4QSSA

Structure of the bromodomain of human atpase family aaa domain-containing protein 2 (atad2) in complex with n-methyl-2-pyrrolidone (nmp)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Structure-based approaches towards identification of fragments for the low-druggability ATAD2 bromodomain
doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qssA00
3O34A 5LKUA 4CFKA 4O7CA 3FKMX 4NYXA 5E9LA 3DAIA 5HEMA 3UVDA 3G0JA 4ZC9A 2E7OA 4QR4A 3LJWA 2YDWA 5D3RA 4TYLA 4IOQA 5EU1A 4QSSA 3Q2EA 4CUUA 4A9MA 5HRWA 3U5PA 5CUDA 4CUQA 4QSQA 4O72A 3Q2FA 5EWVA 5H1TA 3ZYUA 2RO1A 3O35A 4NR6A 5CUCA 4NR8A 2WP1A 4BW1A 5HFQA 3U5MA 5A82A 2G4AA 3U5JA 5AD3A 3P1DA 3QZTA 2RI7A 3HMHA 4WIVA 4GPJA 4QR5A 4UYFB 4CFLA 3U5NA 5IG6A 5EWDA 4LYSA 4YATA 5D3JA 5CTLA 4J1PA 4TU4A 5CUAA 4O77A 4MR3A 5D3HA 5H1VA 4N4GA 5KTUA 4A9KA 4BJXA 5FE4A 4KV4A 5A5OA 5AMFA 5C4QA 4MR4A 2LSPB 5ENEA 5I86A 3HMFA 3JVMA 4N3WA 3UV2A 3UW9A 4HXPA 5H1UA 4NQMA 4ZQLA 5F5ZA 5G4RA 5EQ1A 5D0CA 4J0SA 4QSUA 4NR5A 3RCWA 5CRZA 5IBNA 3DWYA 4RVRA 5FG6A 3P1FA 3JVLA 4NRAA 3MUKA 4BW4A 5CUGA 4YYNA 4YYHA 3QZVA 2WP2A 5I7YA 5I83A 3UV4A 4QSXA 4YYKA 2YQDA 4N4HA 4QNSA 2OUOA 4NS5A 5F62A 4NR9A 4LYIA 4A9IA 4PTBA 5HLSA 5D3PA 5E73A 4QSRA 5F2PA 5DBMA 1F68A 4QZSA 5CFWA 4HXSA 5E9YA 4QUUA 4LDFA 4UITA 4A9JA 5E7DA 5I80A 5DW1A 5KTXA 4NXJA 4NQNA 3MXFA 5F60A 5HQ6A 4YBMA 5D26A 2KTBB 4O75A 4CL9A 3AADA 3JVKA 4NYWA 4QSVA 5I40A 2YEMA 2DKWA 4QYDA 4XYAA 5A5QA 4C67A 3MB4A 5BT3A 5DKHA 5ENBA 5CQ5A 1N72A 5ENGA 5C8GA 3SVHA 5KHMA 3LQIA 5L8UA 4A9NA 3P1EA 5FFWA 5FE7A 5LJ2A 4UYDA 4HXMA 4UYHA 4Z1QA 5E0RA 3O36A 5JWMA 5LUUA 5FE9A 4BW2A 5CQ7A 5HQ5A 4AKNA 4E96A 5F1LA 4TTEA 5D3TA 3NXBA 2D82A 5C87A 5A81A 2R0SA 4O7EA 5FG4A 3I3JA 3AQAA 3IU5A 4TZ8A 5LVQA 1WUMA 5FFYA 3IU6A 5EM3A 2F6JA 5KTWA 5DYCA 1X0JA 4TU6A 4LZRA 5CPEA 4IR3A 4Z6HA 5HM0A 3UVXA 2YW5A 1WUGA 5D25A 4QEUA 5DW2A 5F36A 5D3NA 5HENA 4PKLA 2R0YA 5DYAA 2H60A 5CQ8A 2RS9B 3LQJA 5EISA 4UYEA 4Y03A 2NXBA 3K2JA 3LQHA 3S91A 4QUTA 2YELA 5D3SA 5A85A 5L97A 4NYVA 2DVQA 4QSWA 3SVGA 4MR5A 4FLPA 4TZ2A 5A5SA 4LZSA 4LRGA 5HRXA 4PCEA 2R0VA 5CQ4A 4N4IA 3P5OA 5IGNA 2I8NA 4MENA 4A9FA 2E7NA 2E3KA 5LJ0A 5K29A 4OUFA 5CQTA 5ACYA 5FE8A 5EPBA 2F6NA 5HQ7A 3UVWA 4NUCA 2RFJA 4CUPA 5LJ1A 4F3IA 2OSSA 2L84A 3HMEA 4O74A 4YC9A 5CRMA 5D24A 5IGLA 5LKTA 4OGIA 2DVSA 5A7CA 4Z93A 5AMEA 4MR6A 4TQNA 4YAXA 4UIVA 5DFBA 3D7CA 4YYJA 3MQMA 4ALGA 3MULA 5ENFA 4A9OA 3UVYA 4O71A 5II1A 5I89A 5FG5A 5HJCA 3SVFA 5CGPA 5EPRA 4HXOA 4OGJA 4J0RA 4YH4A 2FSAA 4MEPA 3MB3A 2L5EA 5LKXA 2DATA 4IR4A 5FE3A 4CURA 4YBSA 5CUEA 4LZ2A 4N4FA 5FH7A 5CS8A 2I7KA 5E74A 5L96A 5FE2A 3U5LA 4UIWA 4TT6A 4IORA 2L85A 3U5KA 2DVRA 4NRBA 4YYIA 4NRCA 5EK9A 4O7AA 5ENHA 5FH8A 5HCLA 4J3IA 4O7FA 4ZW1A 5FBXA 2R10A 5C89A 4QEVA 4YYGA 2N9GA 5FE1A 5II2A 5A83A 5I1QA 2YYNA 5EP7A 4WHUA 4BHWA 4A9EA 5EICA 5CQAA 4Q0OA 5ENCA 5A5NA 4IR5A 2MJVB 5L99A 5ENIA 5H85A 4XUBA 4TS8A 5IGMA 4YBTA 4NUEA 4Z1SA 4QYLA 5EV9A 1EQFA 5FDZA 5C85A 4MEOA 3UV5A 5JI8A 4YABA 4HBWA 5F25A 5CQ3A 5FH6A 4QR3A 5F61A 4Q0NA 5EA1A 5F63A 5DY7A 4NR4A 4HBYA 5E3GA 4O70A 5EWHA 1JM4B 4YK0A 5DKCA 4QC1A 4LR6A 3S92A 3P1CA 5ENJA 1E6IA 5TCMA 5DYUA 4PS5A 4HXNA 5BT4A 3G0LA 5ETDA 4O78A 4BW3A 4QB3A 4A9HA 1ZS5A 5HRVA 5E9VA 4ALHA 4UIYA 4QEWA 4XY8A 4CUSA 3QZSA 5E9KA 3ONIA 4QC3A 4CLBA 4QY4A 4QSTA 2D9EA 4KCXA 5L8TA 4LYWA 3U5OA 5EGUA 5D3LA 3TLPA 4LC2A 4KV1A 5FE0A 4IOOA 4UIXA 5AD2A 5FE6A 4UIZA 4YH3A 5D7XA 5I88A 4UYFA 5E3DA 5IIDA 4Z6IA 4IR6A 5DX4A 4HXRA 5KU3A 5CQ6A 2GRCA 5CY9A 5DKDA 4TT4A 5DLZA 5G4SA 5FB1A 4O76A 4QSPA 4PCIA 2RNXA 3LXJA 5CP5A 5EWCA 5F1HA 4HBXA 4PY6A 5L98A 4YYDA 5DLXA 5A5RA 4HXKA 5DFCA 5FFVA 4YADA 4DONA 5FE5A 5BT5A 5EPSA 5E9IA 2RNYA 2YEKA 4NUDA 4MEQA 5EWWA 5KO4A 4HXLA 5HFRA 2RNWA 5I29A 4XUAA 1JSPB 4UIUA 2DVVA 3O37A 4WHWA 5F3AA 5COIA 5TB6A 5FB0A 5CU8A 5J0DA 4XY9A 5I7XA 5DFDA 4NR7A 5C7NA 4O7BA 5LKZA 4YYMA 4YY4A 4CUTA 5LVRA 4HBVA 4X2IA 5IGKA 5E9MA 4QBMA 5EI4A 5A5PA 4YY6A 4C66A 5DYXA 3GG3A 5HELA 3JVJA 5CZGA 2DWWA 2OO1A 4UYGA 5ETBA 5CUBA 4A9LA 4TT2A 3O33A 5EVAA
chains in the Genus database with same CATH superfamily
3O34A 5LKUA 4CFKA 4O7CA 3FKMX 4NYXA 5E9LA 3DAIA 5HEMA 2EJNA 3UVDA 3G0JA 4ZC9A 2E7OA 3D1DA 4QR4A 3LJWA 2YDWA 5D3RA 4TYLA 3D1BA 4IOQA 5EU1A 4QSSA 3Q2EA 4CUUA 4A9MA 5HRWA 3U5PA 5CUDA 4CUQA 4QSQA 4O72A 3Q2FA 5EWVA 5H1TA 3ZYUA 2RO1A 3O35A 4NR6A 5CUCA 4NR8A 2WP1A 4BW1A 5HFQA 3U5MA 5A82A 2G4AA 3U5JA 5AD3A 3P1DA 3QZTA 2RI7A 3HMHA 4WIVA 4GPJA 4QR5A 4UYFB 4CFLA 3U5NA 5IG6A 5EWDA 4LYSA 4YATA 5D3JA 5CTLA 4J1PA 4TU4A 5CUAA 4O77A 4MR3A 5D3HA 5H1VA 4N4GA 5KTUA 4A9KA 4BJXA 5FE4A 4KV4A 5A5OA 5AMFA 5C4QA 4MR4A 2LSPB 5ENEA 5I86A 3HMFA 3JVMA 4N3WA 3UV2A 3UW9A 4HXPA 5H1UA 4NQMA 4ZQLA 5F5ZA 5G4RA 5EQ1A 5D0CA 4J0SA 4QSUA 4NR5A 3RCWA 5CRZA 5IBNA 3DWYA 4RVRA 5FG6A 3P1FA 3JVLA 4NRAA 3MUKA 4BW4A 5CUGA 4YYNA 4YYHA 3QZVA 2WP2A 5I7YA 5I83A 3UV4A 4QSXA 4YYKA 2YQDA 4N4HA 4QNSA 2OUOA 4NS5A 5F62A 4NR9A 4LYIA 4A9IA 4PTBA 5HLSA 5D3PA 5E73A 4QSRA 5F2PA 5DBMA 1F68A 4QZSA 5CFWA 4HXSA 5E9YA 4QUUA 4LDFA 4UITA 4A9JA 5E7DA 5I80A 5DW1A 5KTXA 4NXJA 4NQNA 3MXFA 5F60A 5HQ6A 4YBMA 5D26A 2KTBB 4O75A 4CL9A 3AADA 3JVKA 4NYWA 4QSVA 5I40A 2YEMA 2DKWA 4QYDA 4XYAA 5A5QA 4C67A 3MB4A 5BT3A 5DKHA 5ENBA 5CQ5A 1N72A 5ENGA 5C8GA 3SVHA 5KHMA 3LQIA 5L8UA 4AKHA 4A9NA 3P1EA 5FFWA 5FE7A 5LJ2A 4UYDA 4HXMA 4UYHA 4Z1QA 5E0RA 3O36A 5JWMA 5LUUA 5FE9A 4BW2A 5CQ7A 5HQ5A 4AKNA 4E96A 5F1LA 4TTEA 5D3TA 3NXBA 2D82A 5C87A 5A81A 2R0SA 4O7EA 5FG4A 3I3JA 3AQAA 3IU5A 4TZ8A 5LVQA 1WUMA 5FFYA 3IU6A 5EM3A 2F6JA 5KTWA 5DYCA 1X0JA 4TU6A 4LZRA 5CPEA 4IR3A 4Z6HA 5HM0A 3UVXA 2YW5A 1WUGA 5D25A 4QEUA 5DW2A 5F36A 5D3NA 5HENA 4PKLA 2R0YA 5DYAA 2H60A 5CQ8A 2RS9B 3LQJA 5EISA 4UYEA 4Y03A 2NXBA 3K2JA 3LQHA 3S91A 4QUTA 2YELA 5D3SA 5A85A 5L97A 4NYVA 2DVQA 4QSWA 3SVGA 4MR5A 4FLPA 4TZ2A 5A5SA 4LZSA 4LRGA 5HRXA 4PCEA 2R0VA 5CQ4A 4N4IA 3P5OA 5IGNA 2I8NA 4MENA 4A9FA 2E7NA 2E3KA 5LJ0A 5K29A 4OUFA 5CQTA 5ACYA 5FE8A 5EPBA 2F6NA 5HQ7A 3UVWA 4NUCA 2RFJA 4CUPA 5LJ1A 4F3IA 2OSSA 2L84A 3HMEA 4O74A 4YC9A 5CRMA 5D24A 5IGLA 5LKTA 4OGIA 2DVSA 5A7CA 4Z93A 5AMEA 4MR6A 4TQNA 4YAXA 4UIVA 5DFBA 3D7CA 4YYJA 3MQMA 4ALGA 3MULA 5ENFA 4A9OA 3UVYA 4O71A 5II1A 5I89A 5FG5A 5HJCA 3SVFA 5CGPA 5EPRA 4HXOA 4OGJA 4J0RA 4YH4A 2FSAA 4MEPA 3MB3A 2L5EA 5LKXA 2DATA 4IR4A 5FE3A 4CURA 4YBSA 5CUEA 4LZ2A 4N4FA 5FH7A 5CS8A 2I7KA 5E74A 5L96A 5FE2A 3U5LA 4UIWA 4TT6A 4IORA 2L85A 3U5KA 2DVRA 4NRBA 4YYIA 4NRCA 5EK9A 4O7AA 5ENHA 5FH8A 5HCLA 4J3IA 4O7FA 4ZW1A 5FBXA 2R10A 5C89A 4QEVA 4YYGA 2N9GA 5FE1A 5II2A 5A83A 5I1QA 2YYNA 5EP7A 4WHUA 4BHWA 4A9EA 5EICA 5CQAA 4Q0OA 5ENCA 5A5NA 4IR5A 2MJVB 5L99A 5ENIA 5H85A 4XUBA 4AKGA 4TS8A 3VKHA 5IGMA 4YBTA 4NUEA 4Z1SA 4QYLA 5EV9A 1PUOA 1EQFA 5FDZA 5C85A 4MEOA 3UV5A 5JI8A 4YABA 4HBWA 5F25A 4AKIA 5CQ3A 5FH6A 4QR3A 5F61A 4Q0NA 5EA1A 5F63A 5DY7A 4NR4A 4HBYA 5E3GA 4O70A 5EWHA 1JM4B 4YK0A 5DKCA 4QC1A 4LR6A 3S92A 3P1CA 5ENJA 1E6IA 5TCMA 5DYUA 4PS5A 4HXNA 5BT4A 3G0LA 5ETDA 4O78A 4BW3A 4QB3A 4A9HA 1ZS5A 5HRVA 5E9VA 4ALHA 4UIYA 4QEWA 4XY8A 4CUSA 3QZSA 5E9KA 3ONIA 4QC3A 4CLBA 4QY4A 4AI6A 4QSTA 2D9EA 4KCXA 5L8TA 4LYWA 3U5OA 5EGUA 5D3LA 3TLPA 4LC2A 4KV1A 5FE0A 1ZKRA 4IOOA 4UIXA 5AD2A 5FE6A 4UIZA 4YH3A 5D7XA 5I88A 4UYFA 5E3DA 5IIDA 4Z6IA 4IR6A 5DX4A 4HXRA 5KU3A 5CQ6A 2GRCA 5CY9A 5DKDA 4TT4A 5DLZA 5G4SA 5FB1A 4O76A 4QSPA 4PCIA 2RNXA 3LXJA 5CP5A 5EWCA 5F1HA 4HBXA 4PY6A 5L98A 4YYDA 5DLXA 3ERRA 5A5RA 4HXKA 5DFCA 5FFVA 3VKGA 4YADA 4DONA 5FE5A 5BT5A 5EPSA 5E9IA 2RNYA 2YEKA 4NUDA 4MEQA 5EWWA 5KO4A 4HXLA 5HFRA 2RNWA 5I29A 4XUAA 1JSPB 4UIUA 2DVVA 3O37A 4WHWA 5F3AA 5COIA 5TB6A 5FB0A 5CU8A 5J0DA 4XY9A 5I7XA 5DFDA 4NR7A 5C7NA 4O7BA 5LKZA 4YYMA 4YY4A 4CUTA 5LVRA 4HBVA 4X2IA 5IGKA 5E9MA 4QBMA 5EI4A 5A5PA 4YY6A 4C66A 5DYXA 3GG3A 5HELA 3JVJA 5CZGA 2DWWA 2OO1A 4UYGA 5ETBA 5CUBA 4A9LA 4TT2A 3O33A 5EVAA
chains in the Genus database with same CATH topology
3O34A 5LKUA 4CFKA 4O7CA 3FKMX 4NYXA 5E9LA 3DAIA 5HEMA 3UVDA 3G0JA 4ZC9A 2E7OA 4QR4A 3LJWA 2YDWA 5D3RA 4TYLA 4IOQA 5EU1A 4QSSA 3Q2EA 4CUUA 4A9MA 5HRWA 3U5PA 5CUDA 4CUQA 4QSQA 4O72A 3Q2FA 5EWVA 5H1TA 3ZYUA 2RO1A 3O35A 4NR6A 5CUCA 4NR8A 2WP1A 4BW1A 5HFQA 3U5MA 5A82A 2G4AA 3U5JA 5AD3A 3P1DA 3QZTA 2RI7A 3HMHA 4WIVA 4GPJA 4QR5A 4UYFB 4CFLA 3U5NA 5IG6A 5EWDA 4LYSA 4YATA 5D3JA 5CTLA 4J1PA 4TU4A 5CUAA 4O77A 4MR3A 5D3HA 5H1VA 4N4GA 5KTUA 4A9KA 4BJXA 5FE4A 4KV4A 5A5OA 5AMFA 5C4QA 4MR4A 2LSPB 5ENEA 5I86A 3HMFA 3JVMA 4N3WA 3UV2A 3UW9A 4HXPA 5H1UA 4NQMA 4ZQLA 5F5ZA 5G4RA 5EQ1A 5D0CA 4J0SA 4QSUA 4NR5A 3RCWA 5CRZA 5IBNA 3DWYA 4RVRA 5FG6A 3P1FA 3JVLA 4NRAA 3MUKA 4BW4A 5CUGA 4YYNA 4YYHA 3QZVA 2WP2A 5I7YA 5I83A 3UV4A 4QSXA 4YYKA 2YQDA 4N4HA 4QNSA 2OUOA 4NS5A 5F62A 4NR9A 4LYIA 4A9IA 4PTBA 5HLSA 5D3PA 5E73A 4QSRA 5F2PA 5DBMA 1F68A 4QZSA 5CFWA 4HXSA 5E9YA 4QUUA 4LDFA 4UITA 4A9JA 5E7DA 5I80A 5DW1A 5KTXA 4NXJA 4NQNA 3MXFA 5F60A 5HQ6A 4YBMA 5D26A 2KTBB 4O75A 4CL9A 3AADA 3JVKA 4NYWA 4QSVA 5I40A 2YEMA 2DKWA 4QYDA 4XYAA 5A5QA 4C67A 3MB4A 5BT3A 5DKHA 5ENBA 5CQ5A 1N72A 5ENGA 5C8GA 3SVHA 5KHMA 3LQIA 5L8UA 4A9NA 3P1EA 5FFWA 5FE7A 5LJ2A 4UYDA 4HXMA 4UYHA 4Z1QA 5E0RA 3O36A 5JWMA 5LUUA 5FE9A 4BW2A 5CQ7A 5HQ5A 4AKNA 4E96A 5F1LA 4TTEA 5D3TA 3NXBA 2D82A 5C87A 5A81A 2R0SA 4O7EA 5FG4A 3I3JA 3AQAA 3IU5A 4TZ8A 5LVQA 1WUMA 5FFYA 3IU6A 5EM3A 2F6JA 5KTWA 5DYCA 1X0JA 4TU6A 4LZRA 5CPEA 4IR3A 4Z6HA 5HM0A 3UVXA 2YW5A 1WUGA 5D25A 4QEUA 5DW2A 5F36A 5D3NA 5HENA 4PKLA 2R0YA 5DYAA 2H60A 5CQ8A 2RS9B 3LQJA 5EISA 4UYEA 4Y03A 2NXBA 3K2JA 3LQHA 3S91A 4QUTA 2YELA 5D3SA 5A85A 5L97A 4NYVA 2DVQA 4QSWA 3SVGA 4MR5A 4FLPA 4TZ2A 5A5SA 4LZSA 4LRGA 5HRXA 4PCEA 2R0VA 5CQ4A 4N4IA 3P5OA 5IGNA 2I8NA 4MENA 4A9FA 2E7NA 2E3KA 5LJ0A 5K29A 4OUFA 5CQTA 5ACYA 5FE8A 5EPBA 2F6NA 5HQ7A 3UVWA 4NUCA 2RFJA 4CUPA 5LJ1A 4F3IA 2OSSA 2L84A 3HMEA 4O74A 4YC9A 5CRMA 5D24A 5IGLA 5LKTA 4OGIA 2DVSA 5A7CA 4Z93A 5AMEA 4MR6A 4TQNA 4YAXA 4UIVA 5DFBA 3D7CA 4YYJA 3MQMA 4ALGA 3MULA 5ENFA 4A9OA 3UVYA 4O71A 5II1A 5I89A 5FG5A 5HJCA 3SVFA 5CGPA 5EPRA 4HXOA 4OGJA 4J0RA 4YH4A 2FSAA 4MEPA 3MB3A 2L5EA 5LKXA 2DATA 4IR4A 5FE3A 4CURA 4YBSA 5CUEA 4LZ2A 4N4FA 5FH7A 5CS8A 2I7KA 5E74A 5L96A 5FE2A 3U5LA 4UIWA 4TT6A 4IORA 2L85A 3U5KA 2DVRA 4NRBA 4YYIA 4NRCA 5EK9A 4O7AA 5ENHA 5FH8A 5HCLA 4J3IA 4O7FA 4ZW1A 5FBXA 2R10A 5C89A 4QEVA 4YYGA 2N9GA 5FE1A 5II2A 5A83A 5I1QA 2YYNA 5EP7A 4WHUA 4BHWA 4A9EA 5EICA 5CQAA 4Q0OA 5ENCA 5A5NA 4IR5A 2MJVB 5L99A 5ENIA 5H85A 4XUBA 4TS8A 5IGMA 4YBTA 4NUEA 4Z1SA 4QYLA 5EV9A 1EQFA 5FDZA 5C85A 4MEOA 3UV5A 5JI8A 4YABA 4HBWA 5F25A 5CQ3A 5FH6A 4QR3A 5F61A 4Q0NA 5EA1A 5F63A 5DY7A 4NR4A 4HBYA 5E3GA 4O70A 5EWHA 1JM4B 4YK0A 5DKCA 4QC1A 4LR6A 3S92A 3P1CA 5ENJA 1E6IA 5TCMA 5DYUA 4PS5A 4HXNA 5BT4A 3G0LA 5ETDA 4O78A 4BW3A 4QB3A 4A9HA 1ZS5A 5HRVA 5E9VA 4ALHA 4UIYA 4QEWA 4XY8A 4CUSA 3QZSA 5E9KA 3ONIA 4QC3A 4CLBA 4QY4A 4QSTA 2D9EA 4KCXA 5L8TA 4LYWA 3U5OA 5EGUA 5D3LA 3TLPA 4LC2A 4KV1A 5FE0A 4IOOA 4UIXA 5AD2A 5FE6A 4UIZA 4YH3A 5D7XA 5I88A 4UYFA 5E3DA 5IIDA 4Z6IA 4IR6A 5DX4A 4HXRA 5KU3A 5CQ6A 2GRCA 5CY9A 5DKDA 4TT4A 5DLZA 5G4SA 5FB1A 4O76A 4QSPA 4PCIA 2RNXA 3LXJA 5CP5A 5EWCA 5F1HA 4HBXA 4PY6A 5L98A 4YYDA 5DLXA 5A5RA 4HXKA 5DFCA 5FFVA 4YADA 4DONA 5FE5A 5BT5A 5EPSA 5E9IA 2RNYA 2YEKA 4NUDA 4MEQA 5EWWA 5KO4A 4HXLA 5HFRA 2RNWA 5I29A 4XUAA 1JSPB 4UIUA 2DVVA 3O37A 4WHWA 5F3AA 5COIA 5TB6A 5FB0A 5CU8A 5J0DA 4XY9A 5I7XA 5DFDA 4NR7A 5C7NA 4O7BA 5LKZA 4YYMA 4YY4A 4CUTA 5LVRA 4HBVA 4X2IA 5IGKA 5E9MA 4QBMA 5EI4A 5A5PA 4YY6A 4C66A 5DYXA 3GG3A 5HELA 3JVJA 5CZGA 2DWWA 2OO1A 4UYGA 5ETBA 5CUBA 4A9LA 4TT2A 3O33A 5EVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O34 A;  5LKU A;  4CFK A;  4O7C A;  3FKM X;  4NYX A;  5E9L A;  3DAI A;  5HEM A;  3UVD A;  3G0J A;  4ZC9 A;  2E7O A;  4QR4 A;  3LJW A;  2YDW A;  5D3R A;  4TYL A;  4IOQ A;  5EU1 A;  4QSS A;  3Q2E A;  4CUU A;  4A9M A;  5HRW A;  3U5P A;  5CUD A;  4CUQ A;  4QSQ A;  4O72 A;  3Q2F A;  5EWV A;  5H1T A;  3ZYU A;  2RO1 A;  3O35 A;  4NR6 A;  5CUC A;  4NR8 A;  2WP1 A;  4BW1 A;  5HFQ A;  3U5M A;  5A82 A;  2G4A A;  3U5J A;  5AD3 A;  3P1D A;  3QZT A;  2RI7 A;  3HMH A;  4WIV A;  4GPJ A;  4QR5 A;  4UYF B;  4CFL A;  3U5N A;  5IG6 A;  5EWD A;  4LYS A;  4YAT A;  5D3J A;  5CTL A;  4J1P A;  4TU4 A;  5CUA A;  4O77 A;  4MR3 A;  5D3H A;  5H1V A;  4N4G A;  5KTU A;  4A9K A;  4BJX A;  5FE4 A;  4KV4 A;  5A5O A;  5AMF A;  5C4Q A;  4MR4 A;  2LSP B;  5ENE A;  5I86 A;  3HMF A;  3JVM A;  4N3W A;  3UV2 A;  3UW9 A;  4HXP A;  5H1U A;  4NQM A;  4ZQL A;  5F5Z A;  5G4R A;  5EQ1 A;  5D0C A;  4J0S A;  4QSU A;  4NR5 A;  3RCW A;  5CRZ A;  5IBN A;  3DWY A;  4RVR A;  5FG6 A;  3P1F A;  3JVL A;  4NRA A;  3MUK A;  4BW4 A;  5CUG A;  4YYN A;  4YYH A;  3QZV A;  2WP2 A;  5I7Y A;  5I83 A;  3UV4 A;  4QSX A;  4YYK A;  2YQD A;  4N4H A;  4QNS A;  2OUO A;  4NS5 A;  5F62 A;  4NR9 A;  4LYI A;  4A9I A;  4PTB A;  5HLS A;  5D3P A;  5E73 A;  4QSR A;  5F2P A;  5DBM A;  1F68 A;  4QZS A;  5CFW A;  4HXS A;  5E9Y A;  4QUU A;  4LDF A;  4UIT A;  4A9J A;  5E7D A;  5I80 A;  5DW1 A;  5KTX A;  4NXJ A;  4NQN A;  3MXF A;  5F60 A;  5HQ6 A;  4YBM A;  5D26 A;  2KTB B;  4O75 A;  4CL9 A;  3AAD A;  3JVK A;  4NYW A;  4QSV A;  5I40 A;  2YEM A;  2DKW A;  4QYD A;  4XYA A;  5A5Q A;  4C67 A;  3MB4 A;  5BT3 A;  5DKH A;  5ENB A;  5CQ5 A;  1N72 A;  5ENG A;  5C8G A;  3SVH A;  5KHM A;  3LQI A;  5L8U A;  4A9N A;  3P1E A;  5FFW A;  5FE7 A;  5LJ2 A;  4UYD A;  4HXM A;  4UYH A;  4Z1Q A;  5E0R A;  3O36 A;  5JWM A;  5LUU A;  5FE9 A;  4BW2 A;  5CQ7 A;  5HQ5 A;  4AKN A;  4E96 A;  5F1L A;  4TTE A;  5D3T A;  3NXB A;  2D82 A;  5C87 A;  5A81 A;  2R0S A;  4O7E A;  5FG4 A;  3I3J A;  3AQA A;  3IU5 A;  4TZ8 A;  5LVQ A;  1WUM A;  5FFY A;  3IU6 A;  5EM3 A;  2F6J A;  5KTW A;  5DYC A;  1X0J A;  4TU6 A;  4LZR A;  5CPE A;  4IR3 A;  4Z6H A;  5HM0 A;  3UVX A;  2YW5 A;  1WUG A;  5D25 A;  4QEU A;  5DW2 A;  5F36 A;  5D3N A;  5HEN A;  4PKL A;  2R0Y A;  5DYA A;  2H60 A;  5CQ8 A;  2RS9 B;  3LQJ A;  5EIS A;  4UYE A;  4Y03 A;  2NXB A;  3K2J A;  3LQH A;  3S91 A;  4QUT A;  2YEL A;  5D3S A;  5A85 A;  5L97 A;  4NYV A;  2DVQ A;  4QSW A;  3SVG A;  4MR5 A;  4FLP A;  4TZ2 A;  5A5S A;  4LZS A;  4LRG A;  5HRX A;  4PCE A;  2R0V A;  5CQ4 A;  4N4I A;  3P5O A;  5IGN A;  2I8N A;  4MEN A;  4A9F A;  2E7N A;  2E3K A;  5LJ0 A;  5K29 A;  4OUF A;  5CQT A;  5ACY A;  5FE8 A;  5EPB A;  2F6N A;  5HQ7 A;  3UVW A;  4NUC A;  2RFJ A;  4CUP A;  5LJ1 A;  4F3I A;  2OSS A;  2L84 A;  3HME A;  4O74 A;  4YC9 A;  5CRM A;  5D24 A;  5IGL A;  5LKT A;  4OGI A;  2DVS A;  5A7C A;  4Z93 A;  5AME A;  4MR6 A;  4TQN A;  4YAX A;  4UIV A;  5DFB A;  3D7C A;  4YYJ A;  3MQM A;  4ALG A;  3MUL A;  5ENF A;  4A9O A;  3UVY A;  4O71 A;  5II1 A;  5I89 A;  5FG5 A;  5HJC A;  3SVF A;  5CGP A;  5EPR A;  4HXO A;  4OGJ A;  4J0R A;  4YH4 A;  2FSA A;  4MEP A;  3MB3 A;  2L5E A;  5LKX A;  2DAT A;  4IR4 A;  5FE3 A;  4CUR A;  4YBS A;  5CUE A;  4LZ2 A;  4N4F A;  5FH7 A;  5CS8 A;  2I7K A;  5E74 A;  5L96 A;  5FE2 A;  3U5L A;  4UIW A;  4TT6 A;  4IOR A;  2L85 A;  3U5K A;  2DVR A;  4NRB A;  4YYI A;  4NRC A;  5EK9 A;  4O7A A;  5ENH A;  5FH8 A;  5HCL A;  4J3I A;  4O7F A;  4ZW1 A;  5FBX A;  2R10 A;  5C89 A;  4QEV A;  4YYG A;  2N9G A;  5FE1 A;  5II2 A;  5A83 A;  5I1Q A;  2YYN A;  5EP7 A;  4WHU A;  4BHW A;  4A9E A;  5EIC A;  5CQA A;  4Q0O A;  5ENC A;  5A5N A;  4IR5 A;  2MJV B;  5L99 A;  5ENI A;  5H85 A;  4XUB A;  4TS8 A;  5IGM A;  4YBT A;  4NUE A;  4Z1S A;  4QYL A;  5EV9 A;  1EQF A;  5FDZ A;  5C85 A;  4MEO A;  3UV5 A;  5JI8 A;  4YAB A;  4HBW A;  5F25 A;  5CQ3 A;  5FH6 A;  4QR3 A;  5F61 A;  4Q0N A;  5EA1 A;  5F63 A;  5DY7 A;  4NR4 A;  4HBY A;  5E3G A;  4O70 A;  5EWH A;  1JM4 B;  4YK0 A;  5DKC A;  4QC1 A;  4LR6 A;  3S92 A;  3P1C A;  5ENJ A;  1E6I A;  5TCM A;  5DYU A;  4PS5 A;  4HXN A;  5BT4 A;  3G0L A;  5ETD A;  4O78 A;  4BW3 A;  4QB3 A;  4A9H A;  1ZS5 A;  5HRV A;  5E9V A;  4ALH A;  4UIY A;  4QEW A;  4XY8 A;  4CUS A;  3QZS A;  5E9K A;  3ONI A;  4QC3 A;  4CLB A;  4QY4 A;  4QST A;  2D9E A;  4KCX A;  5L8T A;  4LYW A;  3U5O A;  5EGU A;  5D3L A;  3TLP A;  4LC2 A;  4KV1 A;  5FE0 A;  4IOO A;  4UIX A;  5AD2 A;  5FE6 A;  4UIZ A;  4YH3 A;  5D7X A;  5I88 A;  4UYF A;  5E3D A;  5IID A;  4Z6I A;  4IR6 A;  5DX4 A;  4HXR A;  5KU3 A;  5CQ6 A;  2GRC A;  5CY9 A;  5DKD A;  4TT4 A;  5DLZ A;  5G4S A;  5FB1 A;  4O76 A;  4QSP A;  4PCI A;  2RNX A;  3LXJ A;  5CP5 A;  5EWC A;  5F1H A;  4HBX A;  4PY6 A;  5L98 A;  4YYD A;  5DLX A;  5A5R A;  4HXK A;  5DFC A;  5FFV A;  4YAD A;  4DON A;  5FE5 A;  5BT5 A;  5EPS A;  5E9I A;  2RNY A;  2YEK A;  4NUD A;  4MEQ A;  5EWW A;  5KO4 A;  4HXL A;  5HFR A;  2RNW A;  5I29 A;  4XUA A;  1JSP B;  4UIU A;  2DVV A;  3O37 A;  4WHW A;  5F3A A;  5COI A;  5TB6 A;  5FB0 A;  5CU8 A;  5J0D A;  4XY9 A;  5I7X A;  5DFD A;  4NR7 A;  5C7N A;  4O7B A;  5LKZ A;  4YYM A;  4YY4 A;  4CUT A;  5LVR A;  4HBV A;  4X2I A;  5IGK A;  5E9M A;  4QBM A;  5EI4 A;  5A5P A;  4YY6 A;  4C66 A;  5DYX A;  3GG3 A;  5HEL A;  3JVJ A;  5CZG A;  2DWW A;  2OO1 A;  4UYG A;  5ETB A;  5CUB A;  4A9L A;  4TT2 A;  3O33 A;  5EVA A; 
#chains in the Genus database with same CATH topology
 3O34 A;  5LKU A;  4CFK A;  4O7C A;  3FKM X;  4NYX A;  5E9L A;  3DAI A;  5HEM A;  2EJN A;  3UVD A;  3G0J A;  4ZC9 A;  2E7O A;  3D1D A;  4QR4 A;  3LJW A;  2YDW A;  5D3R A;  4TYL A;  3D1B A;  4IOQ A;  5EU1 A;  4QSS A;  3Q2E A;  4CUU A;  4A9M A;  5HRW A;  3U5P A;  5CUD A;  4CUQ A;  4QSQ A;  4O72 A;  3Q2F A;  5EWV A;  5H1T A;  3ZYU A;  2RO1 A;  3O35 A;  4NR6 A;  5CUC A;  4NR8 A;  2WP1 A;  4BW1 A;  5HFQ A;  3U5M A;  5A82 A;  2G4A A;  3U5J A;  5AD3 A;  3P1D A;  3QZT A;  2RI7 A;  3HMH A;  4WIV A;  4GPJ A;  4QR5 A;  4UYF B;  4CFL A;  3U5N A;  5IG6 A;  5EWD A;  4LYS A;  4YAT A;  5D3J A;  5CTL A;  4J1P A;  4TU4 A;  5CUA A;  4O77 A;  4MR3 A;  5D3H A;  5H1V A;  4N4G A;  5KTU A;  4A9K A;  4BJX A;  5FE4 A;  4KV4 A;  5A5O A;  5AMF A;  5C4Q A;  4MR4 A;  2LSP B;  5ENE A;  5I86 A;  3HMF A;  3JVM A;  4N3W A;  3UV2 A;  3UW9 A;  4HXP A;  5H1U A;  4NQM A;  4ZQL A;  5F5Z A;  5G4R A;  5EQ1 A;  5D0C A;  4J0S A;  4QSU A;  4NR5 A;  3RCW A;  5CRZ A;  5IBN A;  3DWY A;  4RVR A;  5FG6 A;  3P1F A;  3JVL A;  4NRA A;  3MUK A;  4BW4 A;  5CUG A;  4YYN A;  4YYH A;  3QZV A;  2WP2 A;  5I7Y A;  5I83 A;  3UV4 A;  4QSX A;  4YYK A;  2YQD A;  4N4H A;  4QNS A;  2OUO A;  4NS5 A;  5F62 A;  4NR9 A;  4LYI A;  4A9I A;  4PTB A;  5HLS A;  5D3P A;  5E73 A;  4QSR A;  5F2P A;  5DBM A;  1F68 A;  4QZS A;  5CFW A;  4HXS A;  5E9Y A;  4QUU A;  4LDF A;  4UIT A;  4A9J A;  5E7D A;  5I80 A;  5DW1 A;  5KTX A;  4NXJ A;  4NQN A;  3MXF A;  5F60 A;  5HQ6 A;  4YBM A;  5D26 A;  2KTB B;  4O75 A;  4CL9 A;  3AAD A;  3JVK A;  4NYW A;  4QSV A;  5I40 A;  2YEM A;  2DKW A;  4QYD A;  4XYA A;  5A5Q A;  4C67 A;  3MB4 A;  5BT3 A;  5DKH A;  5ENB A;  5CQ5 A;  1N72 A;  5ENG A;  5C8G A;  3SVH A;  5KHM A;  3LQI A;  5L8U A;  4AKH A;  4A9N A;  3P1E A;  5FFW A;  5FE7 A;  5LJ2 A;  4UYD A;  4HXM A;  4UYH A;  4Z1Q A;  5E0R A;  3O36 A;  5JWM A;  5LUU A;  5FE9 A;  4BW2 A;  5CQ7 A;  5HQ5 A;  4AKN A;  4E96 A;  5F1L A;  4TTE A;  5D3T A;  3NXB A;  2D82 A;  5C87 A;  5A81 A;  2R0S A;  4O7E A;  5FG4 A;  3I3J A;  3AQA A;  3IU5 A;  4TZ8 A;  5LVQ A;  1WUM A;  5FFY A;  3IU6 A;  5EM3 A;  2F6J A;  5KTW A;  5DYC A;  1X0J A;  4TU6 A;  4LZR A;  5CPE A;  4IR3 A;  4Z6H A;  5HM0 A;  3UVX A;  2YW5 A;  1WUG A;  5D25 A;  4QEU A;  5DW2 A;  5F36 A;  5D3N A;  5HEN A;  4PKL A;  2R0Y A;  5DYA A;  2H60 A;  5CQ8 A;  2RS9 B;  3LQJ A;  5EIS A;  4UYE A;  4Y03 A;  2NXB A;  3K2J A;  3LQH A;  3S91 A;  4QUT A;  2YEL A;  5D3S A;  5A85 A;  5L97 A;  4NYV A;  2DVQ A;  4QSW A;  3SVG A;  4MR5 A;  4FLP A;  4TZ2 A;  5A5S A;  4LZS A;  4LRG A;  5HRX A;  4PCE A;  2R0V A;  5CQ4 A;  4N4I A;  3P5O A;  5IGN A;  2I8N A;  4MEN A;  4A9F A;  2E7N A;  2E3K A;  5LJ0 A;  5K29 A;  4OUF A;  5CQT A;  5ACY A;  5FE8 A;  5EPB A;  2F6N A;  5HQ7 A;  3UVW A;  4NUC A;  2RFJ A;  4CUP A;  5LJ1 A;  4F3I A;  2OSS A;  2L84 A;  3HME A;  4O74 A;  4YC9 A;  5CRM A;  5D24 A;  5IGL A;  5LKT A;  4OGI A;  2DVS A;  5A7C A;  4Z93 A;  5AME A;  4MR6 A;  4TQN A;  4YAX A;  4UIV A;  5DFB A;  3D7C A;  4YYJ A;  3MQM A;  4ALG A;  3MUL A;  5ENF A;  4A9O A;  3UVY A;  4O71 A;  5II1 A;  5I89 A;  5FG5 A;  5HJC A;  3SVF A;  5CGP A;  5EPR A;  4HXO A;  4OGJ A;  4J0R A;  4YH4 A;  2FSA A;  4MEP A;  3MB3 A;  2L5E A;  5LKX A;  2DAT A;  4IR4 A;  5FE3 A;  4CUR A;  4YBS A;  5CUE A;  4LZ2 A;  4N4F A;  5FH7 A;  5CS8 A;  2I7K A;  5E74 A;  5L96 A;  5FE2 A;  3U5L A;  4UIW A;  4TT6 A;  4IOR A;  2L85 A;  3U5K A;  2DVR A;  4NRB A;  4YYI A;  4NRC A;  5EK9 A;  4O7A A;  5ENH A;  5FH8 A;  5HCL A;  4J3I A;  4O7F A;  4ZW1 A;  5FBX A;  2R10 A;  5C89 A;  4QEV A;  4YYG A;  2N9G A;  5FE1 A;  5II2 A;  5A83 A;  5I1Q A;  2YYN A;  5EP7 A;  4WHU A;  4BHW A;  4A9E A;  5EIC A;  5CQA A;  4Q0O A;  5ENC A;  5A5N A;  4IR5 A;  2MJV B;  5L99 A;  5ENI A;  5H85 A;  4XUB A;  4AKG A;  4TS8 A;  3VKH A;  5IGM A;  4YBT A;  4NUE A;  4Z1S A;  4QYL A;  5EV9 A;  1PUO A;  1EQF A;  5FDZ A;  5C85 A;  4MEO A;  3UV5 A;  5JI8 A;  4YAB A;  4HBW A;  5F25 A;  4AKI A;  5CQ3 A;  5FH6 A;  4QR3 A;  5F61 A;  4Q0N A;  5EA1 A;  5F63 A;  5DY7 A;  4NR4 A;  4HBY A;  5E3G A;  4O70 A;  5EWH A;  1JM4 B;  4YK0 A;  5DKC A;  4QC1 A;  4LR6 A;  3S92 A;  3P1C A;  5ENJ A;  1E6I A;  5TCM A;  5DYU A;  4PS5 A;  4HXN A;  5BT4 A;  3G0L A;  5ETD A;  4O78 A;  4BW3 A;  4QB3 A;  4A9H A;  1ZS5 A;  5HRV A;  5E9V A;  4ALH A;  4UIY A;  4QEW A;  4XY8 A;  4CUS A;  3QZS A;  5E9K A;  3ONI A;  4QC3 A;  4CLB A;  4QY4 A;  4AI6 A;  4QST A;  2D9E A;  4KCX A;  5L8T A;  4LYW A;  3U5O A;  5EGU A;  5D3L A;  3TLP A;  4LC2 A;  4KV1 A;  5FE0 A;  1ZKR A;  4IOO A;  4UIX A;  5AD2 A;  5FE6 A;  4UIZ A;  4YH3 A;  5D7X A;  5I88 A;  4UYF A;  5E3D A;  5IID A;  4Z6I A;  4IR6 A;  5DX4 A;  4HXR A;  5KU3 A;  5CQ6 A;  2GRC A;  5CY9 A;  5DKD A;  4TT4 A;  5DLZ A;  5G4S A;  5FB1 A;  4O76 A;  4QSP A;  4PCI A;  2RNX A;  3LXJ A;  5CP5 A;  5EWC A;  5F1H A;  4HBX A;  4PY6 A;  5L98 A;  4YYD A;  5DLX A;  3ERR A;  5A5R A;  4HXK A;  5DFC A;  5FFV A;  3VKG A;  4YAD A;  4DON A;  5FE5 A;  5BT5 A;  5EPS A;  5E9I A;  2RNY A;  2YEK A;  4NUD A;  4MEQ A;  5EWW A;  5KO4 A;  4HXL A;  5HFR A;  2RNW A;  5I29 A;  4XUA A;  1JSP B;  4UIU A;  2DVV A;  3O37 A;  4WHW A;  5F3A A;  5COI A;  5TB6 A;  5FB0 A;  5CU8 A;  5J0D A;  4XY9 A;  5I7X A;  5DFD A;  4NR7 A;  5C7N A;  4O7B A;  5LKZ A;  4YYM A;  4YY4 A;  4CUT A;  5LVR A;  4HBV A;  4X2I A;  5IGK A;  5E9M A;  4QBM A;  5EI4 A;  5A5P A;  4YY6 A;  4C66 A;  5DYX A;  3GG3 A;  5HEL A;  3JVJ A;  5CZG A;  2DWW A;  2OO1 A;  4UYG A;  5ETB A;  5CUB A;  4A9L A;  4TT2 A;  3O33 A;  5EVA A; 
#chains in the Genus database with same CATH homology
 3O34 A;  5LKU A;  4CFK A;  4O7C A;  3FKM X;  4NYX A;  5E9L A;  3DAI A;  5HEM A;  3UVD A;  3G0J A;  4ZC9 A;  2E7O A;  4QR4 A;  3LJW A;  2YDW A;  5D3R A;  4TYL A;  4IOQ A;  5EU1 A;  4QSS A;  3Q2E A;  4CUU A;  4A9M A;  5HRW A;  3U5P A;  5CUD A;  4CUQ A;  4QSQ A;  4O72 A;  3Q2F A;  5EWV A;  5H1T A;  3ZYU A;  2RO1 A;  3O35 A;  4NR6 A;  5CUC A;  4NR8 A;  2WP1 A;  4BW1 A;  5HFQ A;  3U5M A;  5A82 A;  2G4A A;  3U5J A;  5AD3 A;  3P1D A;  3QZT A;  2RI7 A;  3HMH A;  4WIV A;  4GPJ A;  4QR5 A;  4UYF B;  4CFL A;  3U5N A;  5IG6 A;  5EWD A;  4LYS A;  4YAT A;  5D3J A;  5CTL A;  4J1P A;  4TU4 A;  5CUA A;  4O77 A;  4MR3 A;  5D3H A;  5H1V A;  4N4G A;  5KTU A;  4A9K A;  4BJX A;  5FE4 A;  4KV4 A;  5A5O A;  5AMF A;  5C4Q A;  4MR4 A;  2LSP B;  5ENE A;  5I86 A;  3HMF A;  3JVM A;  4N3W A;  3UV2 A;  3UW9 A;  4HXP A;  5H1U A;  4NQM A;  4ZQL A;  5F5Z A;  5G4R A;  5EQ1 A;  5D0C A;  4J0S A;  4QSU A;  4NR5 A;  3RCW A;  5CRZ A;  5IBN A;  3DWY A;  4RVR A;  5FG6 A;  3P1F A;  3JVL A;  4NRA A;  3MUK A;  4BW4 A;  5CUG A;  4YYN A;  4YYH A;  3QZV A;  2WP2 A;  5I7Y A;  5I83 A;  3UV4 A;  4QSX A;  4YYK A;  2YQD A;  4N4H A;  4QNS A;  2OUO A;  4NS5 A;  5F62 A;  4NR9 A;  4LYI A;  4A9I A;  4PTB A;  5HLS A;  5D3P A;  5E73 A;  4QSR A;  5F2P A;  5DBM A;  1F68 A;  4QZS A;  5CFW A;  4HXS A;  5E9Y A;  4QUU A;  4LDF A;  4UIT A;  4A9J A;  5E7D A;  5I80 A;  5DW1 A;  5KTX A;  4NXJ A;  4NQN A;  3MXF A;  5F60 A;  5HQ6 A;  4YBM A;  5D26 A;  2KTB B;  4O75 A;  4CL9 A;  3AAD A;  3JVK A;  4NYW A;  4QSV A;  5I40 A;  2YEM A;  2DKW A;  4QYD A;  4XYA A;  5A5Q A;  4C67 A;  3MB4 A;  5BT3 A;  5DKH A;  5ENB A;  5CQ5 A;  1N72 A;  5ENG A;  5C8G A;  3SVH A;  5KHM A;  3LQI A;  5L8U A;  4A9N A;  3P1E A;  5FFW A;  5FE7 A;  5LJ2 A;  4UYD A;  4HXM A;  4UYH A;  4Z1Q A;  5E0R A;  3O36 A;  5JWM A;  5LUU A;  5FE9 A;  4BW2 A;  5CQ7 A;  5HQ5 A;  4AKN A;  4E96 A;  5F1L A;  4TTE A;  5D3T A;  3NXB A;  2D82 A;  5C87 A;  5A81 A;  2R0S A;  4O7E A;  5FG4 A;  3I3J A;  3AQA A;  3IU5 A;  4TZ8 A;  5LVQ A;  1WUM A;  5FFY A;  3IU6 A;  5EM3 A;  2F6J A;  5KTW A;  5DYC A;  1X0J A;  4TU6 A;  4LZR A;  5CPE A;  4IR3 A;  4Z6H A;  5HM0 A;  3UVX A;  2YW5 A;  1WUG A;  5D25 A;  4QEU A;  5DW2 A;  5F36 A;  5D3N A;  5HEN A;  4PKL A;  2R0Y A;  5DYA A;  2H60 A;  5CQ8 A;  2RS9 B;  3LQJ A;  5EIS A;  4UYE A;  4Y03 A;  2NXB A;  3K2J A;  3LQH A;  3S91 A;  4QUT A;  2YEL A;  5D3S A;  5A85 A;  5L97 A;  4NYV A;  2DVQ A;  4QSW A;  3SVG A;  4MR5 A;  4FLP A;  4TZ2 A;  5A5S A;  4LZS A;  4LRG A;  5HRX A;  4PCE A;  2R0V A;  5CQ4 A;  4N4I A;  3P5O A;  5IGN A;  2I8N A;  4MEN A;  4A9F A;  2E7N A;  2E3K A;  5LJ0 A;  5K29 A;  4OUF A;  5CQT A;  5ACY A;  5FE8 A;  5EPB A;  2F6N A;  5HQ7 A;  3UVW A;  4NUC A;  2RFJ A;  4CUP A;  5LJ1 A;  4F3I A;  2OSS A;  2L84 A;  3HME A;  4O74 A;  4YC9 A;  5CRM A;  5D24 A;  5IGL A;  5LKT A;  4OGI A;  2DVS A;  5A7C A;  4Z93 A;  5AME A;  4MR6 A;  4TQN A;  4YAX A;  4UIV A;  5DFB A;  3D7C A;  4YYJ A;  3MQM A;  4ALG A;  3MUL A;  5ENF A;  4A9O A;  3UVY A;  4O71 A;  5II1 A;  5I89 A;  5FG5 A;  5HJC A;  3SVF A;  5CGP A;  5EPR A;  4HXO A;  4OGJ A;  4J0R A;  4YH4 A;  2FSA A;  4MEP A;  3MB3 A;  2L5E A;  5LKX A;  2DAT A;  4IR4 A;  5FE3 A;  4CUR A;  4YBS A;  5CUE A;  4LZ2 A;  4N4F A;  5FH7 A;  5CS8 A;  2I7K A;  5E74 A;  5L96 A;  5FE2 A;  3U5L A;  4UIW A;  4TT6 A;  4IOR A;  2L85 A;  3U5K A;  2DVR A;  4NRB A;  4YYI A;  4NRC A;  5EK9 A;  4O7A A;  5ENH A;  5FH8 A;  5HCL A;  4J3I A;  4O7F A;  4ZW1 A;  5FBX A;  2R10 A;  5C89 A;  4QEV A;  4YYG A;  2N9G A;  5FE1 A;  5II2 A;  5A83 A;  5I1Q A;  2YYN A;  5EP7 A;  4WHU A;  4BHW A;  4A9E A;  5EIC A;  5CQA A;  4Q0O A;  5ENC A;  5A5N A;  4IR5 A;  2MJV B;  5L99 A;  5ENI A;  5H85 A;  4XUB A;  4TS8 A;  5IGM A;  4YBT A;  4NUE A;  4Z1S A;  4QYL A;  5EV9 A;  1EQF A;  5FDZ A;  5C85 A;  4MEO A;  3UV5 A;  5JI8 A;  4YAB A;  4HBW A;  5F25 A;  5CQ3 A;  5FH6 A;  4QR3 A;  5F61 A;  4Q0N A;  5EA1 A;  5F63 A;  5DY7 A;  4NR4 A;  4HBY A;  5E3G A;  4O70 A;  5EWH A;  1JM4 B;  4YK0 A;  5DKC A;  4QC1 A;  4LR6 A;  3S92 A;  3P1C A;  5ENJ A;  1E6I A;  5TCM A;  5DYU A;  4PS5 A;  4HXN A;  5BT4 A;  3G0L A;  5ETD A;  4O78 A;  4BW3 A;  4QB3 A;  4A9H A;  1ZS5 A;  5HRV A;  5E9V A;  4ALH A;  4UIY A;  4QEW A;  4XY8 A;  4CUS A;  3QZS A;  5E9K A;  3ONI A;  4QC3 A;  4CLB A;  4QY4 A;  4QST A;  2D9E A;  4KCX A;  5L8T A;  4LYW A;  3U5O A;  5EGU A;  5D3L A;  3TLP A;  4LC2 A;  4KV1 A;  5FE0 A;  4IOO A;  4UIX A;  5AD2 A;  5FE6 A;  4UIZ A;  4YH3 A;  5D7X A;  5I88 A;  4UYF A;  5E3D A;  5IID A;  4Z6I A;  4IR6 A;  5DX4 A;  4HXR A;  5KU3 A;  5CQ6 A;  2GRC A;  5CY9 A;  5DKD A;  4TT4 A;  5DLZ A;  5G4S A;  5FB1 A;  4O76 A;  4QSP A;  4PCI A;  2RNX A;  3LXJ A;  5CP5 A;  5EWC A;  5F1H A;  4HBX A;  4PY6 A;  5L98 A;  4YYD A;  5DLX A;  5A5R A;  4HXK A;  5DFC A;  5FFV A;  4YAD A;  4DON A;  5FE5 A;  5BT5 A;  5EPS A;  5E9I A;  2RNY A;  2YEK A;  4NUD A;  4MEQ A;  5EWW A;  5KO4 A;  4HXL A;  5HFR A;  2RNW A;  5I29 A;  4XUA A;  1JSP B;  4UIU A;  2DVV A;  3O37 A;  4WHW A;  5F3A A;  5COI A;  5TB6 A;  5FB0 A;  5CU8 A;  5J0D A;  4XY9 A;  5I7X A;  5DFD A;  4NR7 A;  5C7N A;  4O7B A;  5LKZ A;  4YYM A;  4YY4 A;  4CUT A;  5LVR A;  4HBV A;  4X2I A;  5IGK A;  5E9M A;  4QBM A;  5EI4 A;  5A5P A;  4YY6 A;  4C66 A;  5DYX A;  3GG3 A;  5HEL A;  3JVJ A;  5CZG A;  2DWW A;  2OO1 A;  4UYG A;  5ETB A;  5CUB A;  4A9L A;  4TT2 A;  3O33 A;  5EVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...