3HMHA

Crystal structure of the second bromodomain of human tbp-associated factor rna polymerase 1-like (taf1l)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
139
structure length
139
Chain Sequence
b'GTENLYFQSMQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTAKEAALEEAELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID 210 kDa subunit
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 57
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3hmhA00
3ZYUA 5CQ6A 1X0JA 4YBSA 5L99A 3IU5A 5E3GA 4QSSA 2LSPB 2E7OA 5ENEA 4HXSA 5CU8A 5COIA 4BHWA 2RFJA 4UYDA 5BT4A 5EA1A 5EICA 5E0RA 4ALGA 4KCXA 2DVVA 4Q0NA 4YABA 2YEMA 5DYXA 5F62A 2YEKA 4QEWA 5DFCA 5AMEA 4LC2A 5LKXA 4UIWA 2RS9B 5LUUA 5F3AA 2G4AA 5DYUA 5CUCA 2YQDA 3O37A 4CURA 4BW3A 5DYAA 5D3NA 5DKCA 3O36A 5DW2A 3I3JA 5LJ1A 4CFKA 4TT2A 4Q0OA 5E3DA 2MJVB 4QSRA 5AD2A 5A5RA 5A5OA 4GPJA 4QSWA 5H1UA 5IGMA 5I40A 4Z93A 4QEVA 3GG3A 4J1PA 4HXRA 4TS8A 4YC9A 5D3SA 3Q2EA 3AQAA 2RI7A 4YH3A 5I29A 4A9EA 5FE7A 4QSUA 4TYLA 4NQMA 3P5OA 4YY4A 4YK0A 3O33A 4FLPA 3MULA 3U5JA 4MR3A 4X2IA 4IR4A 3P1CA 4MEPA 4HXOA 4ZQLA 2RNWA 5EP7A 5A5SA 3QZSA 5DBMA 4HBXA 4YY6A 4YBTA 4TU6A 4Z6HA 4YBMA 5FG4A 4Z1SA 5DKDA 4UIVA 4PS5A 4A9MA 4HXLA 5FFYA 5HENA 4QR3A 5HJCA 5L97A 5LJ2A 3NXBA 2FSAA 4QR5A 3LQHA 5ENJA 4QBMA 5EWDA 2GRCA 2YELA 4UYFB 5CUAA 5HQ5A 5ETBA 2D82A 4XUBA 5F25A 5CQTA 3UW9A 4QSXA 5TCMA 4N4HA 5EI4A 5CGPA 3UVXA 5ENBA 4LYWA 5HRXA 4CUTA 2RNYA 4O76A 2F6JA 5EM3A 5F63A 5HM0A 5LKUA 5D25A 4A9JA 5K29A 2RO1A 4CL9A 4XUAA 5DFDA 5E9YA 5D0CA 5DKHA 4A9IA 4NUCA 4QSQA 2YDWA 4A9NA 5A82A 2WP1A 4QYLA 5CQ8A 3SVFA 4N4FA 2DATA 5ETDA 2DVSA 5FE2A 4HXNA 4YYJA 5HELA 3P1EA 5KU3A 3JVMA 5E9VA 4MEQA 3LJWA 5KTXA 3K2JA 5EPBA 2NXBA 4LRGA 5I7XA 4CFLA 5IGKA 5FH6A 5C87A 2E7NA 3G0LA 4J3IA 4QUUA 5KTUA 4MEOA 3ONIA 4YAXA 5ENHA 5CQ5A 3TLPA 4ALHA 4F3IA 4YYHA 4UYGA 2DVRA 4IR3A 3HMHA 4TQNA 4QC3A 4PTBA 4WHUA 4E96A 4AKNA 2R10A 4O7FA 5D3JA 4MR6A 5F1LA 2OUOA 5IGNA 5EQ1A 4HBYA 4NR4A 4UITA 4CUPA 3QZVA 3U5OA 3S91A 5CQ7A 4YYGA 4MR4A 5A5NA 4NYVA 5A81A 4A9HA 3SVHA 3LQJA 5JI8A 5CUBA 5F60A 4NXJA 5E73A 5D3TA 5D3PA 3UV4A 2OO1A 3JVJA 5FFWA 4DONA 4HBWA 5CPEA 3JVKA 5L96A 5CQ4A 5F5ZA 4HBVA 4LR6A 5H1VA 4NUEA 3MB4A 4QSPA 5E9LA 3QZTA 5CRMA 4YADA 5E7DA 5C4QA 3D7CA 4UIYA 5EVAA 5FE5A 4TU4A 2DWWA 3U5PA 5D7XA 5I7YA 4TT6A 5C7NA 5D24A 4O74A 5F1HA 5EPSA 2E3KA 2L85A 5ENCA 5C8GA 2H60A 3U5MA 5G4RA 5II1A 4KV4A 5TB6A 4UIUA 4CLBA 4CUUA 1EQFA 4A9KA 4O7BA 4A9OA 5CFWA 3P1DA 4KV1A 4BW1A 5HRWA 5EPRA 5I83A 5FB1A 5EK9A 1WUGA 5DW1A 4NYXA 4LZRA 1N72A 3MQMA 5CTLA 5DX4A 5D3LA 3U5KA 3FKMX 5CZGA 5H1TA 4NRCA 5EGUA 5J0DA 3JVLA 4TZ2A 4BW4A 5L8TA 4RVRA 3UVDA 5A5PA 4UIZA 5FH8A 4QY4A 5EWWA 4NUDA 4UYFA 3MUKA 3DAIA 5A85A 5BT3A 5FE0A 5D3HA 5E9MA 5C89A 5C85A 5FH7A 5E9IA 4YYMA 4J0SA 4O75A 4CUQA 3UVYA 4MR5A 4QC1A 5G4SA 4O7EA 5HEMA 5ENFA 2R0SA 4IOQA 4YYKA 4N4IA 4O72A 5DLXA 5E9KA 5A5QA 4OGJA 5IG6A 4XYAA 3LQIA 3LXJA 4YH4A 5EWVA 3S92A 4TZ8A 4LDFA 4O77A 5HQ6A 3UVWA 5FE1A 4QEUA 4OGIA 5IIDA 4O70A 4NR7A 4QR4A 5L98A 4TTEA 4UYHA 4QYDA 5FG5A 2D9EA 5L8UA 1JM4B 4LZ2A 5CUGA 5EISA 3UV5A 5KHMA 4XY9A 4N4GA 5I89A 4J0RA 5HFRA 4Z1QA 5HRVA 4NR9A 4O78A 5LVRA 5AMFA 4NYWA 4NRBA 5F2PA 5D3RA 5ACYA 2I7KA 4WHWA 4XY8A 2L5EA 5EV9A 3Q2FA 4NR8A 5HQ7A 5II2A 4IORA 4IR5A 5AD3A 4YYIA 4PCIA 3SVGA 5DY7A 4YYNA 1F68A 1JSPB 2OSSA 3U5LA 4HXPA 4TT4A 2RNXA 4ZC9A 4PY6A 5A7CA 4IR6A 5CS8A 4OUFA 4MENA 4O7CA 5FBXA 5D26A 4IOOA 4HXKA 4NR6A 5FE4A 4ZW1A 3HMFA 4QNSA 5LJ0A 3G0JA 4PCEA 4NS5A 5FE9A 5KTWA 5DLZA 3IU6A 5FDZA 4HXMA 4QB3A 3AADA 5CUDA 5EWCA 4O7AA 4CUSA 4YYDA 5F61A 5LKZA 4O71A 3O34A 5CY9A 5CUEA 5ENIA 2DKWA 3RCWA 3P1FA 4QSTA 5HFQA 2N9GA 5FE6A 5FE8A 2I8NA 5CQAA 2R0YA 4NQNA 5ENGA 5HLSA 5CRZA 5DYCA 4LYIA 4PKLA 5H85A 2F6NA 4NRAA 2KTBB 4BW2A 5F36A 5FE3A 2R0VA 1E6IA 4A9LA 4LYSA 4UIXA 4BJXA 2DVQA 3O35A 5CQ3A 1ZS5A 3MXFA 5I80A 3HMEA 2YW5A 5EU1A 2L84A 5EWHA 3UV2A 3DWYA 5HCLA 5DFBA 5IGLA 5LVQA 5A83A 4NR5A 5FFVA 5FG6A 4N3WA 4A9FA 4QZSA 4Y03A 4UYEA 3U5NA 1WUMA 3MB3A 2WP2A 4LZSA 5IBNA 5I1QA 4WIVA 5I86A 4C66A 4C67A 5E74A 4QSVA 5I88A 5KO4A 2YYNA 5BT5A 5JWMA 4Z6IA 5FB0A 5CP5A 4YATA 5LKTA 4QUTA
chains in the Genus database with same CATH superfamily
3ZYUA 5CQ6A 1X0JA 4YBSA 5L99A 3IU5A 5E3GA 4QSSA 2LSPB 2E7OA 5ENEA 4HXSA 5CU8A 5COIA 4BHWA 2RFJA 4UYDA 5BT4A 5EA1A 5EICA 5E0RA 4ALGA 4KCXA 2DVVA 4Q0NA 4YABA 2YEMA 5DYXA 5F62A 2YEKA 4QEWA 5DFCA 5AMEA 4LC2A 5LKXA 4UIWA 2RS9B 5LUUA 5F3AA 2G4AA 5DYUA 5CUCA 2YQDA 3O37A 4CURA 4BW3A 5DYAA 5D3NA 5DKCA 3O36A 5DW2A 3I3JA 5LJ1A 4CFKA 4TT2A 4Q0OA 5E3DA 2MJVB 4QSRA 5AD2A 5A5RA 5A5OA 4GPJA 4QSWA 5H1UA 5IGMA 5I40A 4Z93A 4QEVA 3GG3A 4J1PA 4HXRA 4TS8A 4YC9A 5D3SA 3Q2EA 3AQAA 2RI7A 4YH3A 5I29A 4A9EA 5FE7A 4QSUA 4TYLA 4NQMA 3P5OA 4YY4A 4YK0A 3O33A 4FLPA 3MULA 3U5JA 4MR3A 4X2IA 4IR4A 3P1CA 4MEPA 4HXOA 4ZQLA 2RNWA 5EP7A 5A5SA 3QZSA 5DBMA 4HBXA 4YY6A 4YBTA 4TU6A 4Z6HA 4YBMA 5FG4A 4Z1SA 4AKIA 5DKDA 4UIVA 4PS5A 4A9MA 4HXLA 5FFYA 5HENA 4QR3A 5HJCA 5L97A 5LJ2A 3NXBA 2FSAA 4QR5A 3LQHA 5ENJA 4QBMA 5EWDA 2GRCA 2YELA 4UYFB 5CUAA 5HQ5A 5ETBA 2D82A 4XUBA 5F25A 5CQTA 3UW9A 4QSXA 5TCMA 4N4HA 5EI4A 5CGPA 3UVXA 5ENBA 4LYWA 5HRXA 4CUTA 2RNYA 4O76A 2F6JA 5EM3A 5F63A 5HM0A 5LKUA 5D25A 4A9JA 4AKGA 5K29A 2RO1A 4CL9A 4XUAA 5DFDA 5E9YA 5D0CA 5DKHA 4A9IA 4NUCA 4QSQA 2YDWA 4A9NA 5A82A 2WP1A 4QYLA 5CQ8A 3SVFA 4N4FA 2DATA 5ETDA 2DVSA 5FE2A 3ERRA 4HXNA 4YYJA 5HELA 3P1EA 5KU3A 3JVMA 5E9VA 4MEQA 3LJWA 5KTXA 3K2JA 5EPBA 2NXBA 4LRGA 5I7XA 4CFLA 5IGKA 5FH6A 5C87A 2E7NA 3G0LA 4J3IA 4QUUA 5KTUA 4MEOA 3ONIA 4YAXA 5ENHA 5CQ5A 3TLPA 4ALHA 4F3IA 4YYHA 4UYGA 2DVRA 4IR3A 3HMHA 4TQNA 4QC3A 4PTBA 4WHUA 4E96A 4AKNA 2R10A 4O7FA 5D3JA 4MR6A 5F1LA 2OUOA 5IGNA 5EQ1A 4HBYA 4NR4A 4UITA 4CUPA 3QZVA 3U5OA 3S91A 5CQ7A 4YYGA 4MR4A 5A5NA 4NYVA 5A81A 4A9HA 3SVHA 3LQJA 5JI8A 5CUBA 5F60A 4NXJA 5E73A 5D3TA 5D3PA 3UV4A 2OO1A 3JVJA 5FFWA 4DONA 4HBWA 5CPEA 3JVKA 5L96A 5CQ4A 5F5ZA 4HBVA 4LR6A 5H1VA 4NUEA 3MB4A 4QSPA 5E9LA 3QZTA 5CRMA 4YADA 5E7DA 5C4QA 3D7CA 4UIYA 5EVAA 5FE5A 4TU4A 2DWWA 3U5PA 5D7XA 5I7YA 4TT6A 5C7NA 5D24A 4O74A 5F1HA 5EPSA 2E3KA 2L85A 5ENCA 5C8GA 2H60A 3U5MA 5G4RA 5II1A 4KV4A 5TB6A 4UIUA 4CLBA 4CUUA 1EQFA 3D1DA 4A9KA 4O7BA 4A9OA 5CFWA 3P1DA 4KV1A 4BW1A 5HRWA 5EPRA 5I83A 5FB1A 1PUOA 5EK9A 1WUGA 5DW1A 4NYXA 4LZRA 1N72A 3MQMA 5CTLA 5DX4A 5D3LA 3U5KA 3FKMX 5CZGA 5H1TA 4NRCA 5EGUA 5J0DA 3JVLA 4TZ2A 4BW4A 5L8TA 4RVRA 3UVDA 5A5PA 4UIZA 5FH8A 4QY4A 5EWWA 4NUDA 4UYFA 3MUKA 3DAIA 5A85A 5BT3A 5FE0A 5D3HA 5E9MA 5C89A 5C85A 5FH7A 5E9IA 4YYMA 4J0SA 4O75A 4CUQA 3UVYA 4MR5A 4QC1A 5G4SA 4O7EA 5HEMA 5ENFA 2R0SA 4IOQA 4YYKA 4N4IA 4O72A 5DLXA 5E9KA 5A5QA 4OGJA 5IG6A 4XYAA 3LQIA 3LXJA 4YH4A 5EWVA 3S92A 4TZ8A 3D1BA 4LDFA 4O77A 5HQ6A 3UVWA 5FE1A 4QEUA 4OGIA 5IIDA 4O70A 4NR7A 4QR4A 5L98A 4TTEA 4UYHA 4QYDA 5FG5A 2D9EA 5L8UA 1JM4B 4LZ2A 5CUGA 5EISA 3UV5A 5KHMA 4XY9A 4N4GA 5I89A 4J0RA 5HFRA 4Z1QA 5HRVA 4NR9A 4O78A 5LVRA 1ZKRA 5AMFA 4NYWA 4NRBA 5F2PA 5D3RA 5ACYA 3VKGA 2I7KA 4WHWA 4XY8A 2L5EA 5EV9A 3Q2FA 4NR8A 5HQ7A 5II2A 4IORA 4IR5A 5AD3A 4YYIA 4PCIA 3SVGA 5DY7A 4YYNA 1F68A 1JSPB 2OSSA 3U5LA 4HXPA 4TT4A 2RNXA 4ZC9A 4PY6A 5A7CA 4IR6A 5CS8A 4OUFA 4MENA 4O7CA 5FBXA 5D26A 4IOOA 4HXKA 4NR6A 5FE4A 4ZW1A 3HMFA 4QNSA 5LJ0A 3G0JA 4PCEA 4NS5A 5FE9A 5KTWA 5DLZA 3IU6A 5FDZA 4HXMA 4QB3A 3AADA 5CUDA 5EWCA 4O7AA 4CUSA 4YYDA 5F61A 5LKZA 3VKHA 4O71A 3O34A 5CY9A 5CUEA 5ENIA 2DKWA 3RCWA 3P1FA 4QSTA 5HFQA 2N9GA 5FE6A 5FE8A 2I8NA 5CQAA 2R0YA 4NQNA 5ENGA 5HLSA 4AKHA 5CRZA 5DYCA 4LYIA 4PKLA 5H85A 2F6NA 4NRAA 2KTBB 4BW2A 5F36A 5FE3A 2R0VA 1E6IA 4A9LA 4LYSA 4UIXA 4BJXA 2DVQA 3O35A 5CQ3A 1ZS5A 3MXFA 5I80A 3HMEA 2YW5A 5EU1A 2L84A 5EWHA 3UV2A 3DWYA 5HCLA 5DFBA 5IGLA 5LVQA 2EJNA 5A83A 4NR5A 5FFVA 5FG6A 4N3WA 4A9FA 4AI6A 4QZSA 4Y03A 4UYEA 3U5NA 1WUMA 3MB3A 2WP2A 4LZSA 5IBNA 5I1QA 4WIVA 5I86A 4C66A 4C67A 5E74A 4QSVA 5I88A 5KO4A 2YYNA 5BT5A 5JWMA 4Z6IA 5FB0A 5CP5A 4YATA 5LKTA 4QUTA
chains in the Genus database with same CATH topology
3ZYUA 5CQ6A 1X0JA 4YBSA 5L99A 3IU5A 5E3GA 4QSSA 2LSPB 2E7OA 5ENEA 4HXSA 5CU8A 5COIA 4BHWA 2RFJA 4UYDA 5BT4A 5EA1A 5EICA 5E0RA 4ALGA 4KCXA 2DVVA 4Q0NA 4YABA 2YEMA 5DYXA 5F62A 2YEKA 4QEWA 5DFCA 5AMEA 4LC2A 5LKXA 4UIWA 2RS9B 5LUUA 5F3AA 2G4AA 5DYUA 5CUCA 2YQDA 3O37A 4CURA 4BW3A 5DYAA 5D3NA 5DKCA 3O36A 5DW2A 3I3JA 5LJ1A 4CFKA 4TT2A 4Q0OA 5E3DA 2MJVB 4QSRA 5AD2A 5A5RA 5A5OA 4GPJA 4QSWA 5H1UA 5IGMA 5I40A 4Z93A 4QEVA 3GG3A 4J1PA 4HXRA 4TS8A 4YC9A 5D3SA 3Q2EA 3AQAA 2RI7A 4YH3A 5I29A 4A9EA 5FE7A 4QSUA 4TYLA 4NQMA 3P5OA 4YY4A 4YK0A 3O33A 4FLPA 3MULA 3U5JA 4MR3A 4X2IA 4IR4A 3P1CA 4MEPA 4HXOA 4ZQLA 2RNWA 5EP7A 5A5SA 3QZSA 5DBMA 4HBXA 4YY6A 4YBTA 4TU6A 4Z6HA 4YBMA 5FG4A 4Z1SA 5DKDA 4UIVA 4PS5A 4A9MA 4HXLA 5FFYA 5HENA 4QR3A 5HJCA 5L97A 5LJ2A 3NXBA 2FSAA 4QR5A 3LQHA 5ENJA 4QBMA 5EWDA 2GRCA 2YELA 4UYFB 5CUAA 5HQ5A 5ETBA 2D82A 4XUBA 5F25A 5CQTA 3UW9A 4QSXA 5TCMA 4N4HA 5EI4A 5CGPA 3UVXA 5ENBA 4LYWA 5HRXA 4CUTA 2RNYA 4O76A 2F6JA 5EM3A 5F63A 5HM0A 5LKUA 5D25A 4A9JA 5K29A 2RO1A 4CL9A 4XUAA 5DFDA 5E9YA 5D0CA 5DKHA 4A9IA 4NUCA 4QSQA 2YDWA 4A9NA 5A82A 2WP1A 4QYLA 5CQ8A 3SVFA 4N4FA 2DATA 5ETDA 2DVSA 5FE2A 4HXNA 4YYJA 5HELA 3P1EA 5KU3A 3JVMA 5E9VA 4MEQA 3LJWA 5KTXA 3K2JA 5EPBA 2NXBA 4LRGA 5I7XA 4CFLA 5IGKA 5FH6A 5C87A 2E7NA 3G0LA 4J3IA 4QUUA 5KTUA 4MEOA 3ONIA 4YAXA 5ENHA 5CQ5A 3TLPA 4ALHA 4F3IA 4YYHA 4UYGA 2DVRA 4IR3A 3HMHA 4TQNA 4QC3A 4PTBA 4WHUA 4E96A 4AKNA 2R10A 4O7FA 5D3JA 4MR6A 5F1LA 2OUOA 5IGNA 5EQ1A 4HBYA 4NR4A 4UITA 4CUPA 3QZVA 3U5OA 3S91A 5CQ7A 4YYGA 4MR4A 5A5NA 4NYVA 5A81A 4A9HA 3SVHA 3LQJA 5JI8A 5CUBA 5F60A 4NXJA 5E73A 5D3TA 5D3PA 3UV4A 2OO1A 3JVJA 5FFWA 4DONA 4HBWA 5CPEA 3JVKA 5L96A 5CQ4A 5F5ZA 4HBVA 4LR6A 5H1VA 4NUEA 3MB4A 4QSPA 5E9LA 3QZTA 5CRMA 4YADA 5E7DA 5C4QA 3D7CA 4UIYA 5EVAA 5FE5A 4TU4A 2DWWA 3U5PA 5D7XA 5I7YA 4TT6A 5C7NA 5D24A 4O74A 5F1HA 5EPSA 2E3KA 2L85A 5ENCA 5C8GA 2H60A 3U5MA 5G4RA 5II1A 4KV4A 5TB6A 4UIUA 4CLBA 4CUUA 1EQFA 4A9KA 4O7BA 4A9OA 5CFWA 3P1DA 4KV1A 4BW1A 5HRWA 5EPRA 5I83A 5FB1A 5EK9A 1WUGA 5DW1A 4NYXA 4LZRA 1N72A 3MQMA 5CTLA 5DX4A 5D3LA 3U5KA 3FKMX 5CZGA 5H1TA 4NRCA 5EGUA 5J0DA 3JVLA 4TZ2A 4BW4A 5L8TA 4RVRA 3UVDA 5A5PA 4UIZA 5FH8A 4QY4A 5EWWA 4NUDA 4UYFA 3MUKA 3DAIA 5A85A 5BT3A 5FE0A 5D3HA 5E9MA 5C89A 5C85A 5FH7A 5E9IA 4YYMA 4J0SA 4O75A 4CUQA 3UVYA 4MR5A 4QC1A 5G4SA 4O7EA 5HEMA 5ENFA 2R0SA 4IOQA 4YYKA 4N4IA 4O72A 5DLXA 5E9KA 5A5QA 4OGJA 5IG6A 4XYAA 3LQIA 3LXJA 4YH4A 5EWVA 3S92A 4TZ8A 4LDFA 4O77A 5HQ6A 3UVWA 5FE1A 4QEUA 4OGIA 5IIDA 4O70A 4NR7A 4QR4A 5L98A 4TTEA 4UYHA 4QYDA 5FG5A 2D9EA 5L8UA 1JM4B 4LZ2A 5CUGA 5EISA 3UV5A 5KHMA 4XY9A 4N4GA 5I89A 4J0RA 5HFRA 4Z1QA 5HRVA 4NR9A 4O78A 5LVRA 5AMFA 4NYWA 4NRBA 5F2PA 5D3RA 5ACYA 2I7KA 4WHWA 4XY8A 2L5EA 5EV9A 3Q2FA 4NR8A 5HQ7A 5II2A 4IORA 4IR5A 5AD3A 4YYIA 4PCIA 3SVGA 5DY7A 4YYNA 1F68A 1JSPB 2OSSA 3U5LA 4HXPA 4TT4A 2RNXA 4ZC9A 4PY6A 5A7CA 4IR6A 5CS8A 4OUFA 4MENA 4O7CA 5FBXA 5D26A 4IOOA 4HXKA 4NR6A 5FE4A 4ZW1A 3HMFA 4QNSA 5LJ0A 3G0JA 4PCEA 4NS5A 5FE9A 5KTWA 5DLZA 3IU6A 5FDZA 4HXMA 4QB3A 3AADA 5CUDA 5EWCA 4O7AA 4CUSA 4YYDA 5F61A 5LKZA 4O71A 3O34A 5CY9A 5CUEA 5ENIA 2DKWA 3RCWA 3P1FA 4QSTA 5HFQA 2N9GA 5FE6A 5FE8A 2I8NA 5CQAA 2R0YA 4NQNA 5ENGA 5HLSA 5CRZA 5DYCA 4LYIA 4PKLA 5H85A 2F6NA 4NRAA 2KTBB 4BW2A 5F36A 5FE3A 2R0VA 1E6IA 4A9LA 4LYSA 4UIXA 4BJXA 2DVQA 3O35A 5CQ3A 1ZS5A 3MXFA 5I80A 3HMEA 2YW5A 5EU1A 2L84A 5EWHA 3UV2A 3DWYA 5HCLA 5DFBA 5IGLA 5LVQA 5A83A 4NR5A 5FFVA 5FG6A 4N3WA 4A9FA 4QZSA 4Y03A 4UYEA 3U5NA 1WUMA 3MB3A 2WP2A 4LZSA 5IBNA 5I1QA 4WIVA 5I86A 4C66A 4C67A 5E74A 4QSVA 5I88A 5KO4A 2YYNA 5BT5A 5JWMA 4Z6IA 5FB0A 5CP5A 4YATA 5LKTA 4QUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYU A;  5CQ6 A;  1X0J A;  4YBS A;  5L99 A;  3IU5 A;  5E3G A;  4QSS A;  2LSP B;  2E7O A;  5ENE A;  4HXS A;  5CU8 A;  5COI A;  4BHW A;  2RFJ A;  4UYD A;  5BT4 A;  5EA1 A;  5EIC A;  5E0R A;  4ALG A;  4KCX A;  2DVV A;  4Q0N A;  4YAB A;  2YEM A;  5DYX A;  5F62 A;  2YEK A;  4QEW A;  5DFC A;  5AME A;  4LC2 A;  5LKX A;  4UIW A;  2RS9 B;  5LUU A;  5F3A A;  2G4A A;  5DYU A;  5CUC A;  2YQD A;  3O37 A;  4CUR A;  4BW3 A;  5DYA A;  5D3N A;  5DKC A;  3O36 A;  5DW2 A;  3I3J A;  5LJ1 A;  4CFK A;  4TT2 A;  4Q0O A;  5E3D A;  2MJV B;  4QSR A;  5AD2 A;  5A5R A;  5A5O A;  4GPJ A;  4QSW A;  5H1U A;  5IGM A;  5I40 A;  4Z93 A;  4QEV A;  3GG3 A;  4J1P A;  4HXR A;  4TS8 A;  4YC9 A;  5D3S A;  3Q2E A;  3AQA A;  2RI7 A;  4YH3 A;  5I29 A;  4A9E A;  5FE7 A;  4QSU A;  4TYL A;  4NQM A;  3P5O A;  4YY4 A;  4YK0 A;  3O33 A;  4FLP A;  3MUL A;  3U5J A;  4MR3 A;  4X2I A;  4IR4 A;  3P1C A;  4MEP A;  4HXO A;  4ZQL A;  2RNW A;  5EP7 A;  5A5S A;  3QZS A;  5DBM A;  4HBX A;  4YY6 A;  4YBT A;  4TU6 A;  4Z6H A;  4YBM A;  5FG4 A;  4Z1S A;  5DKD A;  4UIV A;  4PS5 A;  4A9M A;  4HXL A;  5FFY A;  5HEN A;  4QR3 A;  5HJC A;  5L97 A;  5LJ2 A;  3NXB A;  2FSA A;  4QR5 A;  3LQH A;  5ENJ A;  4QBM A;  5EWD A;  2GRC A;  2YEL A;  4UYF B;  5CUA A;  5HQ5 A;  5ETB A;  2D82 A;  4XUB A;  5F25 A;  5CQT A;  3UW9 A;  4QSX A;  5TCM A;  4N4H A;  5EI4 A;  5CGP A;  3UVX A;  5ENB A;  4LYW A;  5HRX A;  4CUT A;  2RNY A;  4O76 A;  2F6J A;  5EM3 A;  5F63 A;  5HM0 A;  5LKU A;  5D25 A;  4A9J A;  5K29 A;  2RO1 A;  4CL9 A;  4XUA A;  5DFD A;  5E9Y A;  5D0C A;  5DKH A;  4A9I A;  4NUC A;  4QSQ A;  2YDW A;  4A9N A;  5A82 A;  2WP1 A;  4QYL A;  5CQ8 A;  3SVF A;  4N4F A;  2DAT A;  5ETD A;  2DVS A;  5FE2 A;  4HXN A;  4YYJ A;  5HEL A;  3P1E A;  5KU3 A;  3JVM A;  5E9V A;  4MEQ A;  3LJW A;  5KTX A;  3K2J A;  5EPB A;  2NXB A;  4LRG A;  5I7X A;  4CFL A;  5IGK A;  5FH6 A;  5C87 A;  2E7N A;  3G0L A;  4J3I A;  4QUU A;  5KTU A;  4MEO A;  3ONI A;  4YAX A;  5ENH A;  5CQ5 A;  3TLP A;  4ALH A;  4F3I A;  4YYH A;  4UYG A;  2DVR A;  4IR3 A;  3HMH A;  4TQN A;  4QC3 A;  4PTB A;  4WHU A;  4E96 A;  4AKN A;  2R10 A;  4O7F A;  5D3J A;  4MR6 A;  5F1L A;  2OUO A;  5IGN A;  5EQ1 A;  4HBY A;  4NR4 A;  4UIT A;  4CUP A;  3QZV A;  3U5O A;  3S91 A;  5CQ7 A;  4YYG A;  4MR4 A;  5A5N A;  4NYV A;  5A81 A;  4A9H A;  3SVH A;  3LQJ A;  5JI8 A;  5CUB A;  5F60 A;  4NXJ A;  5E73 A;  5D3T A;  5D3P A;  3UV4 A;  2OO1 A;  3JVJ A;  5FFW A;  4DON A;  4HBW A;  5CPE A;  3JVK A;  5L96 A;  5CQ4 A;  5F5Z A;  4HBV A;  4LR6 A;  5H1V A;  4NUE A;  3MB4 A;  4QSP A;  5E9L A;  3QZT A;  5CRM A;  4YAD A;  5E7D A;  5C4Q A;  3D7C A;  4UIY A;  5EVA A;  5FE5 A;  4TU4 A;  2DWW A;  3U5P A;  5D7X A;  5I7Y A;  4TT6 A;  5C7N A;  5D24 A;  4O74 A;  5F1H A;  5EPS A;  2E3K A;  2L85 A;  5ENC A;  5C8G A;  2H60 A;  3U5M A;  5G4R A;  5II1 A;  4KV4 A;  5TB6 A;  4UIU A;  4CLB A;  4CUU A;  1EQF A;  4A9K A;  4O7B A;  4A9O A;  5CFW A;  3P1D A;  4KV1 A;  4BW1 A;  5HRW A;  5EPR A;  5I83 A;  5FB1 A;  5EK9 A;  1WUG A;  5DW1 A;  4NYX A;  4LZR A;  1N72 A;  3MQM A;  5CTL A;  5DX4 A;  5D3L A;  3U5K A;  3FKM X;  5CZG A;  5H1T A;  4NRC A;  5EGU A;  5J0D A;  3JVL A;  4TZ2 A;  4BW4 A;  5L8T A;  4RVR A;  3UVD A;  5A5P A;  4UIZ A;  5FH8 A;  4QY4 A;  5EWW A;  4NUD A;  4UYF A;  3MUK A;  3DAI A;  5A85 A;  5BT3 A;  5FE0 A;  5D3H A;  5E9M A;  5C89 A;  5C85 A;  5FH7 A;  5E9I A;  4YYM A;  4J0S A;  4O75 A;  4CUQ A;  3UVY A;  4MR5 A;  4QC1 A;  5G4S A;  4O7E A;  5HEM A;  5ENF A;  2R0S A;  4IOQ A;  4YYK A;  4N4I A;  4O72 A;  5DLX A;  5E9K A;  5A5Q A;  4OGJ A;  5IG6 A;  4XYA A;  3LQI A;  3LXJ A;  4YH4 A;  5EWV A;  3S92 A;  4TZ8 A;  4LDF A;  4O77 A;  5HQ6 A;  3UVW A;  5FE1 A;  4QEU A;  4OGI A;  5IID A;  4O70 A;  4NR7 A;  4QR4 A;  5L98 A;  4TTE A;  4UYH A;  4QYD A;  5FG5 A;  2D9E A;  5L8U A;  1JM4 B;  4LZ2 A;  5CUG A;  5EIS A;  3UV5 A;  5KHM A;  4XY9 A;  4N4G A;  5I89 A;  4J0R A;  5HFR A;  4Z1Q A;  5HRV A;  4NR9 A;  4O78 A;  5LVR A;  5AMF A;  4NYW A;  4NRB A;  5F2P A;  5D3R A;  5ACY A;  2I7K A;  4WHW A;  4XY8 A;  2L5E A;  5EV9 A;  3Q2F A;  4NR8 A;  5HQ7 A;  5II2 A;  4IOR A;  4IR5 A;  5AD3 A;  4YYI A;  4PCI A;  3SVG A;  5DY7 A;  4YYN A;  1F68 A;  1JSP B;  2OSS A;  3U5L A;  4HXP A;  4TT4 A;  2RNX A;  4ZC9 A;  4PY6 A;  5A7C A;  4IR6 A;  5CS8 A;  4OUF A;  4MEN A;  4O7C A;  5FBX A;  5D26 A;  4IOO A;  4HXK A;  4NR6 A;  5FE4 A;  4ZW1 A;  3HMF A;  4QNS A;  5LJ0 A;  3G0J A;  4PCE A;  4NS5 A;  5FE9 A;  5KTW A;  5DLZ A;  3IU6 A;  5FDZ A;  4HXM A;  4QB3 A;  3AAD A;  5CUD A;  5EWC A;  4O7A A;  4CUS A;  4YYD A;  5F61 A;  5LKZ A;  4O71 A;  3O34 A;  5CY9 A;  5CUE A;  5ENI A;  2DKW A;  3RCW A;  3P1F A;  4QST A;  5HFQ A;  2N9G A;  5FE6 A;  5FE8 A;  2I8N A;  5CQA A;  2R0Y A;  4NQN A;  5ENG A;  5HLS A;  5CRZ A;  5DYC A;  4LYI A;  4PKL A;  5H85 A;  2F6N A;  4NRA A;  2KTB B;  4BW2 A;  5F36 A;  5FE3 A;  2R0V A;  1E6I A;  4A9L A;  4LYS A;  4UIX A;  4BJX A;  2DVQ A;  3O35 A;  5CQ3 A;  1ZS5 A;  3MXF A;  5I80 A;  3HME A;  2YW5 A;  5EU1 A;  2L84 A;  5EWH A;  3UV2 A;  3DWY A;  5HCL A;  5DFB A;  5IGL A;  5LVQ A;  5A83 A;  4NR5 A;  5FFV A;  5FG6 A;  4N3W A;  4A9F A;  4QZS A;  4Y03 A;  4UYE A;  3U5N A;  1WUM A;  3MB3 A;  2WP2 A;  4LZS A;  5IBN A;  5I1Q A;  4WIV A;  5I86 A;  4C66 A;  4C67 A;  5E74 A;  4QSV A;  5I88 A;  5KO4 A;  2YYN A;  5BT5 A;  5JWM A;  4Z6I A;  5FB0 A;  5CP5 A;  4YAT A;  5LKT A;  4QUT A; 
#chains in the Genus database with same CATH topology
 3ZYU A;  5CQ6 A;  1X0J A;  4YBS A;  5L99 A;  3IU5 A;  5E3G A;  4QSS A;  2LSP B;  2E7O A;  5ENE A;  4HXS A;  5CU8 A;  5COI A;  4BHW A;  2RFJ A;  4UYD A;  5BT4 A;  5EA1 A;  5EIC A;  5E0R A;  4ALG A;  4KCX A;  2DVV A;  4Q0N A;  4YAB A;  2YEM A;  5DYX A;  5F62 A;  2YEK A;  4QEW A;  5DFC A;  5AME A;  4LC2 A;  5LKX A;  4UIW A;  2RS9 B;  5LUU A;  5F3A A;  2G4A A;  5DYU A;  5CUC A;  2YQD A;  3O37 A;  4CUR A;  4BW3 A;  5DYA A;  5D3N A;  5DKC A;  3O36 A;  5DW2 A;  3I3J A;  5LJ1 A;  4CFK A;  4TT2 A;  4Q0O A;  5E3D A;  2MJV B;  4QSR A;  5AD2 A;  5A5R A;  5A5O A;  4GPJ A;  4QSW A;  5H1U A;  5IGM A;  5I40 A;  4Z93 A;  4QEV A;  3GG3 A;  4J1P A;  4HXR A;  4TS8 A;  4YC9 A;  5D3S A;  3Q2E A;  3AQA A;  2RI7 A;  4YH3 A;  5I29 A;  4A9E A;  5FE7 A;  4QSU A;  4TYL A;  4NQM A;  3P5O A;  4YY4 A;  4YK0 A;  3O33 A;  4FLP A;  3MUL A;  3U5J A;  4MR3 A;  4X2I A;  4IR4 A;  3P1C A;  4MEP A;  4HXO A;  4ZQL A;  2RNW A;  5EP7 A;  5A5S A;  3QZS A;  5DBM A;  4HBX A;  4YY6 A;  4YBT A;  4TU6 A;  4Z6H A;  4YBM A;  5FG4 A;  4Z1S A;  4AKI A;  5DKD A;  4UIV A;  4PS5 A;  4A9M A;  4HXL A;  5FFY A;  5HEN A;  4QR3 A;  5HJC A;  5L97 A;  5LJ2 A;  3NXB A;  2FSA A;  4QR5 A;  3LQH A;  5ENJ A;  4QBM A;  5EWD A;  2GRC A;  2YEL A;  4UYF B;  5CUA A;  5HQ5 A;  5ETB A;  2D82 A;  4XUB A;  5F25 A;  5CQT A;  3UW9 A;  4QSX A;  5TCM A;  4N4H A;  5EI4 A;  5CGP A;  3UVX A;  5ENB A;  4LYW A;  5HRX A;  4CUT A;  2RNY A;  4O76 A;  2F6J A;  5EM3 A;  5F63 A;  5HM0 A;  5LKU A;  5D25 A;  4A9J A;  4AKG A;  5K29 A;  2RO1 A;  4CL9 A;  4XUA A;  5DFD A;  5E9Y A;  5D0C A;  5DKH A;  4A9I A;  4NUC A;  4QSQ A;  2YDW A;  4A9N A;  5A82 A;  2WP1 A;  4QYL A;  5CQ8 A;  3SVF A;  4N4F A;  2DAT A;  5ETD A;  2DVS A;  5FE2 A;  3ERR A;  4HXN A;  4YYJ A;  5HEL A;  3P1E A;  5KU3 A;  3JVM A;  5E9V A;  4MEQ A;  3LJW A;  5KTX A;  3K2J A;  5EPB A;  2NXB A;  4LRG A;  5I7X A;  4CFL A;  5IGK A;  5FH6 A;  5C87 A;  2E7N A;  3G0L A;  4J3I A;  4QUU A;  5KTU A;  4MEO A;  3ONI A;  4YAX A;  5ENH A;  5CQ5 A;  3TLP A;  4ALH A;  4F3I A;  4YYH A;  4UYG A;  2DVR A;  4IR3 A;  3HMH A;  4TQN A;  4QC3 A;  4PTB A;  4WHU A;  4E96 A;  4AKN A;  2R10 A;  4O7F A;  5D3J A;  4MR6 A;  5F1L A;  2OUO A;  5IGN A;  5EQ1 A;  4HBY A;  4NR4 A;  4UIT A;  4CUP A;  3QZV A;  3U5O A;  3S91 A;  5CQ7 A;  4YYG A;  4MR4 A;  5A5N A;  4NYV A;  5A81 A;  4A9H A;  3SVH A;  3LQJ A;  5JI8 A;  5CUB A;  5F60 A;  4NXJ A;  5E73 A;  5D3T A;  5D3P A;  3UV4 A;  2OO1 A;  3JVJ A;  5FFW A;  4DON A;  4HBW A;  5CPE A;  3JVK A;  5L96 A;  5CQ4 A;  5F5Z A;  4HBV A;  4LR6 A;  5H1V A;  4NUE A;  3MB4 A;  4QSP A;  5E9L A;  3QZT A;  5CRM A;  4YAD A;  5E7D A;  5C4Q A;  3D7C A;  4UIY A;  5EVA A;  5FE5 A;  4TU4 A;  2DWW A;  3U5P A;  5D7X A;  5I7Y A;  4TT6 A;  5C7N A;  5D24 A;  4O74 A;  5F1H A;  5EPS A;  2E3K A;  2L85 A;  5ENC A;  5C8G A;  2H60 A;  3U5M A;  5G4R A;  5II1 A;  4KV4 A;  5TB6 A;  4UIU A;  4CLB A;  4CUU A;  1EQF A;  3D1D A;  4A9K A;  4O7B A;  4A9O A;  5CFW A;  3P1D A;  4KV1 A;  4BW1 A;  5HRW A;  5EPR A;  5I83 A;  5FB1 A;  1PUO A;  5EK9 A;  1WUG A;  5DW1 A;  4NYX A;  4LZR A;  1N72 A;  3MQM A;  5CTL A;  5DX4 A;  5D3L A;  3U5K A;  3FKM X;  5CZG A;  5H1T A;  4NRC A;  5EGU A;  5J0D A;  3JVL A;  4TZ2 A;  4BW4 A;  5L8T A;  4RVR A;  3UVD A;  5A5P A;  4UIZ A;  5FH8 A;  4QY4 A;  5EWW A;  4NUD A;  4UYF A;  3MUK A;  3DAI A;  5A85 A;  5BT3 A;  5FE0 A;  5D3H A;  5E9M A;  5C89 A;  5C85 A;  5FH7 A;  5E9I A;  4YYM A;  4J0S A;  4O75 A;  4CUQ A;  3UVY A;  4MR5 A;  4QC1 A;  5G4S A;  4O7E A;  5HEM A;  5ENF A;  2R0S A;  4IOQ A;  4YYK A;  4N4I A;  4O72 A;  5DLX A;  5E9K A;  5A5Q A;  4OGJ A;  5IG6 A;  4XYA A;  3LQI A;  3LXJ A;  4YH4 A;  5EWV A;  3S92 A;  4TZ8 A;  3D1B A;  4LDF A;  4O77 A;  5HQ6 A;  3UVW A;  5FE1 A;  4QEU A;  4OGI A;  5IID A;  4O70 A;  4NR7 A;  4QR4 A;  5L98 A;  4TTE A;  4UYH A;  4QYD A;  5FG5 A;  2D9E A;  5L8U A;  1JM4 B;  4LZ2 A;  5CUG A;  5EIS A;  3UV5 A;  5KHM A;  4XY9 A;  4N4G A;  5I89 A;  4J0R A;  5HFR A;  4Z1Q A;  5HRV A;  4NR9 A;  4O78 A;  5LVR A;  1ZKR A;  5AMF A;  4NYW A;  4NRB A;  5F2P A;  5D3R A;  5ACY A;  3VKG A;  2I7K A;  4WHW A;  4XY8 A;  2L5E A;  5EV9 A;  3Q2F A;  4NR8 A;  5HQ7 A;  5II2 A;  4IOR A;  4IR5 A;  5AD3 A;  4YYI A;  4PCI A;  3SVG A;  5DY7 A;  4YYN A;  1F68 A;  1JSP B;  2OSS A;  3U5L A;  4HXP A;  4TT4 A;  2RNX A;  4ZC9 A;  4PY6 A;  5A7C A;  4IR6 A;  5CS8 A;  4OUF A;  4MEN A;  4O7C A;  5FBX A;  5D26 A;  4IOO A;  4HXK A;  4NR6 A;  5FE4 A;  4ZW1 A;  3HMF A;  4QNS A;  5LJ0 A;  3G0J A;  4PCE A;  4NS5 A;  5FE9 A;  5KTW A;  5DLZ A;  3IU6 A;  5FDZ A;  4HXM A;  4QB3 A;  3AAD A;  5CUD A;  5EWC A;  4O7A A;  4CUS A;  4YYD A;  5F61 A;  5LKZ A;  3VKH A;  4O71 A;  3O34 A;  5CY9 A;  5CUE A;  5ENI A;  2DKW A;  3RCW A;  3P1F A;  4QST A;  5HFQ A;  2N9G A;  5FE6 A;  5FE8 A;  2I8N A;  5CQA A;  2R0Y A;  4NQN A;  5ENG A;  5HLS A;  4AKH A;  5CRZ A;  5DYC A;  4LYI A;  4PKL A;  5H85 A;  2F6N A;  4NRA A;  2KTB B;  4BW2 A;  5F36 A;  5FE3 A;  2R0V A;  1E6I A;  4A9L A;  4LYS A;  4UIX A;  4BJX A;  2DVQ A;  3O35 A;  5CQ3 A;  1ZS5 A;  3MXF A;  5I80 A;  3HME A;  2YW5 A;  5EU1 A;  2L84 A;  5EWH A;  3UV2 A;  3DWY A;  5HCL A;  5DFB A;  5IGL A;  5LVQ A;  2EJN A;  5A83 A;  4NR5 A;  5FFV A;  5FG6 A;  4N3W A;  4A9F A;  4AI6 A;  4QZS A;  4Y03 A;  4UYE A;  3U5N A;  1WUM A;  3MB3 A;  2WP2 A;  4LZS A;  5IBN A;  5I1Q A;  4WIV A;  5I86 A;  4C66 A;  4C67 A;  5E74 A;  4QSV A;  5I88 A;  5KO4 A;  2YYN A;  5BT5 A;  5JWM A;  4Z6I A;  5FB0 A;  5CP5 A;  4YAT A;  5LKT A;  4QUT A; 
#chains in the Genus database with same CATH homology
 3ZYU A;  5CQ6 A;  1X0J A;  4YBS A;  5L99 A;  3IU5 A;  5E3G A;  4QSS A;  2LSP B;  2E7O A;  5ENE A;  4HXS A;  5CU8 A;  5COI A;  4BHW A;  2RFJ A;  4UYD A;  5BT4 A;  5EA1 A;  5EIC A;  5E0R A;  4ALG A;  4KCX A;  2DVV A;  4Q0N A;  4YAB A;  2YEM A;  5DYX A;  5F62 A;  2YEK A;  4QEW A;  5DFC A;  5AME A;  4LC2 A;  5LKX A;  4UIW A;  2RS9 B;  5LUU A;  5F3A A;  2G4A A;  5DYU A;  5CUC A;  2YQD A;  3O37 A;  4CUR A;  4BW3 A;  5DYA A;  5D3N A;  5DKC A;  3O36 A;  5DW2 A;  3I3J A;  5LJ1 A;  4CFK A;  4TT2 A;  4Q0O A;  5E3D A;  2MJV B;  4QSR A;  5AD2 A;  5A5R A;  5A5O A;  4GPJ A;  4QSW A;  5H1U A;  5IGM A;  5I40 A;  4Z93 A;  4QEV A;  3GG3 A;  4J1P A;  4HXR A;  4TS8 A;  4YC9 A;  5D3S A;  3Q2E A;  3AQA A;  2RI7 A;  4YH3 A;  5I29 A;  4A9E A;  5FE7 A;  4QSU A;  4TYL A;  4NQM A;  3P5O A;  4YY4 A;  4YK0 A;  3O33 A;  4FLP A;  3MUL A;  3U5J A;  4MR3 A;  4X2I A;  4IR4 A;  3P1C A;  4MEP A;  4HXO A;  4ZQL A;  2RNW A;  5EP7 A;  5A5S A;  3QZS A;  5DBM A;  4HBX A;  4YY6 A;  4YBT A;  4TU6 A;  4Z6H A;  4YBM A;  5FG4 A;  4Z1S A;  5DKD A;  4UIV A;  4PS5 A;  4A9M A;  4HXL A;  5FFY A;  5HEN A;  4QR3 A;  5HJC A;  5L97 A;  5LJ2 A;  3NXB A;  2FSA A;  4QR5 A;  3LQH A;  5ENJ A;  4QBM A;  5EWD A;  2GRC A;  2YEL A;  4UYF B;  5CUA A;  5HQ5 A;  5ETB A;  2D82 A;  4XUB A;  5F25 A;  5CQT A;  3UW9 A;  4QSX A;  5TCM A;  4N4H A;  5EI4 A;  5CGP A;  3UVX A;  5ENB A;  4LYW A;  5HRX A;  4CUT A;  2RNY A;  4O76 A;  2F6J A;  5EM3 A;  5F63 A;  5HM0 A;  5LKU A;  5D25 A;  4A9J A;  5K29 A;  2RO1 A;  4CL9 A;  4XUA A;  5DFD A;  5E9Y A;  5D0C A;  5DKH A;  4A9I A;  4NUC A;  4QSQ A;  2YDW A;  4A9N A;  5A82 A;  2WP1 A;  4QYL A;  5CQ8 A;  3SVF A;  4N4F A;  2DAT A;  5ETD A;  2DVS A;  5FE2 A;  4HXN A;  4YYJ A;  5HEL A;  3P1E A;  5KU3 A;  3JVM A;  5E9V A;  4MEQ A;  3LJW A;  5KTX A;  3K2J A;  5EPB A;  2NXB A;  4LRG A;  5I7X A;  4CFL A;  5IGK A;  5FH6 A;  5C87 A;  2E7N A;  3G0L A;  4J3I A;  4QUU A;  5KTU A;  4MEO A;  3ONI A;  4YAX A;  5ENH A;  5CQ5 A;  3TLP A;  4ALH A;  4F3I A;  4YYH A;  4UYG A;  2DVR A;  4IR3 A;  3HMH A;  4TQN A;  4QC3 A;  4PTB A;  4WHU A;  4E96 A;  4AKN A;  2R10 A;  4O7F A;  5D3J A;  4MR6 A;  5F1L A;  2OUO A;  5IGN A;  5EQ1 A;  4HBY A;  4NR4 A;  4UIT A;  4CUP A;  3QZV A;  3U5O A;  3S91 A;  5CQ7 A;  4YYG A;  4MR4 A;  5A5N A;  4NYV A;  5A81 A;  4A9H A;  3SVH A;  3LQJ A;  5JI8 A;  5CUB A;  5F60 A;  4NXJ A;  5E73 A;  5D3T A;  5D3P A;  3UV4 A;  2OO1 A;  3JVJ A;  5FFW A;  4DON A;  4HBW A;  5CPE A;  3JVK A;  5L96 A;  5CQ4 A;  5F5Z A;  4HBV A;  4LR6 A;  5H1V A;  4NUE A;  3MB4 A;  4QSP A;  5E9L A;  3QZT A;  5CRM A;  4YAD A;  5E7D A;  5C4Q A;  3D7C A;  4UIY A;  5EVA A;  5FE5 A;  4TU4 A;  2DWW A;  3U5P A;  5D7X A;  5I7Y A;  4TT6 A;  5C7N A;  5D24 A;  4O74 A;  5F1H A;  5EPS A;  2E3K A;  2L85 A;  5ENC A;  5C8G A;  2H60 A;  3U5M A;  5G4R A;  5II1 A;  4KV4 A;  5TB6 A;  4UIU A;  4CLB A;  4CUU A;  1EQF A;  4A9K A;  4O7B A;  4A9O A;  5CFW A;  3P1D A;  4KV1 A;  4BW1 A;  5HRW A;  5EPR A;  5I83 A;  5FB1 A;  5EK9 A;  1WUG A;  5DW1 A;  4NYX A;  4LZR A;  1N72 A;  3MQM A;  5CTL A;  5DX4 A;  5D3L A;  3U5K A;  3FKM X;  5CZG A;  5H1T A;  4NRC A;  5EGU A;  5J0D A;  3JVL A;  4TZ2 A;  4BW4 A;  5L8T A;  4RVR A;  3UVD A;  5A5P A;  4UIZ A;  5FH8 A;  4QY4 A;  5EWW A;  4NUD A;  4UYF A;  3MUK A;  3DAI A;  5A85 A;  5BT3 A;  5FE0 A;  5D3H A;  5E9M A;  5C89 A;  5C85 A;  5FH7 A;  5E9I A;  4YYM A;  4J0S A;  4O75 A;  4CUQ A;  3UVY A;  4MR5 A;  4QC1 A;  5G4S A;  4O7E A;  5HEM A;  5ENF A;  2R0S A;  4IOQ A;  4YYK A;  4N4I A;  4O72 A;  5DLX A;  5E9K A;  5A5Q A;  4OGJ A;  5IG6 A;  4XYA A;  3LQI A;  3LXJ A;  4YH4 A;  5EWV A;  3S92 A;  4TZ8 A;  4LDF A;  4O77 A;  5HQ6 A;  3UVW A;  5FE1 A;  4QEU A;  4OGI A;  5IID A;  4O70 A;  4NR7 A;  4QR4 A;  5L98 A;  4TTE A;  4UYH A;  4QYD A;  5FG5 A;  2D9E A;  5L8U A;  1JM4 B;  4LZ2 A;  5CUG A;  5EIS A;  3UV5 A;  5KHM A;  4XY9 A;  4N4G A;  5I89 A;  4J0R A;  5HFR A;  4Z1Q A;  5HRV A;  4NR9 A;  4O78 A;  5LVR A;  5AMF A;  4NYW A;  4NRB A;  5F2P A;  5D3R A;  5ACY A;  2I7K A;  4WHW A;  4XY8 A;  2L5E A;  5EV9 A;  3Q2F A;  4NR8 A;  5HQ7 A;  5II2 A;  4IOR A;  4IR5 A;  5AD3 A;  4YYI A;  4PCI A;  3SVG A;  5DY7 A;  4YYN A;  1F68 A;  1JSP B;  2OSS A;  3U5L A;  4HXP A;  4TT4 A;  2RNX A;  4ZC9 A;  4PY6 A;  5A7C A;  4IR6 A;  5CS8 A;  4OUF A;  4MEN A;  4O7C A;  5FBX A;  5D26 A;  4IOO A;  4HXK A;  4NR6 A;  5FE4 A;  4ZW1 A;  3HMF A;  4QNS A;  5LJ0 A;  3G0J A;  4PCE A;  4NS5 A;  5FE9 A;  5KTW A;  5DLZ A;  3IU6 A;  5FDZ A;  4HXM A;  4QB3 A;  3AAD A;  5CUD A;  5EWC A;  4O7A A;  4CUS A;  4YYD A;  5F61 A;  5LKZ A;  4O71 A;  3O34 A;  5CY9 A;  5CUE A;  5ENI A;  2DKW A;  3RCW A;  3P1F A;  4QST A;  5HFQ A;  2N9G A;  5FE6 A;  5FE8 A;  2I8N A;  5CQA A;  2R0Y A;  4NQN A;  5ENG A;  5HLS A;  5CRZ A;  5DYC A;  4LYI A;  4PKL A;  5H85 A;  2F6N A;  4NRA A;  2KTB B;  4BW2 A;  5F36 A;  5FE3 A;  2R0V A;  1E6I A;  4A9L A;  4LYS A;  4UIX A;  4BJX A;  2DVQ A;  3O35 A;  5CQ3 A;  1ZS5 A;  3MXF A;  5I80 A;  3HME A;  2YW5 A;  5EU1 A;  2L84 A;  5EWH A;  3UV2 A;  3DWY A;  5HCL A;  5DFB A;  5IGL A;  5LVQ A;  5A83 A;  4NR5 A;  5FFV A;  5FG6 A;  4N3W A;  4A9F A;  4QZS A;  4Y03 A;  4UYE A;  3U5N A;  1WUM A;  3MB3 A;  2WP2 A;  4LZS A;  5IBN A;  5I1Q A;  4WIV A;  5I86 A;  4C66 A;  4C67 A;  5E74 A;  4QSV A;  5I88 A;  5KO4 A;  2YYN A;  5BT5 A;  5JWM A;  4Z6I A;  5FB0 A;  5CP5 A;  4YAT A;  5LKT A;  4QUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...