5G4RA

Bromodomain of human brpf1 with n-1,3-dimethyl-6-2r-2- methylpiperazin-1-yl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl-2- methoxybenzamide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
LTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEREGRIN
publication title Gsk6853, a Chemical Probe for Inhibition of the Brpf1 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 39
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5g4rA00
3I3JA 4J0SA 4NRAA 5EISA 3UV5A 4TT6A 4PKLA 4MR6A 4IR6A 5ENBA 5F63A 2L85A 3MULA 1E6IA 5EV9A 5I29A 4Z1SA 5CQ7A 4KV1A 4QSVA 2OSSA 3ONIA 4YC9A 4XYAA 3HMFA 5HM0A 4NUDA 5A5QA 4YBTA 5FE7A 4IR5A 5I89A 4O7BA 4O77A 4QSQA 5A5PA 4Z6HA 3MB3A 4YYGA 4XUAA 5E9LA 5H1VA 5DYUA 4NUCA 5BT5A 5D26A 2LSPB 5D3PA 4PCEA 5IGNA 4O7AA 5D25A 5D24A 5I83A 4HXPA 5COIA 4FLPA 5I7XA 4XUBA 5IGKA 3U5LA 5EM3A 5LJ0A 5A5NA 4O75A 3S91A 5E7DA 4F3IA 5LKUA 3LXJA 4LYIA 3DAIA 3MB4A 4MR3A 5EWWA 4NR7A 2RFJA 5D3LA 5DYAA 2YEKA 5F2PA 2RNWA 5EWHA 4QB3A 5IGMA 5HENA 4NRCA 5E3GA 4NR5A 5CRMA 5DFDA 4LZSA 3IU6A 5ETBA 5L98A 5HEMA 5ENCA 5CZGA 5A5SA 5AMFA 4QY4A 3UW9A 5ACYA 5E0RA 5C89A 5HQ6A 4HXLA 4UYGA 5EPRA 3Q2FA 4WHUA 5A81A 4UYFA 5L97A 5DKDA 5CP5A 5JI8A 3LQJA 5AD2A 4UYHA 4Y03A 3P1FA 5DYXA 5FE2A 2YYNA 4HXMA 5LJ2A 5F36A 4YK0A 4CLBA 4WHWA 4YYIA 3O34A 5F3AA 4TU4A 5DBMA 5E73A 4N4IA 5DW1A 5ENHA 2E7NA 4XY9A 4YATA 5ENFA 5LKZA 3G0JA 3JVMA 5ENIA 4ALHA 5A5RA 5FE9A 5EVAA 3QZVA 5CTLA 4A9OA 3UVYA 5C4QA 5CQ4A 4J1PA 1F68A 2WP2A 3SVHA 3AQAA 5J0DA 5FE4A 4BW4A 5A7CA 4RVRA 5FE3A 4O76A 2RNXA 5K29A 3O36A 4O72A 5E74A 4IORA 5I1QA 5FG4A 2WP1A 5IIDA 2OO1A 3UV2A 5F1LA 4HBVA 4A9IA 4NR6A 3UV4A 2DVQA 4O74A 4HBXA 3IU5A 4TT4A 3TLPA 4CUPA 3G0LA 3U5JA 4QC3A 2F6JA 5F5ZA 5KHMA 5H1TA 4IR4A 4YYHA 4O71A 5CQ3A 4HXSA 5FBXA 5D3NA 5CGPA 2RO1A 4MR5A 5IBNA 3U5NA 4LC2A 4MEPA 4QBMA 5EPBA 5CUBA 5F62A 4IR3A 3NXBA 5I7YA 5D7XA 2G4AA 4BW3A 2GRCA 4UIVA 3SVFA 3O33A 5I88A 4HXKA 4BHWA 4C66A 4NR8A 4CUUA 5FH7A 4Q0NA 5II1A 4CFKA 5EICA 4CUTA 4QNSA 4NYWA 5FE8A 4PS5A 1N72A 4A9FA 3U5KA 5CUGA 4UYEA 3LQHA 5FE5A 5CUEA 5FG6A 5D3TA 5LKTA 5CQTA 4YYJA 2FSAA 3O35A 5HJCA 2D9EA 2DVVA 3U5OA 5I80A 2YW5A 4UYDA 5E9YA 5KTWA 4N4FA 3JVLA 4IOQA 2DVRA 4KV4A 3QZTA 5CQ8A 4ALGA 3UVXA 4QUTA 4Z93A 4QSUA 5F60A 5G4SA 4LYSA 4UIZA 4CFLA 5H1UA 4NUEA 5KU3A 5LKXA 5F25A 2L84A 4CL9A 5EGUA 4OGIA 4YBMA 2DWWA 4YBSA 5BT3A 4O7CA 5KTXA 3MQMA 5FG5A 5FE1A 5HQ7A 5A85A 5C87A 5LVQA 3ZYUA 5HLSA 4LRGA 2I7KA 5A5OA 4DONA 3MXFA 3HMEA 3UVWA 5FB0A 5CRZA 5BT4A 5FFVA 4A9EA 3U5MA 4HXNA 5A83A 4LR6A 4O7EA 4UIWA 4MEOA 3P5OA 4IOOA 3UVDA 5DKHA 4QR4A 2RI7A 4NQMA 4QYLA 5H85A 5D0CA 4GPJA 4QR5A 4TQNA 4QSWA 4J3IA 4Z6IA 4KCXA 2YELA 5DLXA 2D82A 5ETDA 2E3KA 4UYFB 2E7OA 4QZSA 5DKCA 5C8GA 4J0RA 5EWVA 4YYDA 5TB6A 5LJ1A 5FE0A 4ZC9A 5KTUA 4Z1QA 4YY4A 5F1HA 2YEMA 5EWDA 4TZ8A 2KTBB 3K2JA 3LQIA 4LZ2A 2H60A 4NYVA 4TTEA 5CUDA 5ENJA 5TCMA 4WIVA 3DWYA 2NXBA 5CFWA 5FE6A 5FH6A 5ENEA 4A9LA 4OUFA 5EU1A 4QSXA 4TU6A 5D3SA 1WUGA 5IG6A 3QZSA 5CS8A 4YADA 4N3WA 5L99A 5HELA 5EA1A 4HXRA 4YYMA 2DVSA 5LVRA 2I8NA 3P1DA 4QEVA 5C7NA 5L8TA 5C85A 5CU8A 1JSPB 3MUKA 4QSSA 5D3RA 3JVJA 4NR9A 1EQFA 4NS5A 5FFWA 2MJVB 4QEWA 4TT2A 4YY6A 4MENA 4BW1A 5HRXA 2R0SA 5E3DA 4CUSA 5DLZA 5I40A 4NRBA 4NXJA 4YH4A 3GG3A 2N9GA 5HQ5A 4A9JA 3Q2EA 2RNYA 5EWCA 4A9KA 4QYDA 5KO4A 4QUUA 3FKMX 4PY6A 4HBYA 4QR3A 5EP7A 3P1EA 4PTBA 5G4RA 5A82A 4HBWA 3HMHA 4TYLA 5JWMA 5D3HA 5CUCA 5I86A 4MR4A 5F61A 4X2IA 5L96A 4QEUA 4PCIA 4BJXA 4ZQLA 4CUQA 2L5EA 5DX4A 3JVKA 2F6NA 4LDFA 3U5PA 2R10A 4LZRA 2OUOA 5DY7A 4YABA 3AADA 5DYCA 1WUMA 4YYNA 4AKNA 5E9IA 4E96A 5CUAA 4OGJA 4NR4A 4A9NA 4MEQA 5HRVA 4HXOA 3RCWA 4QC1A 5AMEA 4A9HA 5EK9A 4N4GA 4UITA 5L8UA 5EI4A 5HRWA 4QSPA 5E9MA 4LYWA 5FH8A 1JM4B 3D7CA 5CQ6A 5D3JA 5HCLA 4TS8A 2RS9B 4O70A 1X0JA 5LUUA 5DFBA 3SVGA 5IGLA 2YQDA 3O37A 5HFRA 4TZ2A 4UIXA 4UIYA 4QSTA 4QSRA 5EPSA 2DKWA 4CURA 5CY9A 2DATA 4O78A 4NQNA 4NYXA 4O7FA 4A9MA 5HFQA 5ENGA 4ZW1A 1ZS5A 3P1CA 5II2A 5AD3A 4Q0OA 4YH3A 2R0VA 3S92A 2YDWA 5FFYA 4XY8A 5E9KA 5CQAA 4YAXA 5FB1A 4C67A 5DFCA 4UIUA 4N4HA 5FDZA 4BW2A 5CQ5A 5CPEA 5DW2A 4YYKA 5EQ1A 2R0YA 3LJWA 5E9VA
chains in the Genus database with same CATH superfamily
3I3JA 4J0SA 4NRAA 5EISA 3UV5A 4TT6A 4PKLA 4MR6A 4IR6A 5ENBA 5F63A 2L85A 3MULA 1E6IA 5EV9A 5I29A 4Z1SA 5CQ7A 4KV1A 4AI6A 4QSVA 2OSSA 3ONIA 4YC9A 4XYAA 3HMFA 5HM0A 4NUDA 5A5QA 4YBTA 5FE7A 4IR5A 5I89A 4O7BA 4O77A 4QSQA 5A5PA 4Z6HA 3MB3A 4YYGA 4XUAA 5E9LA 5H1VA 5DYUA 4NUCA 5BT5A 5D26A 2LSPB 5D3PA 4PCEA 5IGNA 4AKHA 4O7AA 5D25A 5D24A 5I83A 4HXPA 5COIA 4FLPA 5I7XA 4XUBA 5IGKA 3U5LA 5EM3A 5LJ0A 5A5NA 4O75A 3S91A 5E7DA 4F3IA 5LKUA 3LXJA 4LYIA 3DAIA 3MB4A 4MR3A 5EWWA 4NR7A 2RFJA 5D3LA 5DYAA 2YEKA 5F2PA 2RNWA 5EWHA 4QB3A 5IGMA 5HENA 4NRCA 5E3GA 4NR5A 5CRMA 5DFDA 4LZSA 3IU6A 5ETBA 5L98A 5HEMA 5ENCA 5CZGA 5A5SA 5AMFA 4QY4A 3UW9A 5ACYA 5E0RA 5C89A 5HQ6A 4HXLA 4UYGA 5EPRA 3Q2FA 4WHUA 5A81A 4UYFA 5L97A 5DKDA 5CP5A 5JI8A 3LQJA 5AD2A 4UYHA 4Y03A 3P1FA 5DYXA 5FE2A 2YYNA 4HXMA 5LJ2A 5F36A 4YK0A 4CLBA 4WHWA 4YYIA 3ERRA 3O34A 5F3AA 4TU4A 5DBMA 5E73A 4N4IA 5DW1A 3VKHA 5ENHA 2E7NA 4XY9A 4YATA 5ENFA 5LKZA 3G0JA 3JVMA 5ENIA 4ALHA 5A5RA 5FE9A 5EVAA 3QZVA 5CTLA 4A9OA 3UVYA 5C4QA 5CQ4A 4J1PA 1F68A 2WP2A 3SVHA 4AKGA 3AQAA 5J0DA 5FE4A 4BW4A 5A7CA 4RVRA 5FE3A 4O76A 2RNXA 5K29A 3O36A 4O72A 5E74A 4IORA 5I1QA 5FG4A 2WP1A 5IIDA 2OO1A 3UV2A 5F1LA 4HBVA 4A9IA 4NR6A 3UV4A 2DVQA 4O74A 4HBXA 3IU5A 4TT4A 3TLPA 4CUPA 3G0LA 3U5JA 4QC3A 2F6JA 5F5ZA 5KHMA 5H1TA 4IR4A 4YYHA 4O71A 5CQ3A 4HXSA 5FBXA 5D3NA 5CGPA 2RO1A 4MR5A 5IBNA 3U5NA 4LC2A 4MEPA 4QBMA 5EPBA 5CUBA 5F62A 4IR3A 3NXBA 5I7YA 5D7XA 2G4AA 4BW3A 2GRCA 4UIVA 3SVFA 3O33A 5I88A 4HXKA 4BHWA 4C66A 4NR8A 3VKGA 4CUUA 5FH7A 4Q0NA 5II1A 4CFKA 5EICA 4CUTA 4QNSA 4NYWA 5FE8A 4PS5A 1N72A 4A9FA 3U5KA 5CUGA 4UYEA 3LQHA 5FE5A 5CUEA 5FG6A 5D3TA 5LKTA 5CQTA 4YYJA 2FSAA 3O35A 5HJCA 2D9EA 2DVVA 3U5OA 5I80A 2YW5A 4UYDA 5E9YA 5KTWA 4N4FA 3JVLA 4IOQA 2DVRA 4KV4A 3QZTA 5CQ8A 4ALGA 3UVXA 4QUTA 4Z93A 4QSUA 5F60A 5G4SA 4LYSA 4UIZA 4CFLA 5H1UA 4NUEA 5KU3A 5LKXA 2EJNA 5F25A 2L84A 4CL9A 5EGUA 4OGIA 4YBMA 2DWWA 4YBSA 5BT3A 4O7CA 5KTXA 3MQMA 5FG5A 5FE1A 5HQ7A 5A85A 5C87A 5LVQA 3ZYUA 5HLSA 3D1BA 4LRGA 2I7KA 5A5OA 4DONA 3MXFA 3HMEA 3UVWA 5FB0A 5CRZA 5BT4A 5FFVA 4A9EA 3U5MA 4HXNA 5A83A 4LR6A 4O7EA 4UIWA 4MEOA 3P5OA 4IOOA 3UVDA 5DKHA 4QR4A 2RI7A 1ZKRA 4NQMA 4QYLA 5H85A 5D0CA 4GPJA 4QR5A 4TQNA 4QSWA 4J3IA 4Z6IA 4KCXA 2YELA 5DLXA 2D82A 5ETDA 2E3KA 4UYFB 2E7OA 4QZSA 5DKCA 5C8GA 4J0RA 5EWVA 4YYDA 5TB6A 5LJ1A 5FE0A 4ZC9A 5KTUA 4Z1QA 4YY4A 5F1HA 2YEMA 5EWDA 4TZ8A 2KTBB 3K2JA 3LQIA 4LZ2A 2H60A 4NYVA 4TTEA 5CUDA 5ENJA 5TCMA 4WIVA 3DWYA 2NXBA 5CFWA 5FE6A 5FH6A 5ENEA 4A9LA 4OUFA 5EU1A 4QSXA 4TU6A 5D3SA 1WUGA 5IG6A 3QZSA 5CS8A 4YADA 4N3WA 5L99A 5HELA 5EA1A 4HXRA 4YYMA 2DVSA 5LVRA 2I8NA 3P1DA 4QEVA 5C7NA 5L8TA 5C85A 5CU8A 1JSPB 3MUKA 4QSSA 5D3RA 3JVJA 4NR9A 1EQFA 4NS5A 5FFWA 2MJVB 4QEWA 4TT2A 4YY6A 4MENA 4BW1A 5HRXA 2R0SA 5E3DA 4CUSA 5DLZA 5I40A 4NRBA 4NXJA 4YH4A 3GG3A 2N9GA 5HQ5A 4A9JA 3Q2EA 2RNYA 5EWCA 4A9KA 4QYDA 5KO4A 4QUUA 3FKMX 4PY6A 4HBYA 4QR3A 5EP7A 3P1EA 4PTBA 5G4RA 5A82A 4HBWA 3HMHA 4TYLA 5JWMA 5D3HA 5CUCA 5I86A 4MR4A 5F61A 1PUOA 4X2IA 5L96A 4QEUA 4PCIA 4BJXA 4ZQLA 4CUQA 2L5EA 5DX4A 3JVKA 2F6NA 4LDFA 3U5PA 2R10A 4LZRA 2OUOA 5DY7A 4YABA 3AADA 5DYCA 1WUMA 4YYNA 4AKNA 5E9IA 4E96A 5CUAA 4OGJA 4NR4A 4A9NA 4MEQA 5HRVA 4HXOA 3RCWA 4QC1A 5AMEA 4A9HA 5EK9A 4N4GA 4UITA 5L8UA 5EI4A 5HRWA 4QSPA 5E9MA 4LYWA 5FH8A 1JM4B 3D7CA 5CQ6A 5D3JA 5HCLA 4TS8A 2RS9B 4O70A 1X0JA 5LUUA 5DFBA 3SVGA 5IGLA 2YQDA 3O37A 5HFRA 4TZ2A 4UIXA 4UIYA 4QSTA 4QSRA 5EPSA 2DKWA 4CURA 5CY9A 2DATA 4O78A 4NQNA 4NYXA 4O7FA 4A9MA 5HFQA 5ENGA 4ZW1A 1ZS5A 3P1CA 5II2A 5AD3A 4Q0OA 4YH3A 2R0VA 3S92A 2YDWA 5FFYA 4XY8A 5E9KA 5CQAA 3D1DA 4YAXA 4AKIA 5FB1A 4C67A 5DFCA 4UIUA 4N4HA 5FDZA 4BW2A 5CQ5A 5CPEA 5DW2A 4YYKA 5EQ1A 2R0YA 3LJWA 5E9VA
chains in the Genus database with same CATH topology
3I3JA 4J0SA 4NRAA 5EISA 3UV5A 4TT6A 4PKLA 4MR6A 4IR6A 5ENBA 5F63A 2L85A 3MULA 1E6IA 5EV9A 5I29A 4Z1SA 5CQ7A 4KV1A 4QSVA 2OSSA 3ONIA 4YC9A 4XYAA 3HMFA 5HM0A 4NUDA 5A5QA 4YBTA 5FE7A 4IR5A 5I89A 4O7BA 4O77A 4QSQA 5A5PA 4Z6HA 3MB3A 4YYGA 4XUAA 5E9LA 5H1VA 5DYUA 4NUCA 5BT5A 5D26A 2LSPB 5D3PA 4PCEA 5IGNA 4O7AA 5D25A 5D24A 5I83A 4HXPA 5COIA 4FLPA 5I7XA 4XUBA 5IGKA 3U5LA 5EM3A 5LJ0A 5A5NA 4O75A 3S91A 5E7DA 4F3IA 5LKUA 3LXJA 4LYIA 3DAIA 3MB4A 4MR3A 5EWWA 4NR7A 2RFJA 5D3LA 5DYAA 2YEKA 5F2PA 2RNWA 5EWHA 4QB3A 5IGMA 5HENA 4NRCA 5E3GA 4NR5A 5CRMA 5DFDA 4LZSA 3IU6A 5ETBA 5L98A 5HEMA 5ENCA 5CZGA 5A5SA 5AMFA 4QY4A 3UW9A 5ACYA 5E0RA 5C89A 5HQ6A 4HXLA 4UYGA 5EPRA 3Q2FA 4WHUA 5A81A 4UYFA 5L97A 5DKDA 5CP5A 5JI8A 3LQJA 5AD2A 4UYHA 4Y03A 3P1FA 5DYXA 5FE2A 2YYNA 4HXMA 5LJ2A 5F36A 4YK0A 4CLBA 4WHWA 4YYIA 3O34A 5F3AA 4TU4A 5DBMA 5E73A 4N4IA 5DW1A 5ENHA 2E7NA 4XY9A 4YATA 5ENFA 5LKZA 3G0JA 3JVMA 5ENIA 4ALHA 5A5RA 5FE9A 5EVAA 3QZVA 5CTLA 4A9OA 3UVYA 5C4QA 5CQ4A 4J1PA 1F68A 2WP2A 3SVHA 3AQAA 5J0DA 5FE4A 4BW4A 5A7CA 4RVRA 5FE3A 4O76A 2RNXA 5K29A 3O36A 4O72A 5E74A 4IORA 5I1QA 5FG4A 2WP1A 5IIDA 2OO1A 3UV2A 5F1LA 4HBVA 4A9IA 4NR6A 3UV4A 2DVQA 4O74A 4HBXA 3IU5A 4TT4A 3TLPA 4CUPA 3G0LA 3U5JA 4QC3A 2F6JA 5F5ZA 5KHMA 5H1TA 4IR4A 4YYHA 4O71A 5CQ3A 4HXSA 5FBXA 5D3NA 5CGPA 2RO1A 4MR5A 5IBNA 3U5NA 4LC2A 4MEPA 4QBMA 5EPBA 5CUBA 5F62A 4IR3A 3NXBA 5I7YA 5D7XA 2G4AA 4BW3A 2GRCA 4UIVA 3SVFA 3O33A 5I88A 4HXKA 4BHWA 4C66A 4NR8A 4CUUA 5FH7A 4Q0NA 5II1A 4CFKA 5EICA 4CUTA 4QNSA 4NYWA 5FE8A 4PS5A 1N72A 4A9FA 3U5KA 5CUGA 4UYEA 3LQHA 5FE5A 5CUEA 5FG6A 5D3TA 5LKTA 5CQTA 4YYJA 2FSAA 3O35A 5HJCA 2D9EA 2DVVA 3U5OA 5I80A 2YW5A 4UYDA 5E9YA 5KTWA 4N4FA 3JVLA 4IOQA 2DVRA 4KV4A 3QZTA 5CQ8A 4ALGA 3UVXA 4QUTA 4Z93A 4QSUA 5F60A 5G4SA 4LYSA 4UIZA 4CFLA 5H1UA 4NUEA 5KU3A 5LKXA 5F25A 2L84A 4CL9A 5EGUA 4OGIA 4YBMA 2DWWA 4YBSA 5BT3A 4O7CA 5KTXA 3MQMA 5FG5A 5FE1A 5HQ7A 5A85A 5C87A 5LVQA 3ZYUA 5HLSA 4LRGA 2I7KA 5A5OA 4DONA 3MXFA 3HMEA 3UVWA 5FB0A 5CRZA 5BT4A 5FFVA 4A9EA 3U5MA 4HXNA 5A83A 4LR6A 4O7EA 4UIWA 4MEOA 3P5OA 4IOOA 3UVDA 5DKHA 4QR4A 2RI7A 4NQMA 4QYLA 5H85A 5D0CA 4GPJA 4QR5A 4TQNA 4QSWA 4J3IA 4Z6IA 4KCXA 2YELA 5DLXA 2D82A 5ETDA 2E3KA 4UYFB 2E7OA 4QZSA 5DKCA 5C8GA 4J0RA 5EWVA 4YYDA 5TB6A 5LJ1A 5FE0A 4ZC9A 5KTUA 4Z1QA 4YY4A 5F1HA 2YEMA 5EWDA 4TZ8A 2KTBB 3K2JA 3LQIA 4LZ2A 2H60A 4NYVA 4TTEA 5CUDA 5ENJA 5TCMA 4WIVA 3DWYA 2NXBA 5CFWA 5FE6A 5FH6A 5ENEA 4A9LA 4OUFA 5EU1A 4QSXA 4TU6A 5D3SA 1WUGA 5IG6A 3QZSA 5CS8A 4YADA 4N3WA 5L99A 5HELA 5EA1A 4HXRA 4YYMA 2DVSA 5LVRA 2I8NA 3P1DA 4QEVA 5C7NA 5L8TA 5C85A 5CU8A 1JSPB 3MUKA 4QSSA 5D3RA 3JVJA 4NR9A 1EQFA 4NS5A 5FFWA 2MJVB 4QEWA 4TT2A 4YY6A 4MENA 4BW1A 5HRXA 2R0SA 5E3DA 4CUSA 5DLZA 5I40A 4NRBA 4NXJA 4YH4A 3GG3A 2N9GA 5HQ5A 4A9JA 3Q2EA 2RNYA 5EWCA 4A9KA 4QYDA 5KO4A 4QUUA 3FKMX 4PY6A 4HBYA 4QR3A 5EP7A 3P1EA 4PTBA 5G4RA 5A82A 4HBWA 3HMHA 4TYLA 5JWMA 5D3HA 5CUCA 5I86A 4MR4A 5F61A 4X2IA 5L96A 4QEUA 4PCIA 4BJXA 4ZQLA 4CUQA 2L5EA 5DX4A 3JVKA 2F6NA 4LDFA 3U5PA 2R10A 4LZRA 2OUOA 5DY7A 4YABA 3AADA 5DYCA 1WUMA 4YYNA 4AKNA 5E9IA 4E96A 5CUAA 4OGJA 4NR4A 4A9NA 4MEQA 5HRVA 4HXOA 3RCWA 4QC1A 5AMEA 4A9HA 5EK9A 4N4GA 4UITA 5L8UA 5EI4A 5HRWA 4QSPA 5E9MA 4LYWA 5FH8A 1JM4B 3D7CA 5CQ6A 5D3JA 5HCLA 4TS8A 2RS9B 4O70A 1X0JA 5LUUA 5DFBA 3SVGA 5IGLA 2YQDA 3O37A 5HFRA 4TZ2A 4UIXA 4UIYA 4QSTA 4QSRA 5EPSA 2DKWA 4CURA 5CY9A 2DATA 4O78A 4NQNA 4NYXA 4O7FA 4A9MA 5HFQA 5ENGA 4ZW1A 1ZS5A 3P1CA 5II2A 5AD3A 4Q0OA 4YH3A 2R0VA 3S92A 2YDWA 5FFYA 4XY8A 5E9KA 5CQAA 4YAXA 5FB1A 4C67A 5DFCA 4UIUA 4N4HA 5FDZA 4BW2A 5CQ5A 5CPEA 5DW2A 4YYKA 5EQ1A 2R0YA 3LJWA 5E9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3J A;  4J0S A;  4NRA A;  5EIS A;  3UV5 A;  4TT6 A;  4PKL A;  4MR6 A;  4IR6 A;  5ENB A;  5F63 A;  2L85 A;  3MUL A;  1E6I A;  5EV9 A;  5I29 A;  4Z1S A;  5CQ7 A;  4KV1 A;  4QSV A;  2OSS A;  3ONI A;  4YC9 A;  4XYA A;  3HMF A;  5HM0 A;  4NUD A;  5A5Q A;  4YBT A;  5FE7 A;  4IR5 A;  5I89 A;  4O7B A;  4O77 A;  4QSQ A;  5A5P A;  4Z6H A;  3MB3 A;  4YYG A;  4XUA A;  5E9L A;  5H1V A;  5DYU A;  4NUC A;  5BT5 A;  5D26 A;  2LSP B;  5D3P A;  4PCE A;  5IGN A;  4O7A A;  5D25 A;  5D24 A;  5I83 A;  4HXP A;  5COI A;  4FLP A;  5I7X A;  4XUB A;  5IGK A;  3U5L A;  5EM3 A;  5LJ0 A;  5A5N A;  4O75 A;  3S91 A;  5E7D A;  4F3I A;  5LKU A;  3LXJ A;  4LYI A;  3DAI A;  3MB4 A;  4MR3 A;  5EWW A;  4NR7 A;  2RFJ A;  5D3L A;  5DYA A;  2YEK A;  5F2P A;  2RNW A;  5EWH A;  4QB3 A;  5IGM A;  5HEN A;  4NRC A;  5E3G A;  4NR5 A;  5CRM A;  5DFD A;  4LZS A;  3IU6 A;  5ETB A;  5L98 A;  5HEM A;  5ENC A;  5CZG A;  5A5S A;  5AMF A;  4QY4 A;  3UW9 A;  5ACY A;  5E0R A;  5C89 A;  5HQ6 A;  4HXL A;  4UYG A;  5EPR A;  3Q2F A;  4WHU A;  5A81 A;  4UYF A;  5L97 A;  5DKD A;  5CP5 A;  5JI8 A;  3LQJ A;  5AD2 A;  4UYH A;  4Y03 A;  3P1F A;  5DYX A;  5FE2 A;  2YYN A;  4HXM A;  5LJ2 A;  5F36 A;  4YK0 A;  4CLB A;  4WHW A;  4YYI A;  3O34 A;  5F3A A;  4TU4 A;  5DBM A;  5E73 A;  4N4I A;  5DW1 A;  5ENH A;  2E7N A;  4XY9 A;  4YAT A;  5ENF A;  5LKZ A;  3G0J A;  3JVM A;  5ENI A;  4ALH A;  5A5R A;  5FE9 A;  5EVA A;  3QZV A;  5CTL A;  4A9O A;  3UVY A;  5C4Q A;  5CQ4 A;  4J1P A;  1F68 A;  2WP2 A;  3SVH A;  3AQA A;  5J0D A;  5FE4 A;  4BW4 A;  5A7C A;  4RVR A;  5FE3 A;  4O76 A;  2RNX A;  5K29 A;  3O36 A;  4O72 A;  5E74 A;  4IOR A;  5I1Q A;  5FG4 A;  2WP1 A;  5IID A;  2OO1 A;  3UV2 A;  5F1L A;  4HBV A;  4A9I A;  4NR6 A;  3UV4 A;  2DVQ A;  4O74 A;  4HBX A;  3IU5 A;  4TT4 A;  3TLP A;  4CUP A;  3G0L A;  3U5J A;  4QC3 A;  2F6J A;  5F5Z A;  5KHM A;  5H1T A;  4IR4 A;  4YYH A;  4O71 A;  5CQ3 A;  4HXS A;  5FBX A;  5D3N A;  5CGP A;  2RO1 A;  4MR5 A;  5IBN A;  3U5N A;  4LC2 A;  4MEP A;  4QBM A;  5EPB A;  5CUB A;  5F62 A;  4IR3 A;  3NXB A;  5I7Y A;  5D7X A;  2G4A A;  4BW3 A;  2GRC A;  4UIV A;  3SVF A;  3O33 A;  5I88 A;  4HXK A;  4BHW A;  4C66 A;  4NR8 A;  4CUU A;  5FH7 A;  4Q0N A;  5II1 A;  4CFK A;  5EIC A;  4CUT A;  4QNS A;  4NYW A;  5FE8 A;  4PS5 A;  1N72 A;  4A9F A;  3U5K A;  5CUG A;  4UYE A;  3LQH A;  5FE5 A;  5CUE A;  5FG6 A;  5D3T A;  5LKT A;  5CQT A;  4YYJ A;  2FSA A;  3O35 A;  5HJC A;  2D9E A;  2DVV A;  3U5O A;  5I80 A;  2YW5 A;  4UYD A;  5E9Y A;  5KTW A;  4N4F A;  3JVL A;  4IOQ A;  2DVR A;  4KV4 A;  3QZT A;  5CQ8 A;  4ALG A;  3UVX A;  4QUT A;  4Z93 A;  4QSU A;  5F60 A;  5G4S A;  4LYS A;  4UIZ A;  4CFL A;  5H1U A;  4NUE A;  5KU3 A;  5LKX A;  5F25 A;  2L84 A;  4CL9 A;  5EGU A;  4OGI A;  4YBM A;  2DWW A;  4YBS A;  5BT3 A;  4O7C A;  5KTX A;  3MQM A;  5FG5 A;  5FE1 A;  5HQ7 A;  5A85 A;  5C87 A;  5LVQ A;  3ZYU A;  5HLS A;  4LRG A;  2I7K A;  5A5O A;  4DON A;  3MXF A;  3HME A;  3UVW A;  5FB0 A;  5CRZ A;  5BT4 A;  5FFV A;  4A9E A;  3U5M A;  4HXN A;  5A83 A;  4LR6 A;  4O7E A;  4UIW A;  4MEO A;  3P5O A;  4IOO A;  3UVD A;  5DKH A;  4QR4 A;  2RI7 A;  4NQM A;  4QYL A;  5H85 A;  5D0C A;  4GPJ A;  4QR5 A;  4TQN A;  4QSW A;  4J3I A;  4Z6I A;  4KCX A;  2YEL A;  5DLX A;  2D82 A;  5ETD A;  2E3K A;  4UYF B;  2E7O A;  4QZS A;  5DKC A;  5C8G A;  4J0R A;  5EWV A;  4YYD A;  5TB6 A;  5LJ1 A;  5FE0 A;  4ZC9 A;  5KTU A;  4Z1Q A;  4YY4 A;  5F1H A;  2YEM A;  5EWD A;  4TZ8 A;  2KTB B;  3K2J A;  3LQI A;  4LZ2 A;  2H60 A;  4NYV A;  4TTE A;  5CUD A;  5ENJ A;  5TCM A;  4WIV A;  3DWY A;  2NXB A;  5CFW A;  5FE6 A;  5FH6 A;  5ENE A;  4A9L A;  4OUF A;  5EU1 A;  4QSX A;  4TU6 A;  5D3S A;  1WUG A;  5IG6 A;  3QZS A;  5CS8 A;  4YAD A;  4N3W A;  5L99 A;  5HEL A;  5EA1 A;  4HXR A;  4YYM A;  2DVS A;  5LVR A;  2I8N A;  3P1D A;  4QEV A;  5C7N A;  5L8T A;  5C85 A;  5CU8 A;  1JSP B;  3MUK A;  4QSS A;  5D3R A;  3JVJ A;  4NR9 A;  1EQF A;  4NS5 A;  5FFW A;  2MJV B;  4QEW A;  4TT2 A;  4YY6 A;  4MEN A;  4BW1 A;  5HRX A;  2R0S A;  5E3D A;  4CUS A;  5DLZ A;  5I40 A;  4NRB A;  4NXJ A;  4YH4 A;  3GG3 A;  2N9G A;  5HQ5 A;  4A9J A;  3Q2E A;  2RNY A;  5EWC A;  4A9K A;  4QYD A;  5KO4 A;  4QUU A;  3FKM X;  4PY6 A;  4HBY A;  4QR3 A;  5EP7 A;  3P1E A;  4PTB A;  5G4R A;  5A82 A;  4HBW A;  3HMH A;  4TYL A;  5JWM A;  5D3H A;  5CUC A;  5I86 A;  4MR4 A;  5F61 A;  4X2I A;  5L96 A;  4QEU A;  4PCI A;  4BJX A;  4ZQL A;  4CUQ A;  2L5E A;  5DX4 A;  3JVK A;  2F6N A;  4LDF A;  3U5P A;  2R10 A;  4LZR A;  2OUO A;  5DY7 A;  4YAB A;  3AAD A;  5DYC A;  1WUM A;  4YYN A;  4AKN A;  5E9I A;  4E96 A;  5CUA A;  4OGJ A;  4NR4 A;  4A9N A;  4MEQ A;  5HRV A;  4HXO A;  3RCW A;  4QC1 A;  5AME A;  4A9H A;  5EK9 A;  4N4G A;  4UIT A;  5L8U A;  5EI4 A;  5HRW A;  4QSP A;  5E9M A;  4LYW A;  5FH8 A;  1JM4 B;  3D7C A;  5CQ6 A;  5D3J A;  5HCL A;  4TS8 A;  2RS9 B;  4O70 A;  1X0J A;  5LUU A;  5DFB A;  3SVG A;  5IGL A;  2YQD A;  3O37 A;  5HFR A;  4TZ2 A;  4UIX A;  4UIY A;  4QST A;  4QSR A;  5EPS A;  2DKW A;  4CUR A;  5CY9 A;  2DAT A;  4O78 A;  4NQN A;  4NYX A;  4O7F A;  4A9M A;  5HFQ A;  5ENG A;  4ZW1 A;  1ZS5 A;  3P1C A;  5II2 A;  5AD3 A;  4Q0O A;  4YH3 A;  2R0V A;  3S92 A;  2YDW A;  5FFY A;  4XY8 A;  5E9K A;  5CQA A;  4YAX A;  5FB1 A;  4C67 A;  5DFC A;  4UIU A;  4N4H A;  5FDZ A;  4BW2 A;  5CQ5 A;  5CPE A;  5DW2 A;  4YYK A;  5EQ1 A;  2R0Y A;  3LJW A;  5E9V A; 
#chains in the Genus database with same CATH topology
 3I3J A;  4J0S A;  4NRA A;  5EIS A;  3UV5 A;  4TT6 A;  4PKL A;  4MR6 A;  4IR6 A;  5ENB A;  5F63 A;  2L85 A;  3MUL A;  1E6I A;  5EV9 A;  5I29 A;  4Z1S A;  5CQ7 A;  4KV1 A;  4AI6 A;  4QSV A;  2OSS A;  3ONI A;  4YC9 A;  4XYA A;  3HMF A;  5HM0 A;  4NUD A;  5A5Q A;  4YBT A;  5FE7 A;  4IR5 A;  5I89 A;  4O7B A;  4O77 A;  4QSQ A;  5A5P A;  4Z6H A;  3MB3 A;  4YYG A;  4XUA A;  5E9L A;  5H1V A;  5DYU A;  4NUC A;  5BT5 A;  5D26 A;  2LSP B;  5D3P A;  4PCE A;  5IGN A;  4AKH A;  4O7A A;  5D25 A;  5D24 A;  5I83 A;  4HXP A;  5COI A;  4FLP A;  5I7X A;  4XUB A;  5IGK A;  3U5L A;  5EM3 A;  5LJ0 A;  5A5N A;  4O75 A;  3S91 A;  5E7D A;  4F3I A;  5LKU A;  3LXJ A;  4LYI A;  3DAI A;  3MB4 A;  4MR3 A;  5EWW A;  4NR7 A;  2RFJ A;  5D3L A;  5DYA A;  2YEK A;  5F2P A;  2RNW A;  5EWH A;  4QB3 A;  5IGM A;  5HEN A;  4NRC A;  5E3G A;  4NR5 A;  5CRM A;  5DFD A;  4LZS A;  3IU6 A;  5ETB A;  5L98 A;  5HEM A;  5ENC A;  5CZG A;  5A5S A;  5AMF A;  4QY4 A;  3UW9 A;  5ACY A;  5E0R A;  5C89 A;  5HQ6 A;  4HXL A;  4UYG A;  5EPR A;  3Q2F A;  4WHU A;  5A81 A;  4UYF A;  5L97 A;  5DKD A;  5CP5 A;  5JI8 A;  3LQJ A;  5AD2 A;  4UYH A;  4Y03 A;  3P1F A;  5DYX A;  5FE2 A;  2YYN A;  4HXM A;  5LJ2 A;  5F36 A;  4YK0 A;  4CLB A;  4WHW A;  4YYI A;  3ERR A;  3O34 A;  5F3A A;  4TU4 A;  5DBM A;  5E73 A;  4N4I A;  5DW1 A;  3VKH A;  5ENH A;  2E7N A;  4XY9 A;  4YAT A;  5ENF A;  5LKZ A;  3G0J A;  3JVM A;  5ENI A;  4ALH A;  5A5R A;  5FE9 A;  5EVA A;  3QZV A;  5CTL A;  4A9O A;  3UVY A;  5C4Q A;  5CQ4 A;  4J1P A;  1F68 A;  2WP2 A;  3SVH A;  4AKG A;  3AQA A;  5J0D A;  5FE4 A;  4BW4 A;  5A7C A;  4RVR A;  5FE3 A;  4O76 A;  2RNX A;  5K29 A;  3O36 A;  4O72 A;  5E74 A;  4IOR A;  5I1Q A;  5FG4 A;  2WP1 A;  5IID A;  2OO1 A;  3UV2 A;  5F1L A;  4HBV A;  4A9I A;  4NR6 A;  3UV4 A;  2DVQ A;  4O74 A;  4HBX A;  3IU5 A;  4TT4 A;  3TLP A;  4CUP A;  3G0L A;  3U5J A;  4QC3 A;  2F6J A;  5F5Z A;  5KHM A;  5H1T A;  4IR4 A;  4YYH A;  4O71 A;  5CQ3 A;  4HXS A;  5FBX A;  5D3N A;  5CGP A;  2RO1 A;  4MR5 A;  5IBN A;  3U5N A;  4LC2 A;  4MEP A;  4QBM A;  5EPB A;  5CUB A;  5F62 A;  4IR3 A;  3NXB A;  5I7Y A;  5D7X A;  2G4A A;  4BW3 A;  2GRC A;  4UIV A;  3SVF A;  3O33 A;  5I88 A;  4HXK A;  4BHW A;  4C66 A;  4NR8 A;  3VKG A;  4CUU A;  5FH7 A;  4Q0N A;  5II1 A;  4CFK A;  5EIC A;  4CUT A;  4QNS A;  4NYW A;  5FE8 A;  4PS5 A;  1N72 A;  4A9F A;  3U5K A;  5CUG A;  4UYE A;  3LQH A;  5FE5 A;  5CUE A;  5FG6 A;  5D3T A;  5LKT A;  5CQT A;  4YYJ A;  2FSA A;  3O35 A;  5HJC A;  2D9E A;  2DVV A;  3U5O A;  5I80 A;  2YW5 A;  4UYD A;  5E9Y A;  5KTW A;  4N4F A;  3JVL A;  4IOQ A;  2DVR A;  4KV4 A;  3QZT A;  5CQ8 A;  4ALG A;  3UVX A;  4QUT A;  4Z93 A;  4QSU A;  5F60 A;  5G4S A;  4LYS A;  4UIZ A;  4CFL A;  5H1U A;  4NUE A;  5KU3 A;  5LKX A;  2EJN A;  5F25 A;  2L84 A;  4CL9 A;  5EGU A;  4OGI A;  4YBM A;  2DWW A;  4YBS A;  5BT3 A;  4O7C A;  5KTX A;  3MQM A;  5FG5 A;  5FE1 A;  5HQ7 A;  5A85 A;  5C87 A;  5LVQ A;  3ZYU A;  5HLS A;  3D1B A;  4LRG A;  2I7K A;  5A5O A;  4DON A;  3MXF A;  3HME A;  3UVW A;  5FB0 A;  5CRZ A;  5BT4 A;  5FFV A;  4A9E A;  3U5M A;  4HXN A;  5A83 A;  4LR6 A;  4O7E A;  4UIW A;  4MEO A;  3P5O A;  4IOO A;  3UVD A;  5DKH A;  4QR4 A;  2RI7 A;  1ZKR A;  4NQM A;  4QYL A;  5H85 A;  5D0C A;  4GPJ A;  4QR5 A;  4TQN A;  4QSW A;  4J3I A;  4Z6I A;  4KCX A;  2YEL A;  5DLX A;  2D82 A;  5ETD A;  2E3K A;  4UYF B;  2E7O A;  4QZS A;  5DKC A;  5C8G A;  4J0R A;  5EWV A;  4YYD A;  5TB6 A;  5LJ1 A;  5FE0 A;  4ZC9 A;  5KTU A;  4Z1Q A;  4YY4 A;  5F1H A;  2YEM A;  5EWD A;  4TZ8 A;  2KTB B;  3K2J A;  3LQI A;  4LZ2 A;  2H60 A;  4NYV A;  4TTE A;  5CUD A;  5ENJ A;  5TCM A;  4WIV A;  3DWY A;  2NXB A;  5CFW A;  5FE6 A;  5FH6 A;  5ENE A;  4A9L A;  4OUF A;  5EU1 A;  4QSX A;  4TU6 A;  5D3S A;  1WUG A;  5IG6 A;  3QZS A;  5CS8 A;  4YAD A;  4N3W A;  5L99 A;  5HEL A;  5EA1 A;  4HXR A;  4YYM A;  2DVS A;  5LVR A;  2I8N A;  3P1D A;  4QEV A;  5C7N A;  5L8T A;  5C85 A;  5CU8 A;  1JSP B;  3MUK A;  4QSS A;  5D3R A;  3JVJ A;  4NR9 A;  1EQF A;  4NS5 A;  5FFW A;  2MJV B;  4QEW A;  4TT2 A;  4YY6 A;  4MEN A;  4BW1 A;  5HRX A;  2R0S A;  5E3D A;  4CUS A;  5DLZ A;  5I40 A;  4NRB A;  4NXJ A;  4YH4 A;  3GG3 A;  2N9G A;  5HQ5 A;  4A9J A;  3Q2E A;  2RNY A;  5EWC A;  4A9K A;  4QYD A;  5KO4 A;  4QUU A;  3FKM X;  4PY6 A;  4HBY A;  4QR3 A;  5EP7 A;  3P1E A;  4PTB A;  5G4R A;  5A82 A;  4HBW A;  3HMH A;  4TYL A;  5JWM A;  5D3H A;  5CUC A;  5I86 A;  4MR4 A;  5F61 A;  1PUO A;  4X2I A;  5L96 A;  4QEU A;  4PCI A;  4BJX A;  4ZQL A;  4CUQ A;  2L5E A;  5DX4 A;  3JVK A;  2F6N A;  4LDF A;  3U5P A;  2R10 A;  4LZR A;  2OUO A;  5DY7 A;  4YAB A;  3AAD A;  5DYC A;  1WUM A;  4YYN A;  4AKN A;  5E9I A;  4E96 A;  5CUA A;  4OGJ A;  4NR4 A;  4A9N A;  4MEQ A;  5HRV A;  4HXO A;  3RCW A;  4QC1 A;  5AME A;  4A9H A;  5EK9 A;  4N4G A;  4UIT A;  5L8U A;  5EI4 A;  5HRW A;  4QSP A;  5E9M A;  4LYW A;  5FH8 A;  1JM4 B;  3D7C A;  5CQ6 A;  5D3J A;  5HCL A;  4TS8 A;  2RS9 B;  4O70 A;  1X0J A;  5LUU A;  5DFB A;  3SVG A;  5IGL A;  2YQD A;  3O37 A;  5HFR A;  4TZ2 A;  4UIX A;  4UIY A;  4QST A;  4QSR A;  5EPS A;  2DKW A;  4CUR A;  5CY9 A;  2DAT A;  4O78 A;  4NQN A;  4NYX A;  4O7F A;  4A9M A;  5HFQ A;  5ENG A;  4ZW1 A;  1ZS5 A;  3P1C A;  5II2 A;  5AD3 A;  4Q0O A;  4YH3 A;  2R0V A;  3S92 A;  2YDW A;  5FFY A;  4XY8 A;  5E9K A;  5CQA A;  3D1D A;  4YAX A;  4AKI A;  5FB1 A;  4C67 A;  5DFC A;  4UIU A;  4N4H A;  5FDZ A;  4BW2 A;  5CQ5 A;  5CPE A;  5DW2 A;  4YYK A;  5EQ1 A;  2R0Y A;  3LJW A;  5E9V A; 
#chains in the Genus database with same CATH homology
 3I3J A;  4J0S A;  4NRA A;  5EIS A;  3UV5 A;  4TT6 A;  4PKL A;  4MR6 A;  4IR6 A;  5ENB A;  5F63 A;  2L85 A;  3MUL A;  1E6I A;  5EV9 A;  5I29 A;  4Z1S A;  5CQ7 A;  4KV1 A;  4QSV A;  2OSS A;  3ONI A;  4YC9 A;  4XYA A;  3HMF A;  5HM0 A;  4NUD A;  5A5Q A;  4YBT A;  5FE7 A;  4IR5 A;  5I89 A;  4O7B A;  4O77 A;  4QSQ A;  5A5P A;  4Z6H A;  3MB3 A;  4YYG A;  4XUA A;  5E9L A;  5H1V A;  5DYU A;  4NUC A;  5BT5 A;  5D26 A;  2LSP B;  5D3P A;  4PCE A;  5IGN A;  4O7A A;  5D25 A;  5D24 A;  5I83 A;  4HXP A;  5COI A;  4FLP A;  5I7X A;  4XUB A;  5IGK A;  3U5L A;  5EM3 A;  5LJ0 A;  5A5N A;  4O75 A;  3S91 A;  5E7D A;  4F3I A;  5LKU A;  3LXJ A;  4LYI A;  3DAI A;  3MB4 A;  4MR3 A;  5EWW A;  4NR7 A;  2RFJ A;  5D3L A;  5DYA A;  2YEK A;  5F2P A;  2RNW A;  5EWH A;  4QB3 A;  5IGM A;  5HEN A;  4NRC A;  5E3G A;  4NR5 A;  5CRM A;  5DFD A;  4LZS A;  3IU6 A;  5ETB A;  5L98 A;  5HEM A;  5ENC A;  5CZG A;  5A5S A;  5AMF A;  4QY4 A;  3UW9 A;  5ACY A;  5E0R A;  5C89 A;  5HQ6 A;  4HXL A;  4UYG A;  5EPR A;  3Q2F A;  4WHU A;  5A81 A;  4UYF A;  5L97 A;  5DKD A;  5CP5 A;  5JI8 A;  3LQJ A;  5AD2 A;  4UYH A;  4Y03 A;  3P1F A;  5DYX A;  5FE2 A;  2YYN A;  4HXM A;  5LJ2 A;  5F36 A;  4YK0 A;  4CLB A;  4WHW A;  4YYI A;  3O34 A;  5F3A A;  4TU4 A;  5DBM A;  5E73 A;  4N4I A;  5DW1 A;  5ENH A;  2E7N A;  4XY9 A;  4YAT A;  5ENF A;  5LKZ A;  3G0J A;  3JVM A;  5ENI A;  4ALH A;  5A5R A;  5FE9 A;  5EVA A;  3QZV A;  5CTL A;  4A9O A;  3UVY A;  5C4Q A;  5CQ4 A;  4J1P A;  1F68 A;  2WP2 A;  3SVH A;  3AQA A;  5J0D A;  5FE4 A;  4BW4 A;  5A7C A;  4RVR A;  5FE3 A;  4O76 A;  2RNX A;  5K29 A;  3O36 A;  4O72 A;  5E74 A;  4IOR A;  5I1Q A;  5FG4 A;  2WP1 A;  5IID A;  2OO1 A;  3UV2 A;  5F1L A;  4HBV A;  4A9I A;  4NR6 A;  3UV4 A;  2DVQ A;  4O74 A;  4HBX A;  3IU5 A;  4TT4 A;  3TLP A;  4CUP A;  3G0L A;  3U5J A;  4QC3 A;  2F6J A;  5F5Z A;  5KHM A;  5H1T A;  4IR4 A;  4YYH A;  4O71 A;  5CQ3 A;  4HXS A;  5FBX A;  5D3N A;  5CGP A;  2RO1 A;  4MR5 A;  5IBN A;  3U5N A;  4LC2 A;  4MEP A;  4QBM A;  5EPB A;  5CUB A;  5F62 A;  4IR3 A;  3NXB A;  5I7Y A;  5D7X A;  2G4A A;  4BW3 A;  2GRC A;  4UIV A;  3SVF A;  3O33 A;  5I88 A;  4HXK A;  4BHW A;  4C66 A;  4NR8 A;  4CUU A;  5FH7 A;  4Q0N A;  5II1 A;  4CFK A;  5EIC A;  4CUT A;  4QNS A;  4NYW A;  5FE8 A;  4PS5 A;  1N72 A;  4A9F A;  3U5K A;  5CUG A;  4UYE A;  3LQH A;  5FE5 A;  5CUE A;  5FG6 A;  5D3T A;  5LKT A;  5CQT A;  4YYJ A;  2FSA A;  3O35 A;  5HJC A;  2D9E A;  2DVV A;  3U5O A;  5I80 A;  2YW5 A;  4UYD A;  5E9Y A;  5KTW A;  4N4F A;  3JVL A;  4IOQ A;  2DVR A;  4KV4 A;  3QZT A;  5CQ8 A;  4ALG A;  3UVX A;  4QUT A;  4Z93 A;  4QSU A;  5F60 A;  5G4S A;  4LYS A;  4UIZ A;  4CFL A;  5H1U A;  4NUE A;  5KU3 A;  5LKX A;  5F25 A;  2L84 A;  4CL9 A;  5EGU A;  4OGI A;  4YBM A;  2DWW A;  4YBS A;  5BT3 A;  4O7C A;  5KTX A;  3MQM A;  5FG5 A;  5FE1 A;  5HQ7 A;  5A85 A;  5C87 A;  5LVQ A;  3ZYU A;  5HLS A;  4LRG A;  2I7K A;  5A5O A;  4DON A;  3MXF A;  3HME A;  3UVW A;  5FB0 A;  5CRZ A;  5BT4 A;  5FFV A;  4A9E A;  3U5M A;  4HXN A;  5A83 A;  4LR6 A;  4O7E A;  4UIW A;  4MEO A;  3P5O A;  4IOO A;  3UVD A;  5DKH A;  4QR4 A;  2RI7 A;  4NQM A;  4QYL A;  5H85 A;  5D0C A;  4GPJ A;  4QR5 A;  4TQN A;  4QSW A;  4J3I A;  4Z6I A;  4KCX A;  2YEL A;  5DLX A;  2D82 A;  5ETD A;  2E3K A;  4UYF B;  2E7O A;  4QZS A;  5DKC A;  5C8G A;  4J0R A;  5EWV A;  4YYD A;  5TB6 A;  5LJ1 A;  5FE0 A;  4ZC9 A;  5KTU A;  4Z1Q A;  4YY4 A;  5F1H A;  2YEM A;  5EWD A;  4TZ8 A;  2KTB B;  3K2J A;  3LQI A;  4LZ2 A;  2H60 A;  4NYV A;  4TTE A;  5CUD A;  5ENJ A;  5TCM A;  4WIV A;  3DWY A;  2NXB A;  5CFW A;  5FE6 A;  5FH6 A;  5ENE A;  4A9L A;  4OUF A;  5EU1 A;  4QSX A;  4TU6 A;  5D3S A;  1WUG A;  5IG6 A;  3QZS A;  5CS8 A;  4YAD A;  4N3W A;  5L99 A;  5HEL A;  5EA1 A;  4HXR A;  4YYM A;  2DVS A;  5LVR A;  2I8N A;  3P1D A;  4QEV A;  5C7N A;  5L8T A;  5C85 A;  5CU8 A;  1JSP B;  3MUK A;  4QSS A;  5D3R A;  3JVJ A;  4NR9 A;  1EQF A;  4NS5 A;  5FFW A;  2MJV B;  4QEW A;  4TT2 A;  4YY6 A;  4MEN A;  4BW1 A;  5HRX A;  2R0S A;  5E3D A;  4CUS A;  5DLZ A;  5I40 A;  4NRB A;  4NXJ A;  4YH4 A;  3GG3 A;  2N9G A;  5HQ5 A;  4A9J A;  3Q2E A;  2RNY A;  5EWC A;  4A9K A;  4QYD A;  5KO4 A;  4QUU A;  3FKM X;  4PY6 A;  4HBY A;  4QR3 A;  5EP7 A;  3P1E A;  4PTB A;  5G4R A;  5A82 A;  4HBW A;  3HMH A;  4TYL A;  5JWM A;  5D3H A;  5CUC A;  5I86 A;  4MR4 A;  5F61 A;  4X2I A;  5L96 A;  4QEU A;  4PCI A;  4BJX A;  4ZQL A;  4CUQ A;  2L5E A;  5DX4 A;  3JVK A;  2F6N A;  4LDF A;  3U5P A;  2R10 A;  4LZR A;  2OUO A;  5DY7 A;  4YAB A;  3AAD A;  5DYC A;  1WUM A;  4YYN A;  4AKN A;  5E9I A;  4E96 A;  5CUA A;  4OGJ A;  4NR4 A;  4A9N A;  4MEQ A;  5HRV A;  4HXO A;  3RCW A;  4QC1 A;  5AME A;  4A9H A;  5EK9 A;  4N4G A;  4UIT A;  5L8U A;  5EI4 A;  5HRW A;  4QSP A;  5E9M A;  4LYW A;  5FH8 A;  1JM4 B;  3D7C A;  5CQ6 A;  5D3J A;  5HCL A;  4TS8 A;  2RS9 B;  4O70 A;  1X0J A;  5LUU A;  5DFB A;  3SVG A;  5IGL A;  2YQD A;  3O37 A;  5HFR A;  4TZ2 A;  4UIX A;  4UIY A;  4QST A;  4QSR A;  5EPS A;  2DKW A;  4CUR A;  5CY9 A;  2DAT A;  4O78 A;  4NQN A;  4NYX A;  4O7F A;  4A9M A;  5HFQ A;  5ENG A;  4ZW1 A;  1ZS5 A;  3P1C A;  5II2 A;  5AD3 A;  4Q0O A;  4YH3 A;  2R0V A;  3S92 A;  2YDW A;  5FFY A;  4XY8 A;  5E9K A;  5CQA A;  4YAX A;  5FB1 A;  4C67 A;  5DFC A;  4UIU A;  4N4H A;  5FDZ A;  4BW2 A;  5CQ5 A;  5CPE A;  5DW2 A;  4YYK A;  5EQ1 A;  2R0Y A;  3LJW A;  5E9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...