 5CQ8A 4OUFA 3DWYA 5FDZA 5D3PA 4PTBA 2WP2A 3O35A 3UV5A 5L8UA 4QBMA 5A83A 5DYAA 3ERRA 4LYIA 3P1FA 4LZSA 5D3RA 2I8NA 4MR3A 5C89A 5A5NA 4CFKA 3U5JA 4YYMA 5CU8A 5EK9A 1ZKRA 5EWDA 5HM0A 5C4QA 4KV4A 4QSRA 5FB1A 5G4SA 4Z6HA 5FE7A 1JM4B 5EPRA 3LQHA 3VKGA 4HXNA 5D3JA 5G4RA 4J1PA 4J3IA 5LKXA 5FH7A 2RS9B 4LDFA 2L5EA 4BW1A 4NQMA 5L96A 5CUBA 4YBSA 4IOOA 4HXRA 5DW1A 4LZ2A 5I29A 4Q0NA 3NXBA 4YYIA 5A5OA 4QSUA 4TU6A 2YDWA 4A9MA 5FBXA 2YELA 5CZGA 5EPBA 3DAIA 5HFRA 5I40A 3MB4A 5E9KA 3MUKA 4NYVA 5FE4A 4CURA 2OO1A 4HXPA 5COIA 5D3LA 2OSSA 4QSWA 5F61A 4A9LA 3MULA 2H60A 4IR5A 4TYLA 5I7XA 5H85A 3ZYUA 4QYDA 2F6NA 2RNXA 5ENBA 1EQFA 4TZ2A 4PS5A 5KU3A 4TS8A 5EGUA 4ZW1A 4C66A 5FH6A 3P5OA 5DBMA 4A9OA 4A9KA 4YH3A 4A9HA 4UYHA 3U5KA 5A82A 5L97A 5I83A 4AKNA 1WUGA 5E73A 1WUMA 4NS5A 5TB6A 5HFQA 4QZSA 2DVRA 4Z93A 5JWMA 2OUOA 2WP1A 4IORA 4OGIA 5CS8A 4QNSA 3MQMA 5LVRA 5DYUA 3Q2EA 5D7XA 4AKIA 2KTBB 5LKTA 3RCWA 5HQ7A 3SVFA 3UW9A 3U5PA 4CUTA 4N4GA 5F2PA 2R0YA 5EVAA 2DKWA 5H1VA 5IGNA 5LUUA 1JSPB 4NR8A 5CPEA 5BT3A 4C67A 4NRAA 5DY7A 5E9MA 4ZQLA 4O7EA 5LJ2A 5HQ6A 5C8GA 4IR3A 4O7AA 4PCEA 2YW5A 4QYLA 4O7BA 5HLSA 3U5NA 2I7KA 2RNYA 3I3JA 4NXJA 5CUGA 3JVMA 4NR7A 3P1CA 4NUEA 4IR4A 4HXSA 5CFWA 3K2JA 3HMFA 2DVSA 3G0LA 3IU6A 4LZRA 5DYXA 2LSPB 4AKHA 4BJXA 4YC9A 3O36A 5IGKA 5FFWA 4YY6A 4ALHA 4QEUA 5LJ0A 5F5ZA 5E0RA 4UYDA 4O70A 5DLXA 5FE0A 5HQ5A 5D0CA 5DX4A 4J0SA 2GRCA 5IG6A 4LYWA 4XYAA 4AI6A 2F6JA 5CP5A 4QSPA 5ENEA 5BT5A 4QSQA 3SVHA 3GG3A 4YY4A 4WHUA 4IR6A 5IIDA 4HXOA 5F25A 1N72A 4YABA 4UYEA 4NYXA 5ETDA 2R0SA 5C87A 4UIXA 4N4IA 4BW3A 2DVVA 5J0DA 3AQAA 5CUEA 4O7FA 2YYNA 4XUBA 5C85A 2N9GA 4UITA 4QC3A 5HJCA 4XY9A 4N4FA 5LKZA 4HXLA 5I88A 4HBXA 4HXKA 5FFYA 4A9FA 2D82A 5F60A 2D9EA 5ENCA 5FE9A 5I7YA 4UIUA 3JVLA 4WIVA 3LXJA 3O37A 2RNWA 2YEKA 4LR6A 5CUAA 5CQ3A 3ONIA 4RVRA 4QR4A 5FFVA 2YEMA 4YATA 3O34A 5LKUA 3HMHA 5A5SA 5HRXA 2L85A 5CUCA 3LQIA 5DW2A 3UV2A 5EV9A 2RO1A 5FG4A 4MENA 4J0RA 4OGJA 5KTXA 5AD2A 5DFDA 5FE1A 5A5QA 5HCLA 3TLPA 5EPSA 2YQDA 4F3IA 5F1HA 5E7DA 4O75A 4X2IA 5KTUA 4NR5A 4CL9A 4PY6A 4MR4A 4O72A 5EI4A 3UVXA 4YYNA 5C7NA 3MXFA 5F36A 5H1UA 4YYJA 3S92A 5CUDA 4TZ8A 5D25A 4AKGA 4O77A 4N4HA 5FE5A 5CRZA 3MB3A 2RFJA 3QZSA 5BT4A 5CQTA 4NUCA 5IBNA 3SVGA 2DATA 5KO4A 3S91A 5ACYA 5AMFA 4NRBA 4YYKA 4DONA 4QB3A 5E3DA 5II2A 2MJVB 3AADA 5EA1A 5D3NA 4QR3A 3LJWA 3QZVA 5I86A 3JVJA 4TT6A 5EWHA 2E3KA 4XY8A 5CTLA 5EM3A 5CQ7A 5D3HA 5DLZA 4NR9A 4LYSA 5E3GA 5CGPA 5I89A 2E7OA 4NR6A 4CUSA 4UYGA 4XUAA 3U5LA 4YK0A 4MR6A 4QEWA 4Z6IA 5E9IA 3LQJA 5AD3A 3VKHA 5EP7A 4MEOA 4TTEA 5JI8A 5ENGA 5L8TA 3FKMX 5E9VA 5I80A 2EJNA 5ENFA 4WHWA 5F3AA 4NRCA 5D3SA 5CQAA 4Z1QA 2R0VA 4YAXA 5AMEA 5ENJA 3U5MA 4O7CA 5A5RA 4A9IA 4E96A 4KV1A 5D3TA 2DVQA 4HBVA 5D26A 1X0JA 4QSSA 5D24A 5DFBA 4HXMA 5FB0A 5A7CA 5FE3A 5HRVA 5A85A 4UIWA 4HBYA 4Z1SA 2RI7A 4QY4A 3O33A 4YH4A 5F1LA 5FE6A 4LRGA 4YYGA 3U5OA 4QEVA 4YYHA 3P1DA 4A9NA 5CRMA 5L99A 4QUTA 5CQ5A 4A9EA 4UYFB 4O76A 3Q2FA 5A5PA 5FE8A 5DKHA 4PKLA 4KCXA 4NUDA 2L84A 4YBTA 5LJ1A 5II1A 2NXBA 4ZC9A 4QSTA 4FLPA 4CUQA 5EISA 5A81A 4Y03A 4CLBA 1ZS5A 4GPJA 4MR5A 4O78A 2R10A 5K29A 5LVQA 3UVYA 4CFLA 4NYWA 5HEMA 5ENIA
chains in the Genus database with same CATH topology
5DFCA 3D7CA 5ENHA 4TU4A 4LC2A 4QR5A 5HRWA 4TT4A 4MEQA 4O71A 5FE2A 5CQ6A 2G4AA 4BHWA 5H1TA 5IGMA 4Q0OA 5KHMA 5L98A 4TT2A 4YBMA 5IGLA 4YADA 5EQ1A 4NR4A 4UIVA 3UV4A 4IOQA 5EICA 5KTWA 3G0JA 5DYCA 3P1EA 4BW2A 5I1QA 5CY9A 4CUUA 3UVWA 5E9LA 4MEPA 4A9JA 4QC1A 5FG5A 5EU1A 5FG6A 4HBWA 3QZTA 1E6IA 4TQNA 1F68A 4YYDA 4O74A 5EWVA 5HENA 4QSVA 4ALGA 4CUPA 5DKCA 4UYFA 4QUUA 5EWCA 5FH8A 5DKDA 4BW4A 4PCIA 4NQNA 3JVKA 2FSAA 4UIYA 5EWWA 5CQ4A 5E9YA 5F63A 4QSXA 4N3WA 2DWWA 5HELA 5E74A 5TCMA 3HMEA 5F62A 2E7NA 4UIZA 3UVDA 5ETBA 3IU5A 5CQ8A 4OUFA 3DWYA 5FDZA 5D3PA 4PTBA 2WP2A 3O35A 3UV5A 5L8UA 4QBMA 5A83A 5DYAA 4LYIA 3P1FA 4LZSA 5D3RA 2I8NA 4MR3A 5C89A 5A5NA 4CFKA 3U5JA 4YYMA 5CU8A 5EK9A 5EWDA 5HM0A 5C4QA 4KV4A 4QSRA 5FB1A 5G4SA 4Z6HA 5FE7A 1JM4B 5EPRA 3LQHA 4HXNA 5D3JA 5G4RA 4J1PA 4J3IA 5LKXA 5FH7A 2RS9B 4LDFA 2L5EA 4BW1A 4NQMA 5L96A 5CUBA 4YBSA 4IOOA 4HXRA 5DW1A 4LZ2A 5I29A 4Q0NA 3NXBA 4YYIA 5A5OA 4QSUA 4TU6A 2YDWA 4A9MA 5FBXA 2YELA 5CZGA 5EPBA 3DAIA 5HFRA 5I40A 3MB4A 5E9KA 3MUKA 4NYVA 5FE4A 4CURA 2OO1A 4HXPA 5COIA 5D3LA 2OSSA 4QSWA 5F61A 4A9LA 3MULA 2H60A 4IR5A 4TYLA 5I7XA 5H85A 3ZYUA 4QYDA 2F6NA 2RNXA 5ENBA 1EQFA 4TZ2A 4PS5A 5KU3A 4TS8A 5EGUA 4ZW1A 4C66A 5FH6A 3P5OA 5DBMA 4A9OA 4A9KA 4YH3A 4A9HA 4UYHA 3U5KA 5A82A 5L97A 5I83A 4AKNA 1WUGA 5E73A 1WUMA 4NS5A 5TB6A 5HFQA 4QZSA 2DVRA 4Z93A 5JWMA 2OUOA 2WP1A 4IORA 4OGIA 5CS8A 4QNSA 3MQMA 5LVRA 5DYUA 3Q2EA 5D7XA 2KTBB 5LKTA 3RCWA 5HQ7A 3SVFA 3UW9A 3U5PA 4CUTA 4N4GA 5F2PA 2R0YA 5EVAA 2DKWA 5H1VA 5IGNA 5LUUA 1JSPB 4NR8A 5CPEA 5BT3A 4C67A 4NRAA 5DY7A 5E9MA 4ZQLA 4O7EA 5LJ2A 5HQ6A 5C8GA 4IR3A 4O7AA 4PCEA 2YW5A 4QYLA 4O7BA 5HLSA 3U5NA 2I7KA 2RNYA 3I3JA 4NXJA 5CUGA 3JVMA 4NR7A 3P1CA 4NUEA 4IR4A 4HXSA 5CFWA 3K2JA 3HMFA 2DVSA 3G0LA 3IU6A 4LZRA 5DYXA 2LSPB 4BJXA 4YC9A 3O36A 5IGKA 5FFWA 4YY6A 4ALHA 4QEUA 5LJ0A 5F5ZA 5E0RA 4UYDA 4O70A 5DLXA 5FE0A 5HQ5A 5D0CA 5DX4A 4J0SA 2GRCA 5IG6A 4LYWA 4XYAA 2F6JA 5CP5A 4QSPA 5ENEA 5BT5A 4QSQA 3SVHA 3GG3A 4YY4A 4WHUA 4IR6A 5IIDA 4HXOA 5F25A 1N72A 4YABA 4UYEA 4NYXA 5ETDA 2R0SA 5C87A 4UIXA 4N4IA 4BW3A 2DVVA 5J0DA 3AQAA 5CUEA 4O7FA 2YYNA 4XUBA 5C85A 2N9GA 4UITA 4QC3A 5HJCA 4XY9A 4N4FA 5LKZA 4HXLA 5I88A 4HBXA 4HXKA 5FFYA 4A9FA 2D82A 5F60A 2D9EA 5ENCA 5FE9A 5I7YA 4UIUA 3JVLA 4WIVA 3LXJA 3O37A 2RNWA 2YEKA 4LR6A 5CUAA 5CQ3A 3ONIA 4RVRA 4QR4A 5FFVA 2YEMA 4YATA 3O34A 5LKUA 3HMHA 5A5SA 5HRXA 2L85A 5CUCA 3LQIA 5DW2A 3UV2A 5EV9A 2RO1A 5FG4A 4MENA 4J0RA 4OGJA 5KTXA 5AD2A 5DFDA 5FE1A 5A5QA 5HCLA 3TLPA 5EPSA 2YQDA 4F3IA 5F1HA 5E7DA 4O75A 4X2IA 5KTUA 4NR5A 4CL9A 4PY6A 4MR4A 4O72A 5EI4A 3UVXA 4YYNA 5C7NA 3MXFA 5F36A 5H1UA 4YYJA 3S92A 5CUDA 4TZ8A 5D25A 4O77A 4N4HA 5FE5A 5CRZA 3MB3A 2RFJA 3QZSA 5BT4A 5CQTA 4NUCA 5IBNA 3SVGA 2DATA 5KO4A 3S91A 5ACYA 5AMFA 4NRBA 4YYKA 4DONA 4QB3A 5E3DA 5II2A 2MJVB 3AADA 5EA1A 5D3NA 4QR3A 3LJWA 3QZVA 5I86A 3JVJA 4TT6A 5EWHA 2E3KA 4XY8A 5CTLA 5EM3A 5CQ7A 5D3HA 5DLZA 4NR9A 4LYSA 5E3GA 5CGPA 5I89A 2E7OA 4NR6A 4CUSA 4UYGA 4XUAA 3U5LA 4YK0A 4MR6A 4QEWA 4Z6IA 5E9IA 3LQJA 5AD3A 5EP7A 4MEOA 4TTEA 5JI8A 5ENGA 5L8TA 3FKMX 5E9VA 5I80A 5ENFA 4WHWA 5F3AA 4NRCA 5D3SA 5CQAA 4Z1QA 2R0VA 4YAXA 5AMEA 5ENJA 3U5MA 4O7CA 5A5RA 4A9IA 4E96A 4KV1A 5D3TA 2DVQA 4HBVA 5D26A 1X0JA 4QSSA 5D24A 5DFBA 4HXMA 5FB0A 5A7CA 5FE3A 5HRVA 5A85A 4UIWA 4HBYA 4Z1SA 2RI7A 4QY4A 3O33A 4YH4A 5F1LA 5FE6A 4LRGA 4YYGA 3U5OA 4QEVA 4YYHA 3P1DA 4A9NA 5CRMA 5L99A 4QUTA 5CQ5A 4A9EA 4UYFB 4O76A 3Q2FA 5A5PA 5FE8A 5DKHA 4PKLA 4KCXA 4NUDA 2L84A 4YBTA 5LJ1A 5II1A 2NXBA 4ZC9A 4QSTA 4FLPA 4CUQA 5EISA 5A81A 4Y03A 4CLBA 1ZS5A 4GPJA 4MR5A 4O78A 2R10A 5K29A 5LVQA 3UVYA 4CFLA 4NYWA 5HEMA 5ENIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DFC A;  3D7C A;  5ENH A;  4TU4 A;  4LC2 A;  4QR5 A;  5HRW A;  4TT4 A;  4MEQ A;  4O71 A;  5FE2 A;  5CQ6 A;  2G4A A;  4BHW A;  5H1T A;  5IGM A;  4Q0O A;  5KHM A;  5L98 A;  4TT2 A;  4YBM A;  5IGL A;  4YAD A;  5EQ1 A;  4NR4 A;  4UIV A;  3UV4 A;  4IOQ A;  5EIC A;  5KTW A;  3G0J A;  5DYC A;  3P1E A;  4BW2 A;  5I1Q A;  5CY9 A;  4CUU A;  3UVW A;  5E9L A;  4MEP A;  4A9J A;  4QC1 A;  5FG5 A;  5EU1 A;  5FG6 A;  4HBW A;  3QZT A;  1E6I A;  4TQN A;  1F68 A;  4YYD A;  4O74 A;  5EWV A;  5HEN A;  4QSV A;  4ALG A;  4CUP A;  5DKC A;  4UYF A;  4QUU A;  5EWC A;  5FH8 A;  5DKD A;  4BW4 A;  4PCI A;  4NQN A;  3JVK A;  2FSA A;  4UIY A;  5EWW A;  5CQ4 A;  5E9Y A;  5F63 A;  4QSX A;  4N3W A;  2DWW A;  5HEL A;  5E74 A;  5TCM A;  3HME A;  5F62 A;  2E7N A;  4UIZ A;  3UVD A;  5ETB A;  3IU5 A;  5CQ8 A;  4OUF A;  3DWY A;  5FDZ A;  5D3P A;  4PTB A;  2WP2 A;  3O35 A;  3UV5 A;  5L8U A;  4QBM A;  5A83 A;  5DYA A;  4LYI A;  3P1F A;  4LZS A;  5D3R A;  2I8N A;  4MR3 A;  5C89 A;  5A5N A;  4CFK A;  3U5J A;  4YYM A;  5CU8 A;  5EK9 A;  5EWD A;  5HM0 A;  5C4Q A;  4KV4 A;  4QSR A;  5FB1 A;  5G4S A;  4Z6H A;  5FE7 A;  1JM4 B;  5EPR A;  3LQH A;  4HXN A;  5D3J A;  5G4R A;  4J1P A;  4J3I A;  5LKX A;  5FH7 A;  2RS9 B;  4LDF A;  2L5E A;  4BW1 A;  4NQM A;  5L96 A;  5CUB A;  4YBS A;  4IOO A;  4HXR A;  5DW1 A;  4LZ2 A;  5I29 A;  4Q0N A;  3NXB A;  4YYI A;  5A5O A;  4QSU A;  4TU6 A;  2YDW A;  4A9M A;  5FBX A;  2YEL A;  5CZG A;  5EPB A;  3DAI A;  5HFR A;  5I40 A;  3MB4 A;  5E9K A;  3MUK A;  4NYV A;  5FE4 A;  4CUR A;  2OO1 A;  4HXP A;  5COI A;  5D3L A;  2OSS A;  4QSW A;  5F61 A;  4A9L A;  3MUL A;  2H60 A;  4IR5 A;  4TYL A;  5I7X A;  5H85 A;  3ZYU A;  4QYD A;  2F6N A;  2RNX A;  5ENB A;  1EQF A;  4TZ2 A;  4PS5 A;  5KU3 A;  4TS8 A;  5EGU A;  4ZW1 A;  4C66 A;  5FH6 A;  3P5O A;  5DBM A;  4A9O A;  4A9K A;  4YH3 A;  4A9H A;  4UYH A;  3U5K A;  5A82 A;  5L97 A;  5I83 A;  4AKN A;  1WUG A;  5E73 A;  1WUM A;  4NS5 A;  5TB6 A;  5HFQ A;  4QZS A;  2DVR A;  4Z93 A;  5JWM A;  2OUO A;  2WP1 A;  4IOR A;  4OGI A;  5CS8 A;  4QNS A;  3MQM A;  5LVR A;  5DYU A;  3Q2E A;  5D7X A;  2KTB B;  5LKT A;  3RCW A;  5HQ7 A;  3SVF A;  3UW9 A;  3U5P A;  4CUT A;  4N4G A;  5F2P A;  2R0Y A;  5EVA A;  2DKW A;  5H1V A;  5IGN A;  5LUU A;  1JSP B;  4NR8 A;  5CPE A;  5BT3 A;  4C67 A;  4NRA A;  5DY7 A;  5E9M A;  4ZQL A;  4O7E A;  5LJ2 A;  5HQ6 A;  5C8G A;  4IR3 A;  4O7A A;  4PCE A;  2YW5 A;  4QYL A;  4O7B A;  5HLS A;  3U5N A;  2I7K A;  2RNY A;  3I3J A;  4NXJ A;  5CUG A;  3JVM A;  4NR7 A;  3P1C A;  4NUE A;  4IR4 A;  4HXS A;  5CFW A;  3K2J A;  3HMF A;  2DVS A;  3G0L A;  3IU6 A;  4LZR A;  5DYX A;  2LSP B;  4BJX A;  4YC9 A;  3O36 A;  5IGK A;  5FFW A;  4YY6 A;  4ALH A;  4QEU A;  5LJ0 A;  5F5Z A;  5E0R A;  4UYD A;  4O70 A;  5DLX A;  5FE0 A;  5HQ5 A;  5D0C A;  5DX4 A;  4J0S A;  2GRC A;  5IG6 A;  4LYW A;  4XYA A;  2F6J A;  5CP5 A;  4QSP A;  5ENE A;  5BT5 A;  4QSQ A;  3SVH A;  3GG3 A;  4YY4 A;  4WHU A;  4IR6 A;  5IID A;  4HXO A;  5F25 A;  1N72 A;  4YAB A;  4UYE A;  4NYX A;  5ETD A;  2R0S A;  5C87 A;  4UIX A;  4N4I A;  4BW3 A;  2DVV A;  5J0D A;  3AQA A;  5CUE A;  4O7F A;  2YYN A;  4XUB A;  5C85 A;  2N9G A;  4UIT A;  4QC3 A;  5HJC A;  4XY9 A;  4N4F A;  5LKZ A;  4HXL A;  5I88 A;  4HBX A;  4HXK A;  5FFY A;  4A9F A;  2D82 A;  5F60 A;  2D9E A;  5ENC A;  5FE9 A;  5I7Y A;  4UIU A;  3JVL A;  4WIV A;  3LXJ A;  3O37 A;  2RNW A;  2YEK A;  4LR6 A;  5CUA A;  5CQ3 A;  3ONI A;  4RVR A;  4QR4 A;  5FFV A;  2YEM A;  4YAT A;  3O34 A;  5LKU A;  3HMH A;  5A5S A;  5HRX A;  2L85 A;  5CUC A;  3LQI A;  5DW2 A;  3UV2 A;  5EV9 A;  2RO1 A;  5FG4 A;  4MEN A;  4J0R A;  4OGJ A;  5KTX A;  5AD2 A;  5DFD A;  5FE1 A;  5A5Q A;  5HCL A;  3TLP A;  5EPS A;  2YQD A;  4F3I A;  5F1H A;  5E7D A;  4O75 A;  4X2I A;  5KTU A;  4NR5 A;  4CL9 A;  4PY6 A;  4MR4 A;  4O72 A;  5EI4 A;  3UVX A;  4YYN A;  5C7N A;  3MXF A;  5F36 A;  5H1U A;  4YYJ A;  3S92 A;  5CUD A;  4TZ8 A;  5D25 A;  4O77 A;  4N4H A;  5FE5 A;  5CRZ A;  3MB3 A;  2RFJ A;  3QZS A;  5BT4 A;  5CQT A;  4NUC A;  5IBN A;  3SVG A;  2DAT A;  5KO4 A;  3S91 A;  5ACY A;  5AMF A;  4NRB A;  4YYK A;  4DON A;  4QB3 A;  5E3D A;  5II2 A;  2MJV B;  3AAD A;  5EA1 A;  5D3N A;  4QR3 A;  3LJW A;  3QZV A;  5I86 A;  3JVJ A;  4TT6 A;  5EWH A;  2E3K A;  4XY8 A;  5CTL A;  5EM3 A;  5CQ7 A;  5D3H A;  5DLZ A;  4NR9 A;  4LYS A;  5E3G A;  5CGP A;  5I89 A;  2E7O A;  4NR6 A;  4CUS A;  4UYG A;  4XUA A;  3U5L A;  4YK0 A;  4MR6 A;  4QEW A;  4Z6I A;  5E9I A;  3LQJ A;  5AD3 A;  5EP7 A;  4MEO A;  4TTE A;  5JI8 A;  5ENG A;  5L8T A;  3FKM X;  5E9V A;  5I80 A;  5ENF A;  4WHW A;  5F3A A;  4NRC A;  5D3S A;  5CQA A;  4Z1Q A;  2R0V A;  4YAX A;  5AME A;  5ENJ A;  3U5M A;  4O7C A;  5A5R A;  4A9I A;  4E96 A;  4KV1 A;  5D3T A;  2DVQ A;  4HBV A;  5D26 A;  1X0J A;  4QSS A;  5D24 A;  5DFB A;  4HXM A;  5FB0 A;  5A7C A;  5FE3 A;  5HRV A;  5A85 A;  4UIW A;  4HBY A;  4Z1S A;  2RI7 A;  4QY4 A;  3O33 A;  4YH4 A;  5F1L A;  5FE6 A;  4LRG A;  4YYG A;  3U5O A;  4QEV A;  4YYH A;  3P1D A;  4A9N A;  5CRM A;  5L99 A;  4QUT A;  5CQ5 A;  4A9E A;  4UYF B;  4O76 A;  3Q2F A;  5A5P A;  5FE8 A;  5DKH A;  4PKL A;  4KCX A;  4NUD A;  2L84 A;  4YBT A;  5LJ1 A;  5II1 A;  2NXB A;  4ZC9 A;  4QST A;  4FLP A;  4CUQ A;  5EIS A;  5A81 A;  4Y03 A;  4CLB A;  1ZS5 A;  4GPJ A;  4MR5 A;  4O78 A;  2R10 A;  5K29 A;  5LVQ A;  3UVY A;  4CFL A;  4NYW A;  5HEM A;  5ENI A; 
#chains in the Genus database with same CATH topology
 5DFC A;  3D7C A;  3D1B A;  5ENH A;  4TU4 A;  4LC2 A;  4QR5 A;  5HRW A;  4TT4 A;  4MEQ A;  4O71 A;  5FE2 A;  5CQ6 A;  2G4A A;  4BHW A;  3D1D A;  5H1T A;  5IGM A;  4Q0O A;  5KHM A;  5L98 A;  4TT2 A;  1PUO A;  4YBM A;  5IGL A;  4YAD A;  5EQ1 A;  4NR4 A;  4UIV A;  3UV4 A;  4IOQ A;  5EIC A;  5KTW A;  3G0J A;  5DYC A;  3P1E A;  4BW2 A;  5I1Q A;  5CY9 A;  4CUU A;  3UVW A;  5E9L A;  4MEP A;  4A9J A;  4QC1 A;  5FG5 A;  5EU1 A;  5FG6 A;  4HBW A;  3QZT A;  1E6I A;  4TQN A;  1F68 A;  4YYD A;  4O74 A;  5EWV A;  5HEN A;  4QSV A;  4ALG A;  4CUP A;  5DKC A;  4UYF A;  4QUU A;  5EWC A;  5FH8 A;  5DKD A;  4BW4 A;  4PCI A;  4NQN A;  3JVK A;  2FSA A;  4UIY A;  5EWW A;  5CQ4 A;  5E9Y A;  5F63 A;  4QSX A;  4N3W A;  2DWW A;  5HEL A;  5E74 A;  5TCM A;  3HME A;  5F62 A;  2E7N A;  4UIZ A;  3UVD A;  5ETB A;  3IU5 A;  5CQ8 A;  4OUF A;  3DWY A;  5FDZ A;  5D3P A;  4PTB A;  2WP2 A;  3O35 A;  3UV5 A;  5L8U A;  4QBM A;  5A83 A;  5DYA A;  3ERR A;  4LYI A;  3P1F A;  4LZS A;  5D3R A;  2I8N A;  4MR3 A;  5C89 A;  5A5N A;  4CFK A;  3U5J A;  4YYM A;  5CU8 A;  5EK9 A;  1ZKR A;  5EWD A;  5HM0 A;  5C4Q A;  4KV4 A;  4QSR A;  5FB1 A;  5G4S A;  4Z6H A;  5FE7 A;  1JM4 B;  5EPR A;  3LQH A;  3VKG A;  4HXN A;  5D3J A;  5G4R A;  4J1P A;  4J3I A;  5LKX A;  5FH7 A;  2RS9 B;  4LDF A;  2L5E A;  4BW1 A;  4NQM A;  5L96 A;  5CUB A;  4YBS A;  4IOO A;  4HXR A;  5DW1 A;  4LZ2 A;  5I29 A;  4Q0N A;  3NXB A;  4YYI A;  5A5O A;  4QSU A;  4TU6 A;  2YDW A;  4A9M A;  5FBX A;  2YEL A;  5CZG A;  5EPB A;  3DAI A;  5HFR A;  5I40 A;  3MB4 A;  5E9K A;  3MUK A;  4NYV A;  5FE4 A;  4CUR A;  2OO1 A;  4HXP A;  5COI A;  5D3L A;  2OSS A;  4QSW A;  5F61 A;  4A9L A;  3MUL A;  2H60 A;  4IR5 A;  4TYL A;  5I7X A;  5H85 A;  3ZYU A;  4QYD A;  2F6N A;  2RNX A;  5ENB A;  1EQF A;  4TZ2 A;  4PS5 A;  5KU3 A;  4TS8 A;  5EGU A;  4ZW1 A;  4C66 A;  5FH6 A;  3P5O A;  5DBM A;  4A9O A;  4A9K A;  4YH3 A;  4A9H A;  4UYH A;  3U5K A;  5A82 A;  5L97 A;  5I83 A;  4AKN A;  1WUG A;  5E73 A;  1WUM A;  4NS5 A;  5TB6 A;  5HFQ A;  4QZS A;  2DVR A;  4Z93 A;  5JWM A;  2OUO A;  2WP1 A;  4IOR A;  4OGI A;  5CS8 A;  4QNS A;  3MQM A;  5LVR A;  5DYU A;  3Q2E A;  5D7X A;  4AKI A;  2KTB B;  5LKT A;  3RCW A;  5HQ7 A;  3SVF A;  3UW9 A;  3U5P A;  4CUT A;  4N4G A;  5F2P A;  2R0Y A;  5EVA A;  2DKW A;  5H1V A;  5IGN A;  5LUU A;  1JSP B;  4NR8 A;  5CPE A;  5BT3 A;  4C67 A;  4NRA A;  5DY7 A;  5E9M A;  4ZQL A;  4O7E A;  5LJ2 A;  5HQ6 A;  5C8G A;  4IR3 A;  4O7A A;  4PCE A;  2YW5 A;  4QYL A;  4O7B A;  5HLS A;  3U5N A;  2I7K A;  2RNY A;  3I3J A;  4NXJ A;  5CUG A;  3JVM A;  4NR7 A;  3P1C A;  4NUE A;  4IR4 A;  4HXS A;  5CFW A;  3K2J A;  3HMF A;  2DVS A;  3G0L A;  3IU6 A;  4LZR A;  5DYX A;  2LSP B;  4AKH A;  4BJX A;  4YC9 A;  3O36 A;  5IGK A;  5FFW A;  4YY6 A;  4ALH A;  4QEU A;  5LJ0 A;  5F5Z A;  5E0R A;  4UYD A;  4O70 A;  5DLX A;  5FE0 A;  5HQ5 A;  5D0C A;  5DX4 A;  4J0S A;  2GRC A;  5IG6 A;  4LYW A;  4XYA A;  4AI6 A;  2F6J A;  5CP5 A;  4QSP A;  5ENE A;  5BT5 A;  4QSQ A;  3SVH A;  3GG3 A;  4YY4 A;  4WHU A;  4IR6 A;  5IID A;  4HXO A;  5F25 A;  1N72 A;  4YAB A;  4UYE A;  4NYX A;  5ETD A;  2R0S A;  5C87 A;  4UIX A;  4N4I A;  4BW3 A;  2DVV A;  5J0D A;  3AQA A;  5CUE A;  4O7F A;  2YYN A;  4XUB A;  5C85 A;  2N9G A;  4UIT A;  4QC3 A;  5HJC A;  4XY9 A;  4N4F A;  5LKZ A;  4HXL A;  5I88 A;  4HBX A;  4HXK A;  5FFY A;  4A9F A;  2D82 A;  5F60 A;  2D9E A;  5ENC A;  5FE9 A;  5I7Y A;  4UIU A;  3JVL A;  4WIV A;  3LXJ A;  3O37 A;  2RNW A;  2YEK A;  4LR6 A;  5CUA A;  5CQ3 A;  3ONI A;  4RVR A;  4QR4 A;  5FFV A;  2YEM A;  4YAT A;  3O34 A;  5LKU A;  3HMH A;  5A5S A;  5HRX A;  2L85 A;  5CUC A;  3LQI A;  5DW2 A;  3UV2 A;  5EV9 A;  2RO1 A;  5FG4 A;  4MEN A;  4J0R A;  4OGJ A;  5KTX A;  5AD2 A;  5DFD A;  5FE1 A;  5A5Q A;  5HCL A;  3TLP A;  5EPS A;  2YQD A;  4F3I A;  5F1H A;  5E7D A;  4O75 A;  4X2I A;  5KTU A;  4NR5 A;  4CL9 A;  4PY6 A;  4MR4 A;  4O72 A;  5EI4 A;  3UVX A;  4YYN A;  5C7N A;  3MXF A;  5F36 A;  5H1U A;  4YYJ A;  3S92 A;  5CUD A;  4TZ8 A;  5D25 A;  4AKG A;  4O77 A;  4N4H A;  5FE5 A;  5CRZ A;  3MB3 A;  2RFJ A;  3QZS A;  5BT4 A;  5CQT A;  4NUC A;  5IBN A;  3SVG A;  2DAT A;  5KO4 A;  3S91 A;  5ACY A;  5AMF A;  4NRB A;  4YYK A;  4DON A;  4QB3 A;  5E3D A;  5II2 A;  2MJV B;  3AAD A;  5EA1 A;  5D3N A;  4QR3 A;  3LJW A;  3QZV A;  5I86 A;  3JVJ A;  4TT6 A;  5EWH A;  2E3K A;  4XY8 A;  5CTL A;  5EM3 A;  5CQ7 A;  5D3H A;  5DLZ A;  4NR9 A;  4LYS A;  5E3G A;  5CGP A;  5I89 A;  2E7O A;  4NR6 A;  4CUS A;  4UYG A;  4XUA A;  3U5L A;  4YK0 A;  4MR6 A;  4QEW A;  4Z6I A;  5E9I A;  3LQJ A;  5AD3 A;  3VKH A;  5EP7 A;  4MEO A;  4TTE A;  5JI8 A;  5ENG A;  5L8T A;  3FKM X;  5E9V A;  5I80 A;  2EJN A;  5ENF A;  4WHW A;  5F3A A;  4NRC A;  5D3S A;  5CQA A;  4Z1Q A;  2R0V A;  4YAX A;  5AME A;  5ENJ A;  3U5M A;  4O7C A;  5A5R A;  4A9I A;  4E96 A;  4KV1 A;  5D3T A;  2DVQ A;  4HBV A;  5D26 A;  1X0J A;  4QSS A;  5D24 A;  5DFB A;  4HXM A;  5FB0 A;  5A7C A;  5FE3 A;  5HRV A;  5A85 A;  4UIW A;  4HBY A;  4Z1S A;  2RI7 A;  4QY4 A;  3O33 A;  4YH4 A;  5F1L A;  5FE6 A;  4LRG A;  4YYG A;  3U5O A;  4QEV A;  4YYH A;  3P1D A;  4A9N A;  5CRM A;  5L99 A;  4QUT A;  5CQ5 A;  4A9E A;  4UYF B;  4O76 A;  3Q2F A;  5A5P A;  5FE8 A;  5DKH A;  4PKL A;  4KCX A;  4NUD A;  2L84 A;  4YBT A;  5LJ1 A;  5II1 A;  2NXB A;  4ZC9 A;  4QST A;  4FLP A;  4CUQ A;  5EIS A;  5A81 A;  4Y03 A;  4CLB A;  1ZS5 A;  4GPJ A;  4MR5 A;  4O78 A;  2R10 A;  5K29 A;  5LVQ A;  3UVY A;  4CFL A;  4NYW A;  5HEM A;  5ENI A; 
#chains in the Genus database with same CATH homology
 5DFC A;  3D7C A;  5ENH A;  4TU4 A;  4LC2 A;  4QR5 A;  5HRW A;  4TT4 A;  4MEQ A;  4O71 A;  5FE2 A;  5CQ6 A;  2G4A A;  4BHW A;  5H1T A;  5IGM A;  4Q0O A;  5KHM A;  5L98 A;  4TT2 A;  4YBM A;  5IGL A;  4YAD A;  5EQ1 A;  4NR4 A;  4UIV A;  3UV4 A;  4IOQ A;  5EIC A;  5KTW A;  3G0J A;  5DYC A;  3P1E A;  4BW2 A;  5I1Q A;  5CY9 A;  4CUU A;  3UVW A;  5E9L A;  4MEP A;  4A9J A;  4QC1 A;  5FG5 A;  5EU1 A;  5FG6 A;  4HBW A;  3QZT A;  1E6I A;  4TQN A;  1F68 A;  4YYD A;  4O74 A;  5EWV A;  5HEN A;  4QSV A;  4ALG A;  4CUP A;  5DKC A;  4UYF A;  4QUU A;  5EWC A;  5FH8 A;  5DKD A;  4BW4 A;  4PCI A;  4NQN A;  3JVK A;  2FSA A;  4UIY A;  5EWW A;  5CQ4 A;  5E9Y A;  5F63 A;  4QSX A;  4N3W A;  2DWW A;  5HEL A;  5E74 A;  5TCM A;  3HME A;  5F62 A;  2E7N A;  4UIZ A;  3UVD A;  5ETB A;  3IU5 A;  5CQ8 A;  4OUF A;  3DWY A;  5FDZ A;  5D3P A;  4PTB A;  2WP2 A;  3O35 A;  3UV5 A;  5L8U A;  4QBM A;  5A83 A;  5DYA A;  4LYI A;  3P1F A;  4LZS A;  5D3R A;  2I8N A;  4MR3 A;  5C89 A;  5A5N A;  4CFK A;  3U5J A;  4YYM A;  5CU8 A;  5EK9 A;  5EWD A;  5HM0 A;  5C4Q A;  4KV4 A;  4QSR A;  5FB1 A;  5G4S A;  4Z6H A;  5FE7 A;  1JM4 B;  5EPR A;  3LQH A;  4HXN A;  5D3J A;  5G4R A;  4J1P A;  4J3I A;  5LKX A;  5FH7 A;  2RS9 B;  4LDF A;  2L5E A;  4BW1 A;  4NQM A;  5L96 A;  5CUB A;  4YBS A;  4IOO A;  4HXR A;  5DW1 A;  4LZ2 A;  5I29 A;  4Q0N A;  3NXB A;  4YYI A;  5A5O A;  4QSU A;  4TU6 A;  2YDW A;  4A9M A;  5FBX A;  2YEL A;  5CZG A;  5EPB A;  3DAI A;  5HFR A;  5I40 A;  3MB4 A;  5E9K A;  3MUK A;  4NYV A;  5FE4 A;  4CUR A;  2OO1 A;  4HXP A;  5COI A;  5D3L A;  2OSS A;  4QSW A;  5F61 A;  4A9L A;  3MUL A;  2H60 A;  4IR5 A;  4TYL A;  5I7X A;  5H85 A;  3ZYU A;  4QYD A;  2F6N A;  2RNX A;  5ENB A;  1EQF A;  4TZ2 A;  4PS5 A;  5KU3 A;  4TS8 A;  5EGU A;  4ZW1 A;  4C66 A;  5FH6 A;  3P5O A;  5DBM A;  4A9O A;  4A9K A;  4YH3 A;  4A9H A;  4UYH A;  3U5K A;  5A82 A;  5L97 A;  5I83 A;  4AKN A;  1WUG A;  5E73 A;  1WUM A;  4NS5 A;  5TB6 A;  5HFQ A;  4QZS A;  2DVR A;  4Z93 A;  5JWM A;  2OUO A;  2WP1 A;  4IOR A;  4OGI A;  5CS8 A;  4QNS A;  3MQM A;  5LVR A;  5DYU A;  3Q2E A;  5D7X A;  2KTB B;  5LKT A;  3RCW A;  5HQ7 A;  3SVF A;  3UW9 A;  3U5P A;  4CUT A;  4N4G A;  5F2P A;  2R0Y A;  5EVA A;  2DKW A;  5H1V A;  5IGN A;  5LUU A;  1JSP B;  4NR8 A;  5CPE A;  5BT3 A;  4C67 A;  4NRA A;  5DY7 A;  5E9M A;  4ZQL A;  4O7E A;  5LJ2 A;  5HQ6 A;  5C8G A;  4IR3 A;  4O7A A;  4PCE A;  2YW5 A;  4QYL A;  4O7B A;  5HLS A;  3U5N A;  2I7K A;  2RNY A;  3I3J A;  4NXJ A;  5CUG A;  3JVM A;  4NR7 A;  3P1C A;  4NUE A;  4IR4 A;  4HXS A;  5CFW A;  3K2J A;  3HMF A;  2DVS A;  3G0L A;  3IU6 A;  4LZR A;  5DYX A;  2LSP B;  4BJX A;  4YC9 A;  3O36 A;  5IGK A;  5FFW A;  4YY6 A;  4ALH A;  4QEU A;  5LJ0 A;  5F5Z A;  5E0R A;  4UYD A;  4O70 A;  5DLX A;  5FE0 A;  5HQ5 A;  5D0C A;  5DX4 A;  4J0S A;  2GRC A;  5IG6 A;  4LYW A;  4XYA A;  2F6J A;  5CP5 A;  4QSP A;  5ENE A;  5BT5 A;  4QSQ A;  3SVH A;  3GG3 A;  4YY4 A;  4WHU A;  4IR6 A;  5IID A;  4HXO A;  5F25 A;  1N72 A;  4YAB A;  4UYE A;  4NYX A;  5ETD A;  2R0S A;  5C87 A;  4UIX A;  4N4I A;  4BW3 A;  2DVV A;  5J0D A;  3AQA A;  5CUE A;  4O7F A;  2YYN A;  4XUB A;  5C85 A;  2N9G A;  4UIT A;  4QC3 A;  5HJC A;  4XY9 A;  4N4F A;  5LKZ A;  4HXL A;  5I88 A;  4HBX A;  4HXK A;  5FFY A;  4A9F A;  2D82 A;  5F60 A;  2D9E A;  5ENC A;  5FE9 A;  5I7Y A;  4UIU A;  3JVL A;  4WIV A;  3LXJ A;  3O37 A;  2RNW A;  2YEK A;  4LR6 A;  5CUA A;  5CQ3 A;  3ONI A;  4RVR A;  4QR4 A;  5FFV A;  2YEM A;  4YAT A;  3O34 A;  5LKU A;  3HMH A;  5A5S A;  5HRX A;  2L85 A;  5CUC A;  3LQI A;  5DW2 A;  3UV2 A;  5EV9 A;  2RO1 A;  5FG4 A;  4MEN A;  4J0R A;  4OGJ A;  5KTX A;  5AD2 A;  5DFD A;  5FE1 A;  5A5Q A;  5HCL A;  3TLP A;  5EPS A;  2YQD A;  4F3I A;  5F1H A;  5E7D A;  4O75 A;  4X2I A;  5KTU A;  4NR5 A;  4CL9 A;  4PY6 A;  4MR4 A;  4O72 A;  5EI4 A;  3UVX A;  4YYN A;  5C7N A;  3MXF A;  5F36 A;  5H1U A;  4YYJ A;  3S92 A;  5CUD A;  4TZ8 A;  5D25 A;  4O77 A;  4N4H A;  5FE5 A;  5CRZ A;  3MB3 A;  2RFJ A;  3QZS A;  5BT4 A;  5CQT A;  4NUC A;  5IBN A;  3SVG A;  2DAT A;  5KO4 A;  3S91 A;  5ACY A;  5AMF A;  4NRB A;  4YYK A;  4DON A;  4QB3 A;  5E3D A;  5II2 A;  2MJV B;  3AAD A;  5EA1 A;  5D3N A;  4QR3 A;  3LJW A;  3QZV A;  5I86 A;  3JVJ A;  4TT6 A;  5EWH A;  2E3K A;  4XY8 A;  5CTL A;  5EM3 A;  5CQ7 A;  5D3H A;  5DLZ A;  4NR9 A;  4LYS A;  5E3G A;  5CGP A;  5I89 A;  2E7O A;  4NR6 A;  4CUS A;  4UYG A;  4XUA A;  3U5L A;  4YK0 A;  4MR6 A;  4QEW A;  4Z6I A;  5E9I A;  3LQJ A;  5AD3 A;  5EP7 A;  4MEO A;  4TTE A;  5JI8 A;  5ENG A;  5L8T A;  3FKM X;  5E9V A;  5I80 A;  5ENF A;  4WHW A;  5F3A A;  4NRC A;  5D3S A;  5CQA A;  4Z1Q A;  2R0V A;  4YAX A;  5AME A;  5ENJ A;  3U5M A;  4O7C A;  5A5R A;  4A9I A;  4E96 A;  4KV1 A;  5D3T A;  2DVQ A;  4HBV A;  5D26 A;  1X0J A;  4QSS A;  5D24 A;  5DFB A;  4HXM A;  5FB0 A;  5A7C A;  5FE3 A;  5HRV A;  5A85 A;  4UIW A;  4HBY A;  4Z1S A;  2RI7 A;  4QY4 A;  3O33 A;  4YH4 A;  5F1L A;  5FE6 A;  4LRG A;  4YYG A;  3U5O A;  4QEV A;  4YYH A;  3P1D A;  4A9N A;  5CRM A;  5L99 A;  4QUT A;  5CQ5 A;  4A9E A;  4UYF B;  4O76 A;  3Q2F A;  5A5P A;  5FE8 A;  5DKH A;  4PKL A;  4KCX A;  4NUD A;  2L84 A;  4YBT A;  5LJ1 A;  5II1 A;  2NXB A;  4ZC9 A;  4QST A;  4FLP A;  4CUQ A;  5EIS A;  5A81 A;  4Y03 A;  4CLB A;  1ZS5 A;  4GPJ A;  4MR5 A;  4O78 A;  2R10 A;  5K29 A;  5LVQ A;  3UVY A;  4CFL A;  4NYW A;  5HEM A;  5ENI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...