3HMHA

Crystal structure of the second bromodomain of human tbp-associated factor rna polymerase 1-like (taf1l)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
139
structure length
139
Chain Sequence
GTENLYFQSMQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTAKEAALEEAELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription initiation factor TFIID 210 kDa subunit
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3hmhA00
5A5QA 5EU1A 1X0JA 5AMFA 5I86A 5FH6A 4HBYA 4QSSA 4TZ2A 5CQTA 4O7EA 5CUCA 5D24A 5F36A 4CUPA 5DLXA 3S92A 4LC2A 5E7DA 5EISA 4HXPA 4IORA 5L99A 3MXFA 4UIVA 5E0RA 3SVGA 3P1DA 5DYXA 5A5NA 5FE6A 5ENFA 1ZS5A 4BW1A 4YYGA 4MR4A 4NQNA 3NXBA 2YYNA 5E9IA 4NR5A 4YABA 5JWMA 4O76A 5EI4A 4A9HA 3HMFA 3AADA 4ALGA 3P1EA 4Y03A 4QR4A 4YATA 5KHMA 5FG4A 5CPEA 2RNYA 4Q0OA 4QC3A 5FE9A 5D0CA 4PCIA 3MQMA 5I80A 5L8TA 4YADA 4YH4A 4BJXA 5CUBA 4HXNA 5E3DA 4YBTA 2L85A 4CFKA 4MR6A 5A7CA 2OUOA 4CUSA 5C89A 3UV2A 4UYFA 5CQ5A 4NR4A 4YYJA 5F1LA 4A9JA 5I1QA 4TU6A 1WUMA 4LRGA 4YYDA 5CRZA 3IU6A 5ACYA 5TB6A 4WIVA 5EM3A 4C66A 5DX4A 5DBMA 3HMHA 5BT5A 4J3IA 5D3LA 1JSPB 5DFBA 2OSSA 4TU4A 3JVLA 4QSXA 4GPJA 4IR5A 4CUTA 4Z1QA 5F3AA 5HQ7A 5CGPA 5E9LA 4OGIA 2E7NA 5F5ZA 4NUEA 4O70A 5L98A 4XY8A 4A9EA 4QSRA 4HBXA 4LYIA 5KTUA 4IR3A 5IGLA 5LJ0A 4LYSA 5ENGA 2RO1A 4ALHA 4NS5A 2R10A 5HEMA 4LR6A 4TS8A 4Z6IA 2I8NA 2DATA 4O74A 4QYLA 4YC9A 5EWWA 5G4SA 3UVWA 5DY7A 4BW3A 5CQAA 4J0RA 5FBXA 3LXJA 5FE5A 4NRCA 5CQ8A 5CUDA 5CY9A 4QUTA 4HXLA 4YK0A 5DW2A 3LQIA 4XUBA 5CS8A 5L8UA 3O37A 3QZSA 4QEWA 2LSPB 5F25A 5HM0A 3O34A 3FKMX 4C67A 2F6NA 4NR7A 2FSAA 5ENJA 4CUUA 4QBMA 5II1A 4TQNA 3O36A 5AD3A 3QZTA 5D3RA 5CQ4A 5DKCA 5CQ7A 4QSQA 4A9LA 5IGKA 3MB4A 5COIA 5EWDA 5C7NA 5ETDA 2I7KA 5J0DA 5L96A 4UYGA 4UYHA 4PS5A 1E6IA 5CZGA 5H1VA 5FFYA 5ENHA 4MENA 5HRXA 5A5SA 4TT2A 4MEPA 5F63A 4NUDA 5LVQA 3GG3A 5LJ2A 5HFRA 5EQ1A 2OO1A 4O71A 5CUEA 2YW5A 5I40A 3U5KA 4HBWA 5HRVA 2RNWA 4A9MA 5D3PA 5FE3A 2R0SA 4NYVA 4QC1A 2F6JA 4QEVA 5HLSA 5FDZA 1JM4B 5CTLA 2DVQA 3UV4A 4N4HA 3LQHA 5F60A 4YYMA 3UVYA 5HQ6A 4YYKA 5C85A 4TYLA 5E3GA 4A9KA 4TTEA 4QEUA 5I29A 2E3KA 5AD2A 5EGUA 4QSPA 5D3SA 4ZW1A 5E9YA 5HELA 4X2IA 4XUAA 4HXSA 5DLZA 2H60A 2DVSA 5EWCA 4Z93A 4LYWA 5EVAA 5HCLA 3UVDA 4BHWA 2NXBA 5IIDA 5DW1A 4FLPA 2N9GA 3JVMA 5FE4A 2DWWA 4TZ8A 5DFCA 4YYNA 5C4QA 4QUUA 5KTWA 2WP2A 4YAXA 4O78A 3DAIA 3TLPA 4NRAA 4PCEA 2YEMA 5I7YA 4LZ2A 4YBMA 5ETBA 5D26A 5FFWA 5DYAA 4MR5A 4YYIA 4XY9A 5CUGA 5D3HA 2D9EA 4NR8A 4AKNA 5FG5A 5HQ5A 5D3TA 4O77A 3SVFA 5LKTA 3P1FA 4J0SA 5A5OA 4PTBA 5FE0A 5DYUA 4IOOA 3P5OA 5CQ3A 2E7OA 4CL9A 1F68A 4O72A 4ZQLA 4NXJA 4QR5A 3P1CA 5KU3A 5DKHA 3ONIA 5IGNA 5H1UA 2R0YA 5EICA 4UIYA 5EK9A 3UVXA 3LQJA 5DKDA 4QZSA 4BW4A 2RFJA 5F61A 3U5LA 5I7XA 5AMEA 4UIZA 5HRWA 4HXOA 5EPSA 4IOQA 2RS9B 5IBNA 5I88A 4UIWA 3QZVA 4J1PA 5LUUA 3HMEA 4NR9A 4YBSA 2GRCA 5EPRA 5A82A 4NUCA 4QSWA 2L5EA 3Q2FA 5D25A 5EV9A 5CUAA 4UIUA 4LDFA 4KV1A 4UYFB 4UYDA 4Z1SA 4TT6A 5EP7A 5F1HA 5LKXA 5KO4A 2YQDA 4TT4A 4HBVA 4HXKA 4QNSA 3O35A 2D82A 4IR4A 5FG6A 2R0VA 3Q2EA 3G0LA 4OGJA 2YELA 5G4RA 2G4AA 4N4FA 5H85A 5CU8A 3RCWA 5A5PA 5II2A 5EWVA 3I3JA 5FH8A 5E9VA 4MEOA 4ZC9A 4DONA 5EPBA 5FB1A 3UW9A 4O7BA 5FFVA 5TCMA 5FH7A 5HENA 4YH3A 5HFQA 4E96A 4A9FA 3MUKA 4NRBA 2MJVB 5A5RA 3MULA 2WP1A 4A9IA 4QSTA 5LJ1A 3K2JA 2YEKA 5I89A 3U5PA 4HXRA 4PY6A 4IR6A 5ENEA 5LKZA 4NR6A 4KV4A 4NYWA 3U5NA 2DVRA 4NYXA 5HJCA 5DFDA 4HXMA 5DYCA 2RNXA 5CQ6A 4QY4A 5F62A 3S91A 4A9NA 2DVVA 5FE8A 5CP5A 3IU5A 5CFWA 4BW2A 3DWYA 4QSVA 2YDWA 5EA1A 5A83A 4PKLA 4O75A 4N3WA 3U5MA 4MR3A 3SVHA 4N4GA 5E73A 5E9KA 2DKWA 5LVRA 5A81A 2RI7A 4YY6A 3O33A 4A9OA 5C8GA 3JVKA 4YY4A 5I83A 4CUQA 5H1TA 4LZSA 4QSUA 5L97A 5BT3A 3U5JA 4Q0NA 3UV5A 4MEQA 5A85A 5FB0A 5ENCA 5BT4A 4N4IA 5IG6A 3JVJA 5ENIA 2L84A 5D3NA 5D7XA 5ENBA 3U5OA 4KCXA 4WHWA 5C87A 3D7CA 5K29A 1WUGA 4XYAA 4UITA 3AQAA 4O7AA 4CFLA 5IGMA 4F3IA 3G0JA 5F2PA 5FE2A 2KTBB 4QB3A 4WHUA 4OUFA 5JI8A 3ZYUA 4LZRA 4QR3A 5FE7A 4O7FA 5CRMA 4RVRA 4NQMA 4O7CA 5E9MA 1N72A 5KTXA 1EQFA 4QYDA 5LKUA 4Z6HA 3MB3A 4CURA 4UIXA 5FE1A 4UYEA 5D3JA 3LJWA 4CLBA 4YYHA 5EWHA 5E74A
chains in the Genus database with same CATH superfamily
5A5QA 5EU1A 1X0JA 3VKHA 5AMFA 5I86A 5FH6A 4HBYA 4QSSA 4TZ2A 5CQTA 4AKHA 4O7EA 5CUCA 5D24A 5F36A 4CUPA 5DLXA 3S92A 4LC2A 5E7DA 5EISA 4HXPA 4IORA 5L99A 3MXFA 4UIVA 5E0RA 3SVGA 3P1DA 5DYXA 5A5NA 5FE6A 5ENFA 1ZS5A 4BW1A 4YYGA 4MR4A 4NQNA 3NXBA 2YYNA 5E9IA 4NR5A 4YABA 5JWMA 4O76A 5EI4A 4A9HA 3HMFA 3AADA 4ALGA 3P1EA 4Y03A 4QR4A 4YATA 5KHMA 5FG4A 5CPEA 2RNYA 4Q0OA 4QC3A 5FE9A 5D0CA 4PCIA 3MQMA 5I80A 5L8TA 4YADA 4YH4A 4BJXA 5CUBA 4HXNA 5E3DA 4YBTA 2L85A 4CFKA 4MR6A 5A7CA 2OUOA 4CUSA 5C89A 3UV2A 4UYFA 5CQ5A 4NR4A 4YYJA 5F1LA 4A9JA 5I1QA 4TU6A 1WUMA 4LRGA 4YYDA 5CRZA 3IU6A 5ACYA 5TB6A 4WIVA 5EM3A 4C66A 5DX4A 5DBMA 3HMHA 5BT5A 4J3IA 5D3LA 1JSPB 5DFBA 2OSSA 4TU4A 3JVLA 4QSXA 4GPJA 4IR5A 4CUTA 4Z1QA 5F3AA 5HQ7A 5CGPA 5E9LA 4OGIA 2E7NA 5F5ZA 4NUEA 4O70A 5L98A 4XY8A 4A9EA 4QSRA 4HBXA 4LYIA 5KTUA 4IR3A 5IGLA 5LJ0A 4LYSA 5ENGA 2RO1A 4ALHA 4NS5A 2R10A 5HEMA 4LR6A 4TS8A 4Z6IA 2I8NA 2DATA 4O74A 4QYLA 4YC9A 5EWWA 5G4SA 3UVWA 5DY7A 4BW3A 5CQAA 4J0RA 5FBXA 3LXJA 5FE5A 4NRCA 5CQ8A 5CUDA 5CY9A 4QUTA 4HXLA 4YK0A 5DW2A 3LQIA 4XUBA 5CS8A 5L8UA 3O37A 3QZSA 4QEWA 2LSPB 5F25A 5HM0A 3O34A 3FKMX 4C67A 2F6NA 4NR7A 2FSAA 5ENJA 4CUUA 4QBMA 5II1A 4TQNA 3O36A 5AD3A 2EJNA 3QZTA 5D3RA 5CQ4A 5DKCA 3D1BA 5CQ7A 4QSQA 4A9LA 5IGKA 3MB4A 5COIA 5EWDA 5C7NA 5ETDA 2I7KA 5J0DA 5L96A 4UYGA 4UYHA 4PS5A 1E6IA 5CZGA 5H1VA 5FFYA 5ENHA 4MENA 5HRXA 5A5SA 4TT2A 4MEPA 5F63A 4NUDA 5LVQA 3GG3A 5LJ2A 5HFRA 5EQ1A 2OO1A 4O71A 5CUEA 2YW5A 5I40A 3U5KA 4HBWA 5HRVA 2RNWA 4A9MA 5D3PA 5FE3A 2R0SA 4NYVA 4QC1A 2F6JA 4QEVA 5HLSA 5FDZA 1JM4B 5CTLA 2DVQA 3UV4A 4N4HA 3LQHA 5F60A 4YYMA 3UVYA 5HQ6A 4YYKA 5C85A 4TYLA 5E3GA 4A9KA 4TTEA 4QEUA 5I29A 2E3KA 5AD2A 5EGUA 4QSPA 5D3SA 4ZW1A 5E9YA 5HELA 4X2IA 4XUAA 4HXSA 5DLZA 2H60A 2DVSA 5EWCA 4Z93A 4LYWA 5EVAA 5HCLA 3UVDA 4BHWA 2NXBA 5IIDA 5DW1A 4FLPA 2N9GA 3JVMA 5FE4A 2DWWA 4TZ8A 5DFCA 1PUOA 4YYNA 5C4QA 4QUUA 5KTWA 2WP2A 4YAXA 4O78A 3DAIA 3TLPA 4NRAA 4PCEA 2YEMA 5I7YA 4LZ2A 4YBMA 5ETBA 5D26A 5FFWA 5DYAA 4MR5A 4YYIA 4XY9A 5CUGA 5D3HA 2D9EA 4NR8A 4AKNA 5FG5A 5HQ5A 5D3TA 4AKIA 4O77A 3SVFA 5LKTA 3P1FA 4J0SA 5A5OA 4PTBA 5FE0A 5DYUA 4IOOA 3P5OA 5CQ3A 2E7OA 4CL9A 1F68A 4O72A 4ZQLA 4NXJA 4QR5A 3P1CA 5KU3A 5DKHA 3ONIA 5IGNA 5H1UA 2R0YA 5EICA 3D1DA 4UIYA 5EK9A 3UVXA 3LQJA 5DKDA 4QZSA 4BW4A 2RFJA 5F61A 3U5LA 5I7XA 5AMEA 4UIZA 5HRWA 4HXOA 5EPSA 4IOQA 2RS9B 5IBNA 5I88A 4UIWA 3QZVA 4J1PA 5LUUA 3HMEA 4NR9A 4YBSA 2GRCA 5EPRA 5A82A 4NUCA 4QSWA 2L5EA 3Q2FA 5D25A 5EV9A 5CUAA 4UIUA 4LDFA 4KV1A 4UYFB 4UYDA 4Z1SA 4TT6A 5EP7A 5F1HA 5LKXA 5KO4A 2YQDA 4TT4A 4HBVA 4HXKA 4QNSA 3O35A 2D82A 4IR4A 5FG6A 2R0VA 3Q2EA 3G0LA 4OGJA 2YELA 5G4RA 4AKGA 2G4AA 4N4FA 5H85A 5CU8A 3RCWA 5A5PA 5II2A 3VKGA 5EWVA 3I3JA 5FH8A 5E9VA 4MEOA 4ZC9A 4DONA 5EPBA 5FB1A 3UW9A 4O7BA 5FFVA 5TCMA 5FH7A 5HENA 4YH3A 5HFQA 4E96A 4A9FA 3MUKA 4NRBA 2MJVB 5A5RA 3MULA 2WP1A 4A9IA 4QSTA 5LJ1A 3K2JA 2YEKA 5I89A 3U5PA 4HXRA 4PY6A 4IR6A 5ENEA 5LKZA 4NR6A 4KV4A 4NYWA 3U5NA 2DVRA 4NYXA 5HJCA 5DFDA 4HXMA 5DYCA 2RNXA 5CQ6A 4QY4A 5F62A 3S91A 4A9NA 2DVVA 5FE8A 5CP5A 3IU5A 5CFWA 4BW2A 3DWYA 4QSVA 2YDWA 5EA1A 5A83A 4PKLA 4O75A 4N3WA 3U5MA 4MR3A 3SVHA 4N4GA 5E73A 5E9KA 2DKWA 5LVRA 5A81A 2RI7A 4YY6A 3O33A 4A9OA 5C8GA 4AI6A 3JVKA 4YY4A 5I83A 4CUQA 5H1TA 4LZSA 4QSUA 5L97A 5BT3A 3U5JA 4Q0NA 3UV5A 4MEQA 5A85A 5FB0A 5ENCA 5BT4A 4N4IA 5IG6A 3JVJA 5ENIA 2L84A 5D3NA 5D7XA 5ENBA 3U5OA 4KCXA 4WHWA 5C87A 3D7CA 5K29A 1WUGA 4XYAA 4UITA 3AQAA 4O7AA 3ERRA 1ZKRA 4CFLA 5IGMA 4F3IA 3G0JA 5F2PA 5FE2A 2KTBB 4QB3A 4WHUA 4OUFA 5JI8A 3ZYUA 4LZRA 4QR3A 5FE7A 4O7FA 5CRMA 4RVRA 4NQMA 4O7CA 5E9MA 1N72A 5KTXA 1EQFA 4QYDA 5LKUA 4Z6HA 3MB3A 4CURA 4UIXA 5FE1A 4UYEA 5D3JA 3LJWA 4CLBA 4YYHA 5EWHA 5E74A
chains in the Genus database with same CATH topology
5A5QA 5EU1A 1X0JA 5AMFA 5I86A 5FH6A 4HBYA 4QSSA 4TZ2A 5CQTA 4O7EA 5CUCA 5D24A 5F36A 4CUPA 5DLXA 3S92A 4LC2A 5E7DA 5EISA 4HXPA 4IORA 5L99A 3MXFA 4UIVA 5E0RA 3SVGA 3P1DA 5DYXA 5A5NA 5FE6A 5ENFA 1ZS5A 4BW1A 4YYGA 4MR4A 4NQNA 3NXBA 2YYNA 5E9IA 4NR5A 4YABA 5JWMA 4O76A 5EI4A 4A9HA 3HMFA 3AADA 4ALGA 3P1EA 4Y03A 4QR4A 4YATA 5KHMA 5FG4A 5CPEA 2RNYA 4Q0OA 4QC3A 5FE9A 5D0CA 4PCIA 3MQMA 5I80A 5L8TA 4YADA 4YH4A 4BJXA 5CUBA 4HXNA 5E3DA 4YBTA 2L85A 4CFKA 4MR6A 5A7CA 2OUOA 4CUSA 5C89A 3UV2A 4UYFA 5CQ5A 4NR4A 4YYJA 5F1LA 4A9JA 5I1QA 4TU6A 1WUMA 4LRGA 4YYDA 5CRZA 3IU6A 5ACYA 5TB6A 4WIVA 5EM3A 4C66A 5DX4A 5DBMA 3HMHA 5BT5A 4J3IA 5D3LA 1JSPB 5DFBA 2OSSA 4TU4A 3JVLA 4QSXA 4GPJA 4IR5A 4CUTA 4Z1QA 5F3AA 5HQ7A 5CGPA 5E9LA 4OGIA 2E7NA 5F5ZA 4NUEA 4O70A 5L98A 4XY8A 4A9EA 4QSRA 4HBXA 4LYIA 5KTUA 4IR3A 5IGLA 5LJ0A 4LYSA 5ENGA 2RO1A 4ALHA 4NS5A 2R10A 5HEMA 4LR6A 4TS8A 4Z6IA 2I8NA 2DATA 4O74A 4QYLA 4YC9A 5EWWA 5G4SA 3UVWA 5DY7A 4BW3A 5CQAA 4J0RA 5FBXA 3LXJA 5FE5A 4NRCA 5CQ8A 5CUDA 5CY9A 4QUTA 4HXLA 4YK0A 5DW2A 3LQIA 4XUBA 5CS8A 5L8UA 3O37A 3QZSA 4QEWA 2LSPB 5F25A 5HM0A 3O34A 3FKMX 4C67A 2F6NA 4NR7A 2FSAA 5ENJA 4CUUA 4QBMA 5II1A 4TQNA 3O36A 5AD3A 3QZTA 5D3RA 5CQ4A 5DKCA 5CQ7A 4QSQA 4A9LA 5IGKA 3MB4A 5COIA 5EWDA 5C7NA 5ETDA 2I7KA 5J0DA 5L96A 4UYGA 4UYHA 4PS5A 1E6IA 5CZGA 5H1VA 5FFYA 5ENHA 4MENA 5HRXA 5A5SA 4TT2A 4MEPA 5F63A 4NUDA 5LVQA 3GG3A 5LJ2A 5HFRA 5EQ1A 2OO1A 4O71A 5CUEA 2YW5A 5I40A 3U5KA 4HBWA 5HRVA 2RNWA 4A9MA 5D3PA 5FE3A 2R0SA 4NYVA 4QC1A 2F6JA 4QEVA 5HLSA 5FDZA 1JM4B 5CTLA 2DVQA 3UV4A 4N4HA 3LQHA 5F60A 4YYMA 3UVYA 5HQ6A 4YYKA 5C85A 4TYLA 5E3GA 4A9KA 4TTEA 4QEUA 5I29A 2E3KA 5AD2A 5EGUA 4QSPA 5D3SA 4ZW1A 5E9YA 5HELA 4X2IA 4XUAA 4HXSA 5DLZA 2H60A 2DVSA 5EWCA 4Z93A 4LYWA 5EVAA 5HCLA 3UVDA 4BHWA 2NXBA 5IIDA 5DW1A 4FLPA 2N9GA 3JVMA 5FE4A 2DWWA 4TZ8A 5DFCA 4YYNA 5C4QA 4QUUA 5KTWA 2WP2A 4YAXA 4O78A 3DAIA 3TLPA 4NRAA 4PCEA 2YEMA 5I7YA 4LZ2A 4YBMA 5ETBA 5D26A 5FFWA 5DYAA 4MR5A 4YYIA 4XY9A 5CUGA 5D3HA 2D9EA 4NR8A 4AKNA 5FG5A 5HQ5A 5D3TA 4O77A 3SVFA 5LKTA 3P1FA 4J0SA 5A5OA 4PTBA 5FE0A 5DYUA 4IOOA 3P5OA 5CQ3A 2E7OA 4CL9A 1F68A 4O72A 4ZQLA 4NXJA 4QR5A 3P1CA 5KU3A 5DKHA 3ONIA 5IGNA 5H1UA 2R0YA 5EICA 4UIYA 5EK9A 3UVXA 3LQJA 5DKDA 4QZSA 4BW4A 2RFJA 5F61A 3U5LA 5I7XA 5AMEA 4UIZA 5HRWA 4HXOA 5EPSA 4IOQA 2RS9B 5IBNA 5I88A 4UIWA 3QZVA 4J1PA 5LUUA 3HMEA 4NR9A 4YBSA 2GRCA 5EPRA 5A82A 4NUCA 4QSWA 2L5EA 3Q2FA 5D25A 5EV9A 5CUAA 4UIUA 4LDFA 4KV1A 4UYFB 4UYDA 4Z1SA 4TT6A 5EP7A 5F1HA 5LKXA 5KO4A 2YQDA 4TT4A 4HBVA 4HXKA 4QNSA 3O35A 2D82A 4IR4A 5FG6A 2R0VA 3Q2EA 3G0LA 4OGJA 2YELA 5G4RA 2G4AA 4N4FA 5H85A 5CU8A 3RCWA 5A5PA 5II2A 5EWVA 3I3JA 5FH8A 5E9VA 4MEOA 4ZC9A 4DONA 5EPBA 5FB1A 3UW9A 4O7BA 5FFVA 5TCMA 5FH7A 5HENA 4YH3A 5HFQA 4E96A 4A9FA 3MUKA 4NRBA 2MJVB 5A5RA 3MULA 2WP1A 4A9IA 4QSTA 5LJ1A 3K2JA 2YEKA 5I89A 3U5PA 4HXRA 4PY6A 4IR6A 5ENEA 5LKZA 4NR6A 4KV4A 4NYWA 3U5NA 2DVRA 4NYXA 5HJCA 5DFDA 4HXMA 5DYCA 2RNXA 5CQ6A 4QY4A 5F62A 3S91A 4A9NA 2DVVA 5FE8A 5CP5A 3IU5A 5CFWA 4BW2A 3DWYA 4QSVA 2YDWA 5EA1A 5A83A 4PKLA 4O75A 4N3WA 3U5MA 4MR3A 3SVHA 4N4GA 5E73A 5E9KA 2DKWA 5LVRA 5A81A 2RI7A 4YY6A 3O33A 4A9OA 5C8GA 3JVKA 4YY4A 5I83A 4CUQA 5H1TA 4LZSA 4QSUA 5L97A 5BT3A 3U5JA 4Q0NA 3UV5A 4MEQA 5A85A 5FB0A 5ENCA 5BT4A 4N4IA 5IG6A 3JVJA 5ENIA 2L84A 5D3NA 5D7XA 5ENBA 3U5OA 4KCXA 4WHWA 5C87A 3D7CA 5K29A 1WUGA 4XYAA 4UITA 3AQAA 4O7AA 4CFLA 5IGMA 4F3IA 3G0JA 5F2PA 5FE2A 2KTBB 4QB3A 4WHUA 4OUFA 5JI8A 3ZYUA 4LZRA 4QR3A 5FE7A 4O7FA 5CRMA 4RVRA 4NQMA 4O7CA 5E9MA 1N72A 5KTXA 1EQFA 4QYDA 5LKUA 4Z6HA 3MB3A 4CURA 4UIXA 5FE1A 4UYEA 5D3JA 3LJWA 4CLBA 4YYHA 5EWHA 5E74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A5Q A;  5EU1 A;  1X0J A;  5AMF A;  5I86 A;  5FH6 A;  4HBY A;  4QSS A;  4TZ2 A;  5CQT A;  4O7E A;  5CUC A;  5D24 A;  5F36 A;  4CUP A;  5DLX A;  3S92 A;  4LC2 A;  5E7D A;  5EIS A;  4HXP A;  4IOR A;  5L99 A;  3MXF A;  4UIV A;  5E0R A;  3SVG A;  3P1D A;  5DYX A;  5A5N A;  5FE6 A;  5ENF A;  1ZS5 A;  4BW1 A;  4YYG A;  4MR4 A;  4NQN A;  3NXB A;  2YYN A;  5E9I A;  4NR5 A;  4YAB A;  5JWM A;  4O76 A;  5EI4 A;  4A9H A;  3HMF A;  3AAD A;  4ALG A;  3P1E A;  4Y03 A;  4QR4 A;  4YAT A;  5KHM A;  5FG4 A;  5CPE A;  2RNY A;  4Q0O A;  4QC3 A;  5FE9 A;  5D0C A;  4PCI A;  3MQM A;  5I80 A;  5L8T A;  4YAD A;  4YH4 A;  4BJX A;  5CUB A;  4HXN A;  5E3D A;  4YBT A;  2L85 A;  4CFK A;  4MR6 A;  5A7C A;  2OUO A;  4CUS A;  5C89 A;  3UV2 A;  4UYF A;  5CQ5 A;  4NR4 A;  4YYJ A;  5F1L A;  4A9J A;  5I1Q A;  4TU6 A;  1WUM A;  4LRG A;  4YYD A;  5CRZ A;  3IU6 A;  5ACY A;  5TB6 A;  4WIV A;  5EM3 A;  4C66 A;  5DX4 A;  5DBM A;  3HMH A;  5BT5 A;  4J3I A;  5D3L A;  1JSP B;  5DFB A;  2OSS A;  4TU4 A;  3JVL A;  4QSX A;  4GPJ A;  4IR5 A;  4CUT A;  4Z1Q A;  5F3A A;  5HQ7 A;  5CGP A;  5E9L A;  4OGI A;  2E7N A;  5F5Z A;  4NUE A;  4O70 A;  5L98 A;  4XY8 A;  4A9E A;  4QSR A;  4HBX A;  4LYI A;  5KTU A;  4IR3 A;  5IGL A;  5LJ0 A;  4LYS A;  5ENG A;  2RO1 A;  4ALH A;  4NS5 A;  2R10 A;  5HEM A;  4LR6 A;  4TS8 A;  4Z6I A;  2I8N A;  2DAT A;  4O74 A;  4QYL A;  4YC9 A;  5EWW A;  5G4S A;  3UVW A;  5DY7 A;  4BW3 A;  5CQA A;  4J0R A;  5FBX A;  3LXJ A;  5FE5 A;  4NRC A;  5CQ8 A;  5CUD A;  5CY9 A;  4QUT A;  4HXL A;  4YK0 A;  5DW2 A;  3LQI A;  4XUB A;  5CS8 A;  5L8U A;  3O37 A;  3QZS A;  4QEW A;  2LSP B;  5F25 A;  5HM0 A;  3O34 A;  3FKM X;  4C67 A;  2F6N A;  4NR7 A;  2FSA A;  5ENJ A;  4CUU A;  4QBM A;  5II1 A;  4TQN A;  3O36 A;  5AD3 A;  3QZT A;  5D3R A;  5CQ4 A;  5DKC A;  5CQ7 A;  4QSQ A;  4A9L A;  5IGK A;  3MB4 A;  5COI A;  5EWD A;  5C7N A;  5ETD A;  2I7K A;  5J0D A;  5L96 A;  4UYG A;  4UYH A;  4PS5 A;  1E6I A;  5CZG A;  5H1V A;  5FFY A;  5ENH A;  4MEN A;  5HRX A;  5A5S A;  4TT2 A;  4MEP A;  5F63 A;  4NUD A;  5LVQ A;  3GG3 A;  5LJ2 A;  5HFR A;  5EQ1 A;  2OO1 A;  4O71 A;  5CUE A;  2YW5 A;  5I40 A;  3U5K A;  4HBW A;  5HRV A;  2RNW A;  4A9M A;  5D3P A;  5FE3 A;  2R0S A;  4NYV A;  4QC1 A;  2F6J A;  4QEV A;  5HLS A;  5FDZ A;  1JM4 B;  5CTL A;  2DVQ A;  3UV4 A;  4N4H A;  3LQH A;  5F60 A;  4YYM A;  3UVY A;  5HQ6 A;  4YYK A;  5C85 A;  4TYL A;  5E3G A;  4A9K A;  4TTE A;  4QEU A;  5I29 A;  2E3K A;  5AD2 A;  5EGU A;  4QSP A;  5D3S A;  4ZW1 A;  5E9Y A;  5HEL A;  4X2I A;  4XUA A;  4HXS A;  5DLZ A;  2H60 A;  2DVS A;  5EWC A;  4Z93 A;  4LYW A;  5EVA A;  5HCL A;  3UVD A;  4BHW A;  2NXB A;  5IID A;  5DW1 A;  4FLP A;  2N9G A;  3JVM A;  5FE4 A;  2DWW A;  4TZ8 A;  5DFC A;  4YYN A;  5C4Q A;  4QUU A;  5KTW A;  2WP2 A;  4YAX A;  4O78 A;  3DAI A;  3TLP A;  4NRA A;  4PCE A;  2YEM A;  5I7Y A;  4LZ2 A;  4YBM A;  5ETB A;  5D26 A;  5FFW A;  5DYA A;  4MR5 A;  4YYI A;  4XY9 A;  5CUG A;  5D3H A;  2D9E A;  4NR8 A;  4AKN A;  5FG5 A;  5HQ5 A;  5D3T A;  4O77 A;  3SVF A;  5LKT A;  3P1F A;  4J0S A;  5A5O A;  4PTB A;  5FE0 A;  5DYU A;  4IOO A;  3P5O A;  5CQ3 A;  2E7O A;  4CL9 A;  1F68 A;  4O72 A;  4ZQL A;  4NXJ A;  4QR5 A;  3P1C A;  5KU3 A;  5DKH A;  3ONI A;  5IGN A;  5H1U A;  2R0Y A;  5EIC A;  4UIY A;  5EK9 A;  3UVX A;  3LQJ A;  5DKD A;  4QZS A;  4BW4 A;  2RFJ A;  5F61 A;  3U5L A;  5I7X A;  5AME A;  4UIZ A;  5HRW A;  4HXO A;  5EPS A;  4IOQ A;  2RS9 B;  5IBN A;  5I88 A;  4UIW A;  3QZV A;  4J1P A;  5LUU A;  3HME A;  4NR9 A;  4YBS A;  2GRC A;  5EPR A;  5A82 A;  4NUC A;  4QSW A;  2L5E A;  3Q2F A;  5D25 A;  5EV9 A;  5CUA A;  4UIU A;  4LDF A;  4KV1 A;  4UYF B;  4UYD A;  4Z1S A;  4TT6 A;  5EP7 A;  5F1H A;  5LKX A;  5KO4 A;  2YQD A;  4TT4 A;  4HBV A;  4HXK A;  4QNS A;  3O35 A;  2D82 A;  4IR4 A;  5FG6 A;  2R0V A;  3Q2E A;  3G0L A;  4OGJ A;  2YEL A;  5G4R A;  2G4A A;  4N4F A;  5H85 A;  5CU8 A;  3RCW A;  5A5P A;  5II2 A;  5EWV A;  3I3J A;  5FH8 A;  5E9V A;  4MEO A;  4ZC9 A;  4DON A;  5EPB A;  5FB1 A;  3UW9 A;  4O7B A;  5FFV A;  5TCM A;  5FH7 A;  5HEN A;  4YH3 A;  5HFQ A;  4E96 A;  4A9F A;  3MUK A;  4NRB A;  2MJV B;  5A5R A;  3MUL A;  2WP1 A;  4A9I A;  4QST A;  5LJ1 A;  3K2J A;  2YEK A;  5I89 A;  3U5P A;  4HXR A;  4PY6 A;  4IR6 A;  5ENE A;  5LKZ A;  4NR6 A;  4KV4 A;  4NYW A;  3U5N A;  2DVR A;  4NYX A;  5HJC A;  5DFD A;  4HXM A;  5DYC A;  2RNX A;  5CQ6 A;  4QY4 A;  5F62 A;  3S91 A;  4A9N A;  2DVV A;  5FE8 A;  5CP5 A;  3IU5 A;  5CFW A;  4BW2 A;  3DWY A;  4QSV A;  2YDW A;  5EA1 A;  5A83 A;  4PKL A;  4O75 A;  4N3W A;  3U5M A;  4MR3 A;  3SVH A;  4N4G A;  5E73 A;  5E9K A;  2DKW A;  5LVR A;  5A81 A;  2RI7 A;  4YY6 A;  3O33 A;  4A9O A;  5C8G A;  3JVK A;  4YY4 A;  5I83 A;  4CUQ A;  5H1T A;  4LZS A;  4QSU A;  5L97 A;  5BT3 A;  3U5J A;  4Q0N A;  3UV5 A;  4MEQ A;  5A85 A;  5FB0 A;  5ENC A;  5BT4 A;  4N4I A;  5IG6 A;  3JVJ A;  5ENI A;  2L84 A;  5D3N A;  5D7X A;  5ENB A;  3U5O A;  4KCX A;  4WHW A;  5C87 A;  3D7C A;  5K29 A;  1WUG A;  4XYA A;  4UIT A;  3AQA A;  4O7A A;  4CFL A;  5IGM A;  4F3I A;  3G0J A;  5F2P A;  5FE2 A;  2KTB B;  4QB3 A;  4WHU A;  4OUF A;  5JI8 A;  3ZYU A;  4LZR A;  4QR3 A;  5FE7 A;  4O7F A;  5CRM A;  4RVR A;  4NQM A;  4O7C A;  5E9M A;  1N72 A;  5KTX A;  1EQF A;  4QYD A;  5LKU A;  4Z6H A;  3MB3 A;  4CUR A;  4UIX A;  5FE1 A;  4UYE A;  5D3J A;  3LJW A;  4CLB A;  4YYH A;  5EWH A;  5E74 A; 
#chains in the Genus database with same CATH topology
 5A5Q A;  5EU1 A;  1X0J A;  3VKH A;  5AMF A;  5I86 A;  5FH6 A;  4HBY A;  4QSS A;  4TZ2 A;  5CQT A;  4AKH A;  4O7E A;  5CUC A;  5D24 A;  5F36 A;  4CUP A;  5DLX A;  3S92 A;  4LC2 A;  5E7D A;  5EIS A;  4HXP A;  4IOR A;  5L99 A;  3MXF A;  4UIV A;  5E0R A;  3SVG A;  3P1D A;  5DYX A;  5A5N A;  5FE6 A;  5ENF A;  1ZS5 A;  4BW1 A;  4YYG A;  4MR4 A;  4NQN A;  3NXB A;  2YYN A;  5E9I A;  4NR5 A;  4YAB A;  5JWM A;  4O76 A;  5EI4 A;  4A9H A;  3HMF A;  3AAD A;  4ALG A;  3P1E A;  4Y03 A;  4QR4 A;  4YAT A;  5KHM A;  5FG4 A;  5CPE A;  2RNY A;  4Q0O A;  4QC3 A;  5FE9 A;  5D0C A;  4PCI A;  3MQM A;  5I80 A;  5L8T A;  4YAD A;  4YH4 A;  4BJX A;  5CUB A;  4HXN A;  5E3D A;  4YBT A;  2L85 A;  4CFK A;  4MR6 A;  5A7C A;  2OUO A;  4CUS A;  5C89 A;  3UV2 A;  4UYF A;  5CQ5 A;  4NR4 A;  4YYJ A;  5F1L A;  4A9J A;  5I1Q A;  4TU6 A;  1WUM A;  4LRG A;  4YYD A;  5CRZ A;  3IU6 A;  5ACY A;  5TB6 A;  4WIV A;  5EM3 A;  4C66 A;  5DX4 A;  5DBM A;  3HMH A;  5BT5 A;  4J3I A;  5D3L A;  1JSP B;  5DFB A;  2OSS A;  4TU4 A;  3JVL A;  4QSX A;  4GPJ A;  4IR5 A;  4CUT A;  4Z1Q A;  5F3A A;  5HQ7 A;  5CGP A;  5E9L A;  4OGI A;  2E7N A;  5F5Z A;  4NUE A;  4O70 A;  5L98 A;  4XY8 A;  4A9E A;  4QSR A;  4HBX A;  4LYI A;  5KTU A;  4IR3 A;  5IGL A;  5LJ0 A;  4LYS A;  5ENG A;  2RO1 A;  4ALH A;  4NS5 A;  2R10 A;  5HEM A;  4LR6 A;  4TS8 A;  4Z6I A;  2I8N A;  2DAT A;  4O74 A;  4QYL A;  4YC9 A;  5EWW A;  5G4S A;  3UVW A;  5DY7 A;  4BW3 A;  5CQA A;  4J0R A;  5FBX A;  3LXJ A;  5FE5 A;  4NRC A;  5CQ8 A;  5CUD A;  5CY9 A;  4QUT A;  4HXL A;  4YK0 A;  5DW2 A;  3LQI A;  4XUB A;  5CS8 A;  5L8U A;  3O37 A;  3QZS A;  4QEW A;  2LSP B;  5F25 A;  5HM0 A;  3O34 A;  3FKM X;  4C67 A;  2F6N A;  4NR7 A;  2FSA A;  5ENJ A;  4CUU A;  4QBM A;  5II1 A;  4TQN A;  3O36 A;  5AD3 A;  2EJN A;  3QZT A;  5D3R A;  5CQ4 A;  5DKC A;  3D1B A;  5CQ7 A;  4QSQ A;  4A9L A;  5IGK A;  3MB4 A;  5COI A;  5EWD A;  5C7N A;  5ETD A;  2I7K A;  5J0D A;  5L96 A;  4UYG A;  4UYH A;  4PS5 A;  1E6I A;  5CZG A;  5H1V A;  5FFY A;  5ENH A;  4MEN A;  5HRX A;  5A5S A;  4TT2 A;  4MEP A;  5F63 A;  4NUD A;  5LVQ A;  3GG3 A;  5LJ2 A;  5HFR A;  5EQ1 A;  2OO1 A;  4O71 A;  5CUE A;  2YW5 A;  5I40 A;  3U5K A;  4HBW A;  5HRV A;  2RNW A;  4A9M A;  5D3P A;  5FE3 A;  2R0S A;  4NYV A;  4QC1 A;  2F6J A;  4QEV A;  5HLS A;  5FDZ A;  1JM4 B;  5CTL A;  2DVQ A;  3UV4 A;  4N4H A;  3LQH A;  5F60 A;  4YYM A;  3UVY A;  5HQ6 A;  4YYK A;  5C85 A;  4TYL A;  5E3G A;  4A9K A;  4TTE A;  4QEU A;  5I29 A;  2E3K A;  5AD2 A;  5EGU A;  4QSP A;  5D3S A;  4ZW1 A;  5E9Y A;  5HEL A;  4X2I A;  4XUA A;  4HXS A;  5DLZ A;  2H60 A;  2DVS A;  5EWC A;  4Z93 A;  4LYW A;  5EVA A;  5HCL A;  3UVD A;  4BHW A;  2NXB A;  5IID A;  5DW1 A;  4FLP A;  2N9G A;  3JVM A;  5FE4 A;  2DWW A;  4TZ8 A;  5DFC A;  1PUO A;  4YYN A;  5C4Q A;  4QUU A;  5KTW A;  2WP2 A;  4YAX A;  4O78 A;  3DAI A;  3TLP A;  4NRA A;  4PCE A;  2YEM A;  5I7Y A;  4LZ2 A;  4YBM A;  5ETB A;  5D26 A;  5FFW A;  5DYA A;  4MR5 A;  4YYI A;  4XY9 A;  5CUG A;  5D3H A;  2D9E A;  4NR8 A;  4AKN A;  5FG5 A;  5HQ5 A;  5D3T A;  4AKI A;  4O77 A;  3SVF A;  5LKT A;  3P1F A;  4J0S A;  5A5O A;  4PTB A;  5FE0 A;  5DYU A;  4IOO A;  3P5O A;  5CQ3 A;  2E7O A;  4CL9 A;  1F68 A;  4O72 A;  4ZQL A;  4NXJ A;  4QR5 A;  3P1C A;  5KU3 A;  5DKH A;  3ONI A;  5IGN A;  5H1U A;  2R0Y A;  5EIC A;  3D1D A;  4UIY A;  5EK9 A;  3UVX A;  3LQJ A;  5DKD A;  4QZS A;  4BW4 A;  2RFJ A;  5F61 A;  3U5L A;  5I7X A;  5AME A;  4UIZ A;  5HRW A;  4HXO A;  5EPS A;  4IOQ A;  2RS9 B;  5IBN A;  5I88 A;  4UIW A;  3QZV A;  4J1P A;  5LUU A;  3HME A;  4NR9 A;  4YBS A;  2GRC A;  5EPR A;  5A82 A;  4NUC A;  4QSW A;  2L5E A;  3Q2F A;  5D25 A;  5EV9 A;  5CUA A;  4UIU A;  4LDF A;  4KV1 A;  4UYF B;  4UYD A;  4Z1S A;  4TT6 A;  5EP7 A;  5F1H A;  5LKX A;  5KO4 A;  2YQD A;  4TT4 A;  4HBV A;  4HXK A;  4QNS A;  3O35 A;  2D82 A;  4IR4 A;  5FG6 A;  2R0V A;  3Q2E A;  3G0L A;  4OGJ A;  2YEL A;  5G4R A;  4AKG A;  2G4A A;  4N4F A;  5H85 A;  5CU8 A;  3RCW A;  5A5P A;  5II2 A;  3VKG A;  5EWV A;  3I3J A;  5FH8 A;  5E9V A;  4MEO A;  4ZC9 A;  4DON A;  5EPB A;  5FB1 A;  3UW9 A;  4O7B A;  5FFV A;  5TCM A;  5FH7 A;  5HEN A;  4YH3 A;  5HFQ A;  4E96 A;  4A9F A;  3MUK A;  4NRB A;  2MJV B;  5A5R A;  3MUL A;  2WP1 A;  4A9I A;  4QST A;  5LJ1 A;  3K2J A;  2YEK A;  5I89 A;  3U5P A;  4HXR A;  4PY6 A;  4IR6 A;  5ENE A;  5LKZ A;  4NR6 A;  4KV4 A;  4NYW A;  3U5N A;  2DVR A;  4NYX A;  5HJC A;  5DFD A;  4HXM A;  5DYC A;  2RNX A;  5CQ6 A;  4QY4 A;  5F62 A;  3S91 A;  4A9N A;  2DVV A;  5FE8 A;  5CP5 A;  3IU5 A;  5CFW A;  4BW2 A;  3DWY A;  4QSV A;  2YDW A;  5EA1 A;  5A83 A;  4PKL A;  4O75 A;  4N3W A;  3U5M A;  4MR3 A;  3SVH A;  4N4G A;  5E73 A;  5E9K A;  2DKW A;  5LVR A;  5A81 A;  2RI7 A;  4YY6 A;  3O33 A;  4A9O A;  5C8G A;  4AI6 A;  3JVK A;  4YY4 A;  5I83 A;  4CUQ A;  5H1T A;  4LZS A;  4QSU A;  5L97 A;  5BT3 A;  3U5J A;  4Q0N A;  3UV5 A;  4MEQ A;  5A85 A;  5FB0 A;  5ENC A;  5BT4 A;  4N4I A;  5IG6 A;  3JVJ A;  5ENI A;  2L84 A;  5D3N A;  5D7X A;  5ENB A;  3U5O A;  4KCX A;  4WHW A;  5C87 A;  3D7C A;  5K29 A;  1WUG A;  4XYA A;  4UIT A;  3AQA A;  4O7A A;  3ERR A;  1ZKR A;  4CFL A;  5IGM A;  4F3I A;  3G0J A;  5F2P A;  5FE2 A;  2KTB B;  4QB3 A;  4WHU A;  4OUF A;  5JI8 A;  3ZYU A;  4LZR A;  4QR3 A;  5FE7 A;  4O7F A;  5CRM A;  4RVR A;  4NQM A;  4O7C A;  5E9M A;  1N72 A;  5KTX A;  1EQF A;  4QYD A;  5LKU A;  4Z6H A;  3MB3 A;  4CUR A;  4UIX A;  5FE1 A;  4UYE A;  5D3J A;  3LJW A;  4CLB A;  4YYH A;  5EWH A;  5E74 A; 
#chains in the Genus database with same CATH homology
 5A5Q A;  5EU1 A;  1X0J A;  5AMF A;  5I86 A;  5FH6 A;  4HBY A;  4QSS A;  4TZ2 A;  5CQT A;  4O7E A;  5CUC A;  5D24 A;  5F36 A;  4CUP A;  5DLX A;  3S92 A;  4LC2 A;  5E7D A;  5EIS A;  4HXP A;  4IOR A;  5L99 A;  3MXF A;  4UIV A;  5E0R A;  3SVG A;  3P1D A;  5DYX A;  5A5N A;  5FE6 A;  5ENF A;  1ZS5 A;  4BW1 A;  4YYG A;  4MR4 A;  4NQN A;  3NXB A;  2YYN A;  5E9I A;  4NR5 A;  4YAB A;  5JWM A;  4O76 A;  5EI4 A;  4A9H A;  3HMF A;  3AAD A;  4ALG A;  3P1E A;  4Y03 A;  4QR4 A;  4YAT A;  5KHM A;  5FG4 A;  5CPE A;  2RNY A;  4Q0O A;  4QC3 A;  5FE9 A;  5D0C A;  4PCI A;  3MQM A;  5I80 A;  5L8T A;  4YAD A;  4YH4 A;  4BJX A;  5CUB A;  4HXN A;  5E3D A;  4YBT A;  2L85 A;  4CFK A;  4MR6 A;  5A7C A;  2OUO A;  4CUS A;  5C89 A;  3UV2 A;  4UYF A;  5CQ5 A;  4NR4 A;  4YYJ A;  5F1L A;  4A9J A;  5I1Q A;  4TU6 A;  1WUM A;  4LRG A;  4YYD A;  5CRZ A;  3IU6 A;  5ACY A;  5TB6 A;  4WIV A;  5EM3 A;  4C66 A;  5DX4 A;  5DBM A;  3HMH A;  5BT5 A;  4J3I A;  5D3L A;  1JSP B;  5DFB A;  2OSS A;  4TU4 A;  3JVL A;  4QSX A;  4GPJ A;  4IR5 A;  4CUT A;  4Z1Q A;  5F3A A;  5HQ7 A;  5CGP A;  5E9L A;  4OGI A;  2E7N A;  5F5Z A;  4NUE A;  4O70 A;  5L98 A;  4XY8 A;  4A9E A;  4QSR A;  4HBX A;  4LYI A;  5KTU A;  4IR3 A;  5IGL A;  5LJ0 A;  4LYS A;  5ENG A;  2RO1 A;  4ALH A;  4NS5 A;  2R10 A;  5HEM A;  4LR6 A;  4TS8 A;  4Z6I A;  2I8N A;  2DAT A;  4O74 A;  4QYL A;  4YC9 A;  5EWW A;  5G4S A;  3UVW A;  5DY7 A;  4BW3 A;  5CQA A;  4J0R A;  5FBX A;  3LXJ A;  5FE5 A;  4NRC A;  5CQ8 A;  5CUD A;  5CY9 A;  4QUT A;  4HXL A;  4YK0 A;  5DW2 A;  3LQI A;  4XUB A;  5CS8 A;  5L8U A;  3O37 A;  3QZS A;  4QEW A;  2LSP B;  5F25 A;  5HM0 A;  3O34 A;  3FKM X;  4C67 A;  2F6N A;  4NR7 A;  2FSA A;  5ENJ A;  4CUU A;  4QBM A;  5II1 A;  4TQN A;  3O36 A;  5AD3 A;  3QZT A;  5D3R A;  5CQ4 A;  5DKC A;  5CQ7 A;  4QSQ A;  4A9L A;  5IGK A;  3MB4 A;  5COI A;  5EWD A;  5C7N A;  5ETD A;  2I7K A;  5J0D A;  5L96 A;  4UYG A;  4UYH A;  4PS5 A;  1E6I A;  5CZG A;  5H1V A;  5FFY A;  5ENH A;  4MEN A;  5HRX A;  5A5S A;  4TT2 A;  4MEP A;  5F63 A;  4NUD A;  5LVQ A;  3GG3 A;  5LJ2 A;  5HFR A;  5EQ1 A;  2OO1 A;  4O71 A;  5CUE A;  2YW5 A;  5I40 A;  3U5K A;  4HBW A;  5HRV A;  2RNW A;  4A9M A;  5D3P A;  5FE3 A;  2R0S A;  4NYV A;  4QC1 A;  2F6J A;  4QEV A;  5HLS A;  5FDZ A;  1JM4 B;  5CTL A;  2DVQ A;  3UV4 A;  4N4H A;  3LQH A;  5F60 A;  4YYM A;  3UVY A;  5HQ6 A;  4YYK A;  5C85 A;  4TYL A;  5E3G A;  4A9K A;  4TTE A;  4QEU A;  5I29 A;  2E3K A;  5AD2 A;  5EGU A;  4QSP A;  5D3S A;  4ZW1 A;  5E9Y A;  5HEL A;  4X2I A;  4XUA A;  4HXS A;  5DLZ A;  2H60 A;  2DVS A;  5EWC A;  4Z93 A;  4LYW A;  5EVA A;  5HCL A;  3UVD A;  4BHW A;  2NXB A;  5IID A;  5DW1 A;  4FLP A;  2N9G A;  3JVM A;  5FE4 A;  2DWW A;  4TZ8 A;  5DFC A;  4YYN A;  5C4Q A;  4QUU A;  5KTW A;  2WP2 A;  4YAX A;  4O78 A;  3DAI A;  3TLP A;  4NRA A;  4PCE A;  2YEM A;  5I7Y A;  4LZ2 A;  4YBM A;  5ETB A;  5D26 A;  5FFW A;  5DYA A;  4MR5 A;  4YYI A;  4XY9 A;  5CUG A;  5D3H A;  2D9E A;  4NR8 A;  4AKN A;  5FG5 A;  5HQ5 A;  5D3T A;  4O77 A;  3SVF A;  5LKT A;  3P1F A;  4J0S A;  5A5O A;  4PTB A;  5FE0 A;  5DYU A;  4IOO A;  3P5O A;  5CQ3 A;  2E7O A;  4CL9 A;  1F68 A;  4O72 A;  4ZQL A;  4NXJ A;  4QR5 A;  3P1C A;  5KU3 A;  5DKH A;  3ONI A;  5IGN A;  5H1U A;  2R0Y A;  5EIC A;  4UIY A;  5EK9 A;  3UVX A;  3LQJ A;  5DKD A;  4QZS A;  4BW4 A;  2RFJ A;  5F61 A;  3U5L A;  5I7X A;  5AME A;  4UIZ A;  5HRW A;  4HXO A;  5EPS A;  4IOQ A;  2RS9 B;  5IBN A;  5I88 A;  4UIW A;  3QZV A;  4J1P A;  5LUU A;  3HME A;  4NR9 A;  4YBS A;  2GRC A;  5EPR A;  5A82 A;  4NUC A;  4QSW A;  2L5E A;  3Q2F A;  5D25 A;  5EV9 A;  5CUA A;  4UIU A;  4LDF A;  4KV1 A;  4UYF B;  4UYD A;  4Z1S A;  4TT6 A;  5EP7 A;  5F1H A;  5LKX A;  5KO4 A;  2YQD A;  4TT4 A;  4HBV A;  4HXK A;  4QNS A;  3O35 A;  2D82 A;  4IR4 A;  5FG6 A;  2R0V A;  3Q2E A;  3G0L A;  4OGJ A;  2YEL A;  5G4R A;  2G4A A;  4N4F A;  5H85 A;  5CU8 A;  3RCW A;  5A5P A;  5II2 A;  5EWV A;  3I3J A;  5FH8 A;  5E9V A;  4MEO A;  4ZC9 A;  4DON A;  5EPB A;  5FB1 A;  3UW9 A;  4O7B A;  5FFV A;  5TCM A;  5FH7 A;  5HEN A;  4YH3 A;  5HFQ A;  4E96 A;  4A9F A;  3MUK A;  4NRB A;  2MJV B;  5A5R A;  3MUL A;  2WP1 A;  4A9I A;  4QST A;  5LJ1 A;  3K2J A;  2YEK A;  5I89 A;  3U5P A;  4HXR A;  4PY6 A;  4IR6 A;  5ENE A;  5LKZ A;  4NR6 A;  4KV4 A;  4NYW A;  3U5N A;  2DVR A;  4NYX A;  5HJC A;  5DFD A;  4HXM A;  5DYC A;  2RNX A;  5CQ6 A;  4QY4 A;  5F62 A;  3S91 A;  4A9N A;  2DVV A;  5FE8 A;  5CP5 A;  3IU5 A;  5CFW A;  4BW2 A;  3DWY A;  4QSV A;  2YDW A;  5EA1 A;  5A83 A;  4PKL A;  4O75 A;  4N3W A;  3U5M A;  4MR3 A;  3SVH A;  4N4G A;  5E73 A;  5E9K A;  2DKW A;  5LVR A;  5A81 A;  2RI7 A;  4YY6 A;  3O33 A;  4A9O A;  5C8G A;  3JVK A;  4YY4 A;  5I83 A;  4CUQ A;  5H1T A;  4LZS A;  4QSU A;  5L97 A;  5BT3 A;  3U5J A;  4Q0N A;  3UV5 A;  4MEQ A;  5A85 A;  5FB0 A;  5ENC A;  5BT4 A;  4N4I A;  5IG6 A;  3JVJ A;  5ENI A;  2L84 A;  5D3N A;  5D7X A;  5ENB A;  3U5O A;  4KCX A;  4WHW A;  5C87 A;  3D7C A;  5K29 A;  1WUG A;  4XYA A;  4UIT A;  3AQA A;  4O7A A;  4CFL A;  5IGM A;  4F3I A;  3G0J A;  5F2P A;  5FE2 A;  2KTB B;  4QB3 A;  4WHU A;  4OUF A;  5JI8 A;  3ZYU A;  4LZR A;  4QR3 A;  5FE7 A;  4O7F A;  5CRM A;  4RVR A;  4NQM A;  4O7C A;  5E9M A;  1N72 A;  5KTX A;  1EQF A;  4QYD A;  5LKU A;  4Z6H A;  3MB3 A;  4CUR A;  4UIX A;  5FE1 A;  4UYE A;  5D3J A;  3LJW A;  4CLB A;  4YYH A;  5EWH A;  5E74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...