5G4RA

Bromodomain of human brpf1 with n-1,3-dimethyl-6-2r-2- methylpiperazin-1-yl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl-2- methoxybenzamide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
LTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords PEREGRIN
publication title Gsk6853, a Chemical Probe for Inhibition of the Brpf1 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5g4rA00
5FH7A 4YYNA 5HCLA 2R10A 5KTXA 4ZQLA 5C85A 5D3RA 5CUBA 5HRWA 4UIUA 5KTUA 4UYFA 5CUGA 5LJ0A 2WP1A 3P1DA 4A9OA 4QEWA 5HFRA 5EWWA 2DVQA 4O7FA 5DX4A 4A9EA 4BW4A 4A9JA 3SVGA 4YY4A 5ACYA 4QSQA 5D3NA 4N4HA 2D82A 3LQHA 4RVRA 4UIZA 5DYAA 5ENFA 4N4FA 3LXJA 4MR3A 4NRCA 5DKHA 4TQNA 5EM3A 1JSPB 4IR6A 3O34A 5LVRA 4QNSA 4TT6A 4CUPA 5IIDA 4IORA 4UYFB 4UITA 2R0SA 3MULA 4YAXA 3TLPA 1X0JA 5CQ6A 5D3HA 2F6NA 5DFCA 3P5OA 4PY6A 5I7YA 3SVHA 4LZ2A 4MEOA 4NUDA 5FFWA 4TU6A 3U5MA 5I1QA 4UYDA 5EPBA 3UW9A 4MEPA 4TZ2A 3S91A 4YYJA 2DVRA 4OGIA 5DW1A 5HFQA 4NS5A 4YADA 4PKLA 5DKCA 5ENGA 5LJ1A 5HQ6A 3MUKA 4QC3A 4UYGA 4HXNA 5DW2A 3DAIA 5CQ4A 5ENCA 4CUTA 3P1EA 5DFBA 4QYLA 2YW5A 4CUSA 3QZSA 5FE7A 4YYHA 5FE1A 4QR5A 2H60A 3MQMA 5JI8A 3AADA 5KHMA 4A9LA 5C87A 1JM4B 4C67A 3ZYUA 4UIYA 4YY6A 1N72A 4QYDA 4OUFA 5F36A 5E0RA 5A5RA 4YYDA 3UV2A 4YC9A 2RO1A 5E3DA 4MEQA 5LUUA 4Z1SA 4MENA 4TT2A 5A83A 5I29A 3U5NA 5FE8A 5TCMA 4J1PA 5CQAA 5DBMA 4NR9A 4KCXA 3RCWA 4QSXA 5I83A 2FSAA 5LJ2A 5FE3A 3QZTA 5IBNA 3JVJA 4YK0A 3O37A 5LKTA 4WHUA 5LKUA 4E96A 2R0VA 5H1UA 5LKXA 5AMEA 5CRZA 4XY8A 5TB6A 3U5KA 2L85A 4XUAA 2E7NA 5CRMA 5EPSA 4CURA 5HM0A 4O75A 5C89A 5IGMA 5DFDA 4NUEA 4LZRA 5FE9A 4AKNA 4PTBA 3DWYA 5EU1A 2YYNA 1EQFA 4QSWA 4Z93A 4CLBA 5EA1A 5FB1A 3ONIA 4KV1A 4ZC9A 4BW1A 4MR6A 5EI4A 5A5OA 4UIVA 4X2IA 4A9MA 5DYUA 2N9GA 5I86A 5II1A 3UVDA 4YATA 4O7AA 5ENJA 5FH8A 5CUCA 2RFJA 2G4AA 4Y03A 5EICA 4QY4A 5A82A 5EPRA 2RS9B 4Q0OA 4XYAA 5LVQA 4O76A 4O77A 4QR3A 4QZSA 4GPJA 2L5EA 4HXPA 4O70A 3FKMX 4LYSA 3U5OA 4BW2A 5D3PA 2WP2A 4UIXA 5ETDA 2YQDA 4HBXA 3UVXA 3MB4A 4N3WA 5C8GA 2KTBB 5BT4A 3SVFA 4QSTA 5EISA 5EQ1A 3MXFA 5FE0A 5ENBA 5CUDA 2OSSA 5CQTA 4YBSA 4A9HA 4O71A 5I7XA 4O7BA 4OGJA 4J0RA 5E9MA 5C4QA 5ENIA 5CP5A 5DYCA 2DKWA 5CZGA 4Z6HA 5L8TA 3U5PA 4TT4A 4LYIA 5D3JA 5D7XA 5A5NA 4YBMA 3U5JA 4LC2A 3K2JA 2F6JA 5F25A 5H1TA 5I80A 1WUMA 2D9EA 5CPEA 5I40A 2YEKA 3NXBA 5FE4A 5F2PA 3O33A 5F63A 5EGUA 5AD3A 4YBTA 3Q2EA 4NYWA 2GRCA 5FG6A 5DKDA 4KV4A 5IG6A 5J0DA 5FFYA 5EWVA 3QZVA 4QSRA 4C66A 2R0YA 1WUGA 3LJWA 4NYXA 4O78A 5KTWA 5DYXA 3S92A 5E7DA 2I7KA 4HBYA 4QBMA 3JVKA 5CQ3A 5HLSA 4QSPA 5D3TA 5E73A 5G4RA 5EK9A 4QSVA 5ENEA 5A85A 4TYLA 3IU6A 3U5LA 4NR7A 5DLXA 2NXBA 4IR3A 4NRAA 4UYEA 5CQ7A 4FLPA 4DONA 2I8NA 5ENHA 4YH3A 5H1VA 5F5ZA 4NQNA 4NUCA 5HQ5A 2YELA 3P1FA 4TS8A 4QR4A 5EVAA 5A5PA 5E9YA 4WHWA 2E7OA 5DY7A 4BJXA 3Q2FA 5CUAA 5E9KA 4F3IA 4A9NA 4O7CA 2RNXA 2OO1A 4J0SA 5HQ7A 5D3LA 3AQAA 4NR5A 4QB3A 3G0LA 4HXOA 5FFVA 5KU3A 4Q0NA 5FDZA 5A5QA 4Z6IA 4XUBA 5JWMA 4PCEA 4PS5A 5D3SA 5F3AA 5I89A 1ZS5A 4NR4A 5CY9A 3UV5A 2RNYA 3I3JA 4N4IA 3HMFA 1F68A 5A5SA 5L8UA 5KO4A 4TU4A 4LYWA 5CUEA 4A9KA 4J3IA 5HJCA 5I88A 3UVWA 4NR6A 4YYGA 5BT5A 4O7EA 4HXRA 5EWHA 4YYKA 5CFWA 5E9LA 4LR6A 2E3KA 4QEVA 4A9FA 4NQMA 5HELA 4ALHA 4HXKA 3G0JA 5FE2A 4QSUA 5CU8A 5HRVA 4IR5A 5EP7A 5LKZA 4YYMA 4O72A 4UYHA 4NRBA 4O74A 3JVMA 5L98A 5K29A 5E9VA 4CFLA 5H85A 5FB0A 5FH6A 5BT3A 5IGKA 2OUOA 5G4SA 4HBVA 4NXJA 5CGPA 5F1HA 5D24A 3P1CA 4CL9A 4NR8A 4CUUA 4N4GA 5EV9A 4LDFA 3LQIA 4UIWA 2DVVA 4BW3A 5EWDA 4LRGA 3O36A 5A81A 5FE5A 4YYIA 5D26A 4IOQA 4WIVA 3UV4A 4ZW1A 4QC1A 5FE6A 4BHWA 5E3GA 5E74A 5L96A 2L84A 5CS8A 4QUTA 4CUQA 5F62A 5L99A 4MR5A 5HRXA 5HENA 5FG4A 4TZ8A 5E9IA 2DVSA 5HEMA 4YH4A 5ETBA 3JVLA 5C7NA 4MR4A 4ALGA 4HBWA 4QSSA 5F60A 3UVYA 3GG3A 2YDWA 3D7CA 2RNWA 3LQJA 3HMEA 2RI7A 5II2A 3IU5A 5D0CA 2YEMA 2DATA 5AD2A 4LZSA 4HXSA 5DLZA 4TTEA 4YABA 5L97A 4Z1QA 4QEUA 4IOOA 2DWWA 4QUUA 2MJVB 5F61A 4IR4A 5CTLA 4HXMA 5CQ8A 5F1LA 5FG5A 4A9IA 2LSPB 3HMHA 5FBXA 4NYVA 5IGNA 4PCIA 5EWCA 4XY9A 4CFKA 5COIA 3MB3A 5A7CA 5AMFA 3O35A 4HXLA 5D25A 5IGLA 1E6IA 5CQ5A
chains in the Genus database with same CATH superfamily
5FH7A 4YYNA 5HCLA 2R10A 5KTXA 4ZQLA 5C85A 5D3RA 5CUBA 5HRWA 4UIUA 5KTUA 4UYFA 5CUGA 5LJ0A 2WP1A 3P1DA 4A9OA 4QEWA 5HFRA 5EWWA 2DVQA 4O7FA 5DX4A 4A9EA 4BW4A 4A9JA 3SVGA 4YY4A 5ACYA 4QSQA 5D3NA 4N4HA 2D82A 3LQHA 4RVRA 4UIZA 5DYAA 5ENFA 4N4FA 3LXJA 4MR3A 4NRCA 5DKHA 4TQNA 5EM3A 1JSPB 4IR6A 3O34A 5LVRA 4QNSA 4TT6A 4CUPA 5IIDA 4IORA 4UYFB 4UITA 2R0SA 3MULA 4YAXA 3TLPA 1X0JA 5CQ6A 5D3HA 2F6NA 5DFCA 3P5OA 4PY6A 5I7YA 3SVHA 4LZ2A 4MEOA 4NUDA 5FFWA 4TU6A 3U5MA 5I1QA 4UYDA 5EPBA 3UW9A 4MEPA 4TZ2A 3S91A 4YYJA 2DVRA 4OGIA 5DW1A 5HFQA 4NS5A 4YADA 4PKLA 5DKCA 5ENGA 5LJ1A 5HQ6A 3MUKA 4QC3A 4UYGA 4HXNA 5DW2A 3DAIA 5CQ4A 5ENCA 4CUTA 3P1EA 5DFBA 4QYLA 2YW5A 4CUSA 3QZSA 5FE7A 4YYHA 5FE1A 4QR5A 2H60A 3MQMA 5JI8A 3AADA 5KHMA 4A9LA 5C87A 1JM4B 4C67A 3ZYUA 4UIYA 4YY6A 1N72A 4QYDA 4OUFA 5F36A 5E0RA 5A5RA 4YYDA 3UV2A 4YC9A 2RO1A 5E3DA 4MEQA 5LUUA 4Z1SA 4MENA 4TT2A 5A83A 5I29A 3U5NA 5FE8A 5TCMA 4J1PA 5CQAA 5DBMA 4NR9A 4KCXA 3RCWA 4QSXA 5I83A 2FSAA 5LJ2A 5FE3A 3QZTA 5IBNA 3JVJA 4YK0A 3O37A 5LKTA 4WHUA 5LKUA 4E96A 3ERRA 4AI6A 2R0VA 5H1UA 5LKXA 5AMEA 5CRZA 4XY8A 5TB6A 3U5KA 2L85A 4XUAA 2E7NA 5CRMA 5EPSA 4CURA 5HM0A 4O75A 5C89A 5IGMA 5DFDA 4NUEA 4LZRA 4AKIA 5FE9A 4AKNA 4PTBA 3DWYA 5EU1A 2YYNA 1EQFA 4QSWA 4Z93A 4CLBA 5EA1A 5FB1A 3ONIA 4KV1A 4ZC9A 4BW1A 4MR6A 5EI4A 5A5OA 4UIVA 4X2IA 4A9MA 5DYUA 2N9GA 5I86A 5II1A 3UVDA 4YATA 4O7AA 5ENJA 5FH8A 5CUCA 2RFJA 2G4AA 4Y03A 5EICA 4QY4A 5A82A 5EPRA 2RS9B 4Q0OA 4XYAA 5LVQA 4O76A 4O77A 4QR3A 4QZSA 4GPJA 2L5EA 4HXPA 4O70A 3FKMX 4LYSA 3U5OA 4BW2A 5D3PA 2WP2A 4UIXA 5ETDA 2YQDA 3D1DA 4HBXA 3UVXA 3MB4A 4N3WA 5C8GA 2KTBB 5BT4A 3SVFA 4QSTA 5EISA 5EQ1A 3MXFA 5FE0A 5ENBA 5CUDA 2OSSA 5CQTA 4YBSA 4A9HA 3VKGA 4O71A 5I7XA 4O7BA 4OGJA 4J0RA 5E9MA 5C4QA 5ENIA 5CP5A 5DYCA 2DKWA 5CZGA 4Z6HA 5L8TA 3U5PA 4TT4A 4LYIA 5D3JA 5D7XA 5A5NA 4YBMA 3U5JA 4LC2A 3K2JA 2F6JA 5F25A 5H1TA 5I80A 1WUMA 2D9EA 5CPEA 5I40A 2YEKA 3NXBA 5FE4A 5F2PA 3O33A 1ZKRA 5EGUA 5F63A 5AD3A 4YBTA 3Q2EA 4NYWA 2GRCA 5FG6A 5DKDA 4KV4A 5IG6A 5J0DA 5FFYA 5EWVA 3QZVA 4QSRA 4C66A 2R0YA 1WUGA 3LJWA 4NYXA 4O78A 5KTWA 5DYXA 3S92A 5E7DA 2I7KA 4HBYA 4QBMA 3JVKA 5CQ3A 5HLSA 4QSPA 5D3TA 5E73A 5G4RA 5EK9A 4QSVA 5ENEA 5A85A 4TYLA 3IU6A 3U5LA 4NR7A 5DLXA 2NXBA 4IR3A 4NRAA 4UYEA 5CQ7A 4FLPA 4DONA 2I8NA 5ENHA 4YH3A 5H1VA 5F5ZA 4NQNA 4NUCA 5HQ5A 2YELA 3P1FA 4TS8A 4QR4A 5EVAA 5A5PA 5E9YA 4WHWA 2E7OA 5DY7A 4BJXA 3Q2FA 5CUAA 5E9KA 4F3IA 4A9NA 4O7CA 2RNXA 2OO1A 4J0SA 5HQ7A 5D3LA 3AQAA 4NR5A 4QB3A 3G0LA 4HXOA 5FFVA 5KU3A 4Q0NA 5FDZA 2EJNA 5A5QA 4Z6IA 4XUBA 5JWMA 4PCEA 4PS5A 5D3SA 5F3AA 5I89A 1ZS5A 4NR4A 5CY9A 3UV5A 2RNYA 3I3JA 4N4IA 3HMFA 1F68A 5A5SA 5L8UA 5KO4A 4TU4A 4LYWA 5CUEA 4A9KA 4J3IA 5HJCA 5I88A 3UVWA 4NR6A 4YYGA 5BT5A 4O7EA 4HXRA 1PUOA 5EWHA 4YYKA 5CFWA 5E9LA 4LR6A 2E3KA 4QEVA 4A9FA 4NQMA 5HELA 4ALHA 4HXKA 3G0JA 5FE2A 4QSUA 5CU8A 5HRVA 4IR5A 5EP7A 5LKZA 4YYMA 4O72A 4UYHA 4NRBA 4O74A 3JVMA 5L98A 5K29A 5E9VA 4CFLA 5H85A 5FB0A 5FH6A 5BT3A 5IGKA 2OUOA 5G4SA 4HBVA 4NXJA 3D1BA 5CGPA 5F1HA 5D24A 3P1CA 4CL9A 4NR8A 4CUUA 4N4GA 5EV9A 4LDFA 3LQIA 4UIWA 2DVVA 4BW3A 5EWDA 4LRGA 3O36A 5A81A 5FE5A 4YYIA 5D26A 4IOQA 4WIVA 4AKGA 3UV4A 4ZW1A 4QC1A 5FE6A 4BHWA 5E3GA 5E74A 5L96A 2L84A 5CS8A 4QUTA 4CUQA 5F62A 5L99A 4MR5A 5HRXA 5HENA 5FG4A 4TZ8A 5E9IA 2DVSA 5HEMA 4YH4A 5ETBA 4AKHA 3JVLA 3VKHA 5C7NA 4MR4A 4ALGA 4HBWA 4QSSA 5F60A 3UVYA 3GG3A 2YDWA 3D7CA 2RNWA 3LQJA 3HMEA 2RI7A 5II2A 3IU5A 5D0CA 2YEMA 2DATA 5AD2A 4LZSA 4HXSA 5DLZA 4TTEA 4YABA 5L97A 4Z1QA 4QEUA 4IOOA 2DWWA 4QUUA 2MJVB 5F61A 4IR4A 5CTLA 4HXMA 5CQ8A 5F1LA 5FG5A 4A9IA 2LSPB 3HMHA 5FBXA 4NYVA 5IGNA 4PCIA 5EWCA 4XY9A 4CFKA 5COIA 3MB3A 5A7CA 5AMFA 3O35A 4HXLA 5D25A 5IGLA 1E6IA 5CQ5A
chains in the Genus database with same CATH topology
5FH7A 4YYNA 5HCLA 2R10A 5KTXA 4ZQLA 5C85A 5D3RA 5CUBA 5HRWA 4UIUA 5KTUA 4UYFA 5CUGA 5LJ0A 2WP1A 3P1DA 4A9OA 4QEWA 5HFRA 5EWWA 2DVQA 4O7FA 5DX4A 4A9EA 4BW4A 4A9JA 3SVGA 4YY4A 5ACYA 4QSQA 5D3NA 4N4HA 2D82A 3LQHA 4RVRA 4UIZA 5DYAA 5ENFA 4N4FA 3LXJA 4MR3A 4NRCA 5DKHA 4TQNA 5EM3A 1JSPB 4IR6A 3O34A 5LVRA 4QNSA 4TT6A 4CUPA 5IIDA 4IORA 4UYFB 4UITA 2R0SA 3MULA 4YAXA 3TLPA 1X0JA 5CQ6A 5D3HA 2F6NA 5DFCA 3P5OA 4PY6A 5I7YA 3SVHA 4LZ2A 4MEOA 4NUDA 5FFWA 4TU6A 3U5MA 5I1QA 4UYDA 5EPBA 3UW9A 4MEPA 4TZ2A 3S91A 4YYJA 2DVRA 4OGIA 5DW1A 5HFQA 4NS5A 4YADA 4PKLA 5DKCA 5ENGA 5LJ1A 5HQ6A 3MUKA 4QC3A 4UYGA 4HXNA 5DW2A 3DAIA 5CQ4A 5ENCA 4CUTA 3P1EA 5DFBA 4QYLA 2YW5A 4CUSA 3QZSA 5FE7A 4YYHA 5FE1A 4QR5A 2H60A 3MQMA 5JI8A 3AADA 5KHMA 4A9LA 5C87A 1JM4B 4C67A 3ZYUA 4UIYA 4YY6A 1N72A 4QYDA 4OUFA 5F36A 5E0RA 5A5RA 4YYDA 3UV2A 4YC9A 2RO1A 5E3DA 4MEQA 5LUUA 4Z1SA 4MENA 4TT2A 5A83A 5I29A 3U5NA 5FE8A 5TCMA 4J1PA 5CQAA 5DBMA 4NR9A 4KCXA 3RCWA 4QSXA 5I83A 2FSAA 5LJ2A 5FE3A 3QZTA 5IBNA 3JVJA 4YK0A 3O37A 5LKTA 4WHUA 5LKUA 4E96A 2R0VA 5H1UA 5LKXA 5AMEA 5CRZA 4XY8A 5TB6A 3U5KA 2L85A 4XUAA 2E7NA 5CRMA 5EPSA 4CURA 5HM0A 4O75A 5C89A 5IGMA 5DFDA 4NUEA 4LZRA 5FE9A 4AKNA 4PTBA 3DWYA 5EU1A 2YYNA 1EQFA 4QSWA 4Z93A 4CLBA 5EA1A 5FB1A 3ONIA 4KV1A 4ZC9A 4BW1A 4MR6A 5EI4A 5A5OA 4UIVA 4X2IA 4A9MA 5DYUA 2N9GA 5I86A 5II1A 3UVDA 4YATA 4O7AA 5ENJA 5FH8A 5CUCA 2RFJA 2G4AA 4Y03A 5EICA 4QY4A 5A82A 5EPRA 2RS9B 4Q0OA 4XYAA 5LVQA 4O76A 4O77A 4QR3A 4QZSA 4GPJA 2L5EA 4HXPA 4O70A 3FKMX 4LYSA 3U5OA 4BW2A 5D3PA 2WP2A 4UIXA 5ETDA 2YQDA 4HBXA 3UVXA 3MB4A 4N3WA 5C8GA 2KTBB 5BT4A 3SVFA 4QSTA 5EISA 5EQ1A 3MXFA 5FE0A 5ENBA 5CUDA 2OSSA 5CQTA 4YBSA 4A9HA 4O71A 5I7XA 4O7BA 4OGJA 4J0RA 5E9MA 5C4QA 5ENIA 5CP5A 5DYCA 2DKWA 5CZGA 4Z6HA 5L8TA 3U5PA 4TT4A 4LYIA 5D3JA 5D7XA 5A5NA 4YBMA 3U5JA 4LC2A 3K2JA 2F6JA 5F25A 5H1TA 5I80A 1WUMA 2D9EA 5CPEA 5I40A 2YEKA 3NXBA 5FE4A 5F2PA 3O33A 5F63A 5EGUA 5AD3A 4YBTA 3Q2EA 4NYWA 2GRCA 5FG6A 5DKDA 4KV4A 5IG6A 5J0DA 5FFYA 5EWVA 3QZVA 4QSRA 4C66A 2R0YA 1WUGA 3LJWA 4NYXA 4O78A 5KTWA 5DYXA 3S92A 5E7DA 2I7KA 4HBYA 4QBMA 3JVKA 5CQ3A 5HLSA 4QSPA 5D3TA 5E73A 5G4RA 5EK9A 4QSVA 5ENEA 5A85A 4TYLA 3IU6A 3U5LA 4NR7A 5DLXA 2NXBA 4IR3A 4NRAA 4UYEA 5CQ7A 4FLPA 4DONA 2I8NA 5ENHA 4YH3A 5H1VA 5F5ZA 4NQNA 4NUCA 5HQ5A 2YELA 3P1FA 4TS8A 4QR4A 5EVAA 5A5PA 5E9YA 4WHWA 2E7OA 5DY7A 4BJXA 3Q2FA 5CUAA 5E9KA 4F3IA 4A9NA 4O7CA 2RNXA 2OO1A 4J0SA 5HQ7A 5D3LA 3AQAA 4NR5A 4QB3A 3G0LA 4HXOA 5FFVA 5KU3A 4Q0NA 5FDZA 5A5QA 4Z6IA 4XUBA 5JWMA 4PCEA 4PS5A 5D3SA 5F3AA 5I89A 1ZS5A 4NR4A 5CY9A 3UV5A 2RNYA 3I3JA 4N4IA 3HMFA 1F68A 5A5SA 5L8UA 5KO4A 4TU4A 4LYWA 5CUEA 4A9KA 4J3IA 5HJCA 5I88A 3UVWA 4NR6A 4YYGA 5BT5A 4O7EA 4HXRA 5EWHA 4YYKA 5CFWA 5E9LA 4LR6A 2E3KA 4QEVA 4A9FA 4NQMA 5HELA 4ALHA 4HXKA 3G0JA 5FE2A 4QSUA 5CU8A 5HRVA 4IR5A 5EP7A 5LKZA 4YYMA 4O72A 4UYHA 4NRBA 4O74A 3JVMA 5L98A 5K29A 5E9VA 4CFLA 5H85A 5FB0A 5FH6A 5BT3A 5IGKA 2OUOA 5G4SA 4HBVA 4NXJA 5CGPA 5F1HA 5D24A 3P1CA 4CL9A 4NR8A 4CUUA 4N4GA 5EV9A 4LDFA 3LQIA 4UIWA 2DVVA 4BW3A 5EWDA 4LRGA 3O36A 5A81A 5FE5A 4YYIA 5D26A 4IOQA 4WIVA 3UV4A 4ZW1A 4QC1A 5FE6A 4BHWA 5E3GA 5E74A 5L96A 2L84A 5CS8A 4QUTA 4CUQA 5F62A 5L99A 4MR5A 5HRXA 5HENA 5FG4A 4TZ8A 5E9IA 2DVSA 5HEMA 4YH4A 5ETBA 3JVLA 5C7NA 4MR4A 4ALGA 4HBWA 4QSSA 5F60A 3UVYA 3GG3A 2YDWA 3D7CA 2RNWA 3LQJA 3HMEA 2RI7A 5II2A 3IU5A 5D0CA 2YEMA 2DATA 5AD2A 4LZSA 4HXSA 5DLZA 4TTEA 4YABA 5L97A 4Z1QA 4QEUA 4IOOA 2DWWA 4QUUA 2MJVB 5F61A 4IR4A 5CTLA 4HXMA 5CQ8A 5F1LA 5FG5A 4A9IA 2LSPB 3HMHA 5FBXA 4NYVA 5IGNA 4PCIA 5EWCA 4XY9A 4CFKA 5COIA 3MB3A 5A7CA 5AMFA 3O35A 4HXLA 5D25A 5IGLA 1E6IA 5CQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FH7 A;  4YYN A;  5HCL A;  2R10 A;  5KTX A;  4ZQL A;  5C85 A;  5D3R A;  5CUB A;  5HRW A;  4UIU A;  5KTU A;  4UYF A;  5CUG A;  5LJ0 A;  2WP1 A;  3P1D A;  4A9O A;  4QEW A;  5HFR A;  5EWW A;  2DVQ A;  4O7F A;  5DX4 A;  4A9E A;  4BW4 A;  4A9J A;  3SVG A;  4YY4 A;  5ACY A;  4QSQ A;  5D3N A;  4N4H A;  2D82 A;  3LQH A;  4RVR A;  4UIZ A;  5DYA A;  5ENF A;  4N4F A;  3LXJ A;  4MR3 A;  4NRC A;  5DKH A;  4TQN A;  5EM3 A;  1JSP B;  4IR6 A;  3O34 A;  5LVR A;  4QNS A;  4TT6 A;  4CUP A;  5IID A;  4IOR A;  4UYF B;  4UIT A;  2R0S A;  3MUL A;  4YAX A;  3TLP A;  1X0J A;  5CQ6 A;  5D3H A;  2F6N A;  5DFC A;  3P5O A;  4PY6 A;  5I7Y A;  3SVH A;  4LZ2 A;  4MEO A;  4NUD A;  5FFW A;  4TU6 A;  3U5M A;  5I1Q A;  4UYD A;  5EPB A;  3UW9 A;  4MEP A;  4TZ2 A;  3S91 A;  4YYJ A;  2DVR A;  4OGI A;  5DW1 A;  5HFQ A;  4NS5 A;  4YAD A;  4PKL A;  5DKC A;  5ENG A;  5LJ1 A;  5HQ6 A;  3MUK A;  4QC3 A;  4UYG A;  4HXN A;  5DW2 A;  3DAI A;  5CQ4 A;  5ENC A;  4CUT A;  3P1E A;  5DFB A;  4QYL A;  2YW5 A;  4CUS A;  3QZS A;  5FE7 A;  4YYH A;  5FE1 A;  4QR5 A;  2H60 A;  3MQM A;  5JI8 A;  3AAD A;  5KHM A;  4A9L A;  5C87 A;  1JM4 B;  4C67 A;  3ZYU A;  4UIY A;  4YY6 A;  1N72 A;  4QYD A;  4OUF A;  5F36 A;  5E0R A;  5A5R A;  4YYD A;  3UV2 A;  4YC9 A;  2RO1 A;  5E3D A;  4MEQ A;  5LUU A;  4Z1S A;  4MEN A;  4TT2 A;  5A83 A;  5I29 A;  3U5N A;  5FE8 A;  5TCM A;  4J1P A;  5CQA A;  5DBM A;  4NR9 A;  4KCX A;  3RCW A;  4QSX A;  5I83 A;  2FSA A;  5LJ2 A;  5FE3 A;  3QZT A;  5IBN A;  3JVJ A;  4YK0 A;  3O37 A;  5LKT A;  4WHU A;  5LKU A;  4E96 A;  2R0V A;  5H1U A;  5LKX A;  5AME A;  5CRZ A;  4XY8 A;  5TB6 A;  3U5K A;  2L85 A;  4XUA A;  2E7N A;  5CRM A;  5EPS A;  4CUR A;  5HM0 A;  4O75 A;  5C89 A;  5IGM A;  5DFD A;  4NUE A;  4LZR A;  5FE9 A;  4AKN A;  4PTB A;  3DWY A;  5EU1 A;  2YYN A;  1EQF A;  4QSW A;  4Z93 A;  4CLB A;  5EA1 A;  5FB1 A;  3ONI A;  4KV1 A;  4ZC9 A;  4BW1 A;  4MR6 A;  5EI4 A;  5A5O A;  4UIV A;  4X2I A;  4A9M A;  5DYU A;  2N9G A;  5I86 A;  5II1 A;  3UVD A;  4YAT A;  4O7A A;  5ENJ A;  5FH8 A;  5CUC A;  2RFJ A;  2G4A A;  4Y03 A;  5EIC A;  4QY4 A;  5A82 A;  5EPR A;  2RS9 B;  4Q0O A;  4XYA A;  5LVQ A;  4O76 A;  4O77 A;  4QR3 A;  4QZS A;  4GPJ A;  2L5E A;  4HXP A;  4O70 A;  3FKM X;  4LYS A;  3U5O A;  4BW2 A;  5D3P A;  2WP2 A;  4UIX A;  5ETD A;  2YQD A;  4HBX A;  3UVX A;  3MB4 A;  4N3W A;  5C8G A;  2KTB B;  5BT4 A;  3SVF A;  4QST A;  5EIS A;  5EQ1 A;  3MXF A;  5FE0 A;  5ENB A;  5CUD A;  2OSS A;  5CQT A;  4YBS A;  4A9H A;  4O71 A;  5I7X A;  4O7B A;  4OGJ A;  4J0R A;  5E9M A;  5C4Q A;  5ENI A;  5CP5 A;  5DYC A;  2DKW A;  5CZG A;  4Z6H A;  5L8T A;  3U5P A;  4TT4 A;  4LYI A;  5D3J A;  5D7X A;  5A5N A;  4YBM A;  3U5J A;  4LC2 A;  3K2J A;  2F6J A;  5F25 A;  5H1T A;  5I80 A;  1WUM A;  2D9E A;  5CPE A;  5I40 A;  2YEK A;  3NXB A;  5FE4 A;  5F2P A;  3O33 A;  5F63 A;  5EGU A;  5AD3 A;  4YBT A;  3Q2E A;  4NYW A;  2GRC A;  5FG6 A;  5DKD A;  4KV4 A;  5IG6 A;  5J0D A;  5FFY A;  5EWV A;  3QZV A;  4QSR A;  4C66 A;  2R0Y A;  1WUG A;  3LJW A;  4NYX A;  4O78 A;  5KTW A;  5DYX A;  3S92 A;  5E7D A;  2I7K A;  4HBY A;  4QBM A;  3JVK A;  5CQ3 A;  5HLS A;  4QSP A;  5D3T A;  5E73 A;  5G4R A;  5EK9 A;  4QSV A;  5ENE A;  5A85 A;  4TYL A;  3IU6 A;  3U5L A;  4NR7 A;  5DLX A;  2NXB A;  4IR3 A;  4NRA A;  4UYE A;  5CQ7 A;  4FLP A;  4DON A;  2I8N A;  5ENH A;  4YH3 A;  5H1V A;  5F5Z A;  4NQN A;  4NUC A;  5HQ5 A;  2YEL A;  3P1F A;  4TS8 A;  4QR4 A;  5EVA A;  5A5P A;  5E9Y A;  4WHW A;  2E7O A;  5DY7 A;  4BJX A;  3Q2F A;  5CUA A;  5E9K A;  4F3I A;  4A9N A;  4O7C A;  2RNX A;  2OO1 A;  4J0S A;  5HQ7 A;  5D3L A;  3AQA A;  4NR5 A;  4QB3 A;  3G0L A;  4HXO A;  5FFV A;  5KU3 A;  4Q0N A;  5FDZ A;  5A5Q A;  4Z6I A;  4XUB A;  5JWM A;  4PCE A;  4PS5 A;  5D3S A;  5F3A A;  5I89 A;  1ZS5 A;  4NR4 A;  5CY9 A;  3UV5 A;  2RNY A;  3I3J A;  4N4I A;  3HMF A;  1F68 A;  5A5S A;  5L8U A;  5KO4 A;  4TU4 A;  4LYW A;  5CUE A;  4A9K A;  4J3I A;  5HJC A;  5I88 A;  3UVW A;  4NR6 A;  4YYG A;  5BT5 A;  4O7E A;  4HXR A;  5EWH A;  4YYK A;  5CFW A;  5E9L A;  4LR6 A;  2E3K A;  4QEV A;  4A9F A;  4NQM A;  5HEL A;  4ALH A;  4HXK A;  3G0J A;  5FE2 A;  4QSU A;  5CU8 A;  5HRV A;  4IR5 A;  5EP7 A;  5LKZ A;  4YYM A;  4O72 A;  4UYH A;  4NRB A;  4O74 A;  3JVM A;  5L98 A;  5K29 A;  5E9V A;  4CFL A;  5H85 A;  5FB0 A;  5FH6 A;  5BT3 A;  5IGK A;  2OUO A;  5G4S A;  4HBV A;  4NXJ A;  5CGP A;  5F1H A;  5D24 A;  3P1C A;  4CL9 A;  4NR8 A;  4CUU A;  4N4G A;  5EV9 A;  4LDF A;  3LQI A;  4UIW A;  2DVV A;  4BW3 A;  5EWD A;  4LRG A;  3O36 A;  5A81 A;  5FE5 A;  4YYI A;  5D26 A;  4IOQ A;  4WIV A;  3UV4 A;  4ZW1 A;  4QC1 A;  5FE6 A;  4BHW A;  5E3G A;  5E74 A;  5L96 A;  2L84 A;  5CS8 A;  4QUT A;  4CUQ A;  5F62 A;  5L99 A;  4MR5 A;  5HRX A;  5HEN A;  5FG4 A;  4TZ8 A;  5E9I A;  2DVS A;  5HEM A;  4YH4 A;  5ETB A;  3JVL A;  5C7N A;  4MR4 A;  4ALG A;  4HBW A;  4QSS A;  5F60 A;  3UVY A;  3GG3 A;  2YDW A;  3D7C A;  2RNW A;  3LQJ A;  3HME A;  2RI7 A;  5II2 A;  3IU5 A;  5D0C A;  2YEM A;  2DAT A;  5AD2 A;  4LZS A;  4HXS A;  5DLZ A;  4TTE A;  4YAB A;  5L97 A;  4Z1Q A;  4QEU A;  4IOO A;  2DWW A;  4QUU A;  2MJV B;  5F61 A;  4IR4 A;  5CTL A;  4HXM A;  5CQ8 A;  5F1L A;  5FG5 A;  4A9I A;  2LSP B;  3HMH A;  5FBX A;  4NYV A;  5IGN A;  4PCI A;  5EWC A;  4XY9 A;  4CFK A;  5COI A;  3MB3 A;  5A7C A;  5AMF A;  3O35 A;  4HXL A;  5D25 A;  5IGL A;  1E6I A;  5CQ5 A; 
#chains in the Genus database with same CATH topology
 5FH7 A;  4YYN A;  5HCL A;  2R10 A;  5KTX A;  4ZQL A;  5C85 A;  5D3R A;  5CUB A;  5HRW A;  4UIU A;  5KTU A;  4UYF A;  5CUG A;  5LJ0 A;  2WP1 A;  3P1D A;  4A9O A;  4QEW A;  5HFR A;  5EWW A;  2DVQ A;  4O7F A;  5DX4 A;  4A9E A;  4BW4 A;  4A9J A;  3SVG A;  4YY4 A;  5ACY A;  4QSQ A;  5D3N A;  4N4H A;  2D82 A;  3LQH A;  4RVR A;  4UIZ A;  5DYA A;  5ENF A;  4N4F A;  3LXJ A;  4MR3 A;  4NRC A;  5DKH A;  4TQN A;  5EM3 A;  1JSP B;  4IR6 A;  3O34 A;  5LVR A;  4QNS A;  4TT6 A;  4CUP A;  5IID A;  4IOR A;  4UYF B;  4UIT A;  2R0S A;  3MUL A;  4YAX A;  3TLP A;  1X0J A;  5CQ6 A;  5D3H A;  2F6N A;  5DFC A;  3P5O A;  4PY6 A;  5I7Y A;  3SVH A;  4LZ2 A;  4MEO A;  4NUD A;  5FFW A;  4TU6 A;  3U5M A;  5I1Q A;  4UYD A;  5EPB A;  3UW9 A;  4MEP A;  4TZ2 A;  3S91 A;  4YYJ A;  2DVR A;  4OGI A;  5DW1 A;  5HFQ A;  4NS5 A;  4YAD A;  4PKL A;  5DKC A;  5ENG A;  5LJ1 A;  5HQ6 A;  3MUK A;  4QC3 A;  4UYG A;  4HXN A;  5DW2 A;  3DAI A;  5CQ4 A;  5ENC A;  4CUT A;  3P1E A;  5DFB A;  4QYL A;  2YW5 A;  4CUS A;  3QZS A;  5FE7 A;  4YYH A;  5FE1 A;  4QR5 A;  2H60 A;  3MQM A;  5JI8 A;  3AAD A;  5KHM A;  4A9L A;  5C87 A;  1JM4 B;  4C67 A;  3ZYU A;  4UIY A;  4YY6 A;  1N72 A;  4QYD A;  4OUF A;  5F36 A;  5E0R A;  5A5R A;  4YYD A;  3UV2 A;  4YC9 A;  2RO1 A;  5E3D A;  4MEQ A;  5LUU A;  4Z1S A;  4MEN A;  4TT2 A;  5A83 A;  5I29 A;  3U5N A;  5FE8 A;  5TCM A;  4J1P A;  5CQA A;  5DBM A;  4NR9 A;  4KCX A;  3RCW A;  4QSX A;  5I83 A;  2FSA A;  5LJ2 A;  5FE3 A;  3QZT A;  5IBN A;  3JVJ A;  4YK0 A;  3O37 A;  5LKT A;  4WHU A;  5LKU A;  4E96 A;  3ERR A;  4AI6 A;  2R0V A;  5H1U A;  5LKX A;  5AME A;  5CRZ A;  4XY8 A;  5TB6 A;  3U5K A;  2L85 A;  4XUA A;  2E7N A;  5CRM A;  5EPS A;  4CUR A;  5HM0 A;  4O75 A;  5C89 A;  5IGM A;  5DFD A;  4NUE A;  4LZR A;  4AKI A;  5FE9 A;  4AKN A;  4PTB A;  3DWY A;  5EU1 A;  2YYN A;  1EQF A;  4QSW A;  4Z93 A;  4CLB A;  5EA1 A;  5FB1 A;  3ONI A;  4KV1 A;  4ZC9 A;  4BW1 A;  4MR6 A;  5EI4 A;  5A5O A;  4UIV A;  4X2I A;  4A9M A;  5DYU A;  2N9G A;  5I86 A;  5II1 A;  3UVD A;  4YAT A;  4O7A A;  5ENJ A;  5FH8 A;  5CUC A;  2RFJ A;  2G4A A;  4Y03 A;  5EIC A;  4QY4 A;  5A82 A;  5EPR A;  2RS9 B;  4Q0O A;  4XYA A;  5LVQ A;  4O76 A;  4O77 A;  4QR3 A;  4QZS A;  4GPJ A;  2L5E A;  4HXP A;  4O70 A;  3FKM X;  4LYS A;  3U5O A;  4BW2 A;  5D3P A;  2WP2 A;  4UIX A;  5ETD A;  2YQD A;  3D1D A;  4HBX A;  3UVX A;  3MB4 A;  4N3W A;  5C8G A;  2KTB B;  5BT4 A;  3SVF A;  4QST A;  5EIS A;  5EQ1 A;  3MXF A;  5FE0 A;  5ENB A;  5CUD A;  2OSS A;  5CQT A;  4YBS A;  4A9H A;  3VKG A;  4O71 A;  5I7X A;  4O7B A;  4OGJ A;  4J0R A;  5E9M A;  5C4Q A;  5ENI A;  5CP5 A;  5DYC A;  2DKW A;  5CZG A;  4Z6H A;  5L8T A;  3U5P A;  4TT4 A;  4LYI A;  5D3J A;  5D7X A;  5A5N A;  4YBM A;  3U5J A;  4LC2 A;  3K2J A;  2F6J A;  5F25 A;  5H1T A;  5I80 A;  1WUM A;  2D9E A;  5CPE A;  5I40 A;  2YEK A;  3NXB A;  5FE4 A;  5F2P A;  3O33 A;  1ZKR A;  5EGU A;  5F63 A;  5AD3 A;  4YBT A;  3Q2E A;  4NYW A;  2GRC A;  5FG6 A;  5DKD A;  4KV4 A;  5IG6 A;  5J0D A;  5FFY A;  5EWV A;  3QZV A;  4QSR A;  4C66 A;  2R0Y A;  1WUG A;  3LJW A;  4NYX A;  4O78 A;  5KTW A;  5DYX A;  3S92 A;  5E7D A;  2I7K A;  4HBY A;  4QBM A;  3JVK A;  5CQ3 A;  5HLS A;  4QSP A;  5D3T A;  5E73 A;  5G4R A;  5EK9 A;  4QSV A;  5ENE A;  5A85 A;  4TYL A;  3IU6 A;  3U5L A;  4NR7 A;  5DLX A;  2NXB A;  4IR3 A;  4NRA A;  4UYE A;  5CQ7 A;  4FLP A;  4DON A;  2I8N A;  5ENH A;  4YH3 A;  5H1V A;  5F5Z A;  4NQN A;  4NUC A;  5HQ5 A;  2YEL A;  3P1F A;  4TS8 A;  4QR4 A;  5EVA A;  5A5P A;  5E9Y A;  4WHW A;  2E7O A;  5DY7 A;  4BJX A;  3Q2F A;  5CUA A;  5E9K A;  4F3I A;  4A9N A;  4O7C A;  2RNX A;  2OO1 A;  4J0S A;  5HQ7 A;  5D3L A;  3AQA A;  4NR5 A;  4QB3 A;  3G0L A;  4HXO A;  5FFV A;  5KU3 A;  4Q0N A;  5FDZ A;  2EJN A;  5A5Q A;  4Z6I A;  4XUB A;  5JWM A;  4PCE A;  4PS5 A;  5D3S A;  5F3A A;  5I89 A;  1ZS5 A;  4NR4 A;  5CY9 A;  3UV5 A;  2RNY A;  3I3J A;  4N4I A;  3HMF A;  1F68 A;  5A5S A;  5L8U A;  5KO4 A;  4TU4 A;  4LYW A;  5CUE A;  4A9K A;  4J3I A;  5HJC A;  5I88 A;  3UVW A;  4NR6 A;  4YYG A;  5BT5 A;  4O7E A;  4HXR A;  1PUO A;  5EWH A;  4YYK A;  5CFW A;  5E9L A;  4LR6 A;  2E3K A;  4QEV A;  4A9F A;  4NQM A;  5HEL A;  4ALH A;  4HXK A;  3G0J A;  5FE2 A;  4QSU A;  5CU8 A;  5HRV A;  4IR5 A;  5EP7 A;  5LKZ A;  4YYM A;  4O72 A;  4UYH A;  4NRB A;  4O74 A;  3JVM A;  5L98 A;  5K29 A;  5E9V A;  4CFL A;  5H85 A;  5FB0 A;  5FH6 A;  5BT3 A;  5IGK A;  2OUO A;  5G4S A;  4HBV A;  4NXJ A;  3D1B A;  5CGP A;  5F1H A;  5D24 A;  3P1C A;  4CL9 A;  4NR8 A;  4CUU A;  4N4G A;  5EV9 A;  4LDF A;  3LQI A;  4UIW A;  2DVV A;  4BW3 A;  5EWD A;  4LRG A;  3O36 A;  5A81 A;  5FE5 A;  4YYI A;  5D26 A;  4IOQ A;  4WIV A;  4AKG A;  3UV4 A;  4ZW1 A;  4QC1 A;  5FE6 A;  4BHW A;  5E3G A;  5E74 A;  5L96 A;  2L84 A;  5CS8 A;  4QUT A;  4CUQ A;  5F62 A;  5L99 A;  4MR5 A;  5HRX A;  5HEN A;  5FG4 A;  4TZ8 A;  5E9I A;  2DVS A;  5HEM A;  4YH4 A;  5ETB A;  4AKH A;  3JVL A;  3VKH A;  5C7N A;  4MR4 A;  4ALG A;  4HBW A;  4QSS A;  5F60 A;  3UVY A;  3GG3 A;  2YDW A;  3D7C A;  2RNW A;  3LQJ A;  3HME A;  2RI7 A;  5II2 A;  3IU5 A;  5D0C A;  2YEM A;  2DAT A;  5AD2 A;  4LZS A;  4HXS A;  5DLZ A;  4TTE A;  4YAB A;  5L97 A;  4Z1Q A;  4QEU A;  4IOO A;  2DWW A;  4QUU A;  2MJV B;  5F61 A;  4IR4 A;  5CTL A;  4HXM A;  5CQ8 A;  5F1L A;  5FG5 A;  4A9I A;  2LSP B;  3HMH A;  5FBX A;  4NYV A;  5IGN A;  4PCI A;  5EWC A;  4XY9 A;  4CFK A;  5COI A;  3MB3 A;  5A7C A;  5AMF A;  3O35 A;  4HXL A;  5D25 A;  5IGL A;  1E6I A;  5CQ5 A; 
#chains in the Genus database with same CATH homology
 5FH7 A;  4YYN A;  5HCL A;  2R10 A;  5KTX A;  4ZQL A;  5C85 A;  5D3R A;  5CUB A;  5HRW A;  4UIU A;  5KTU A;  4UYF A;  5CUG A;  5LJ0 A;  2WP1 A;  3P1D A;  4A9O A;  4QEW A;  5HFR A;  5EWW A;  2DVQ A;  4O7F A;  5DX4 A;  4A9E A;  4BW4 A;  4A9J A;  3SVG A;  4YY4 A;  5ACY A;  4QSQ A;  5D3N A;  4N4H A;  2D82 A;  3LQH A;  4RVR A;  4UIZ A;  5DYA A;  5ENF A;  4N4F A;  3LXJ A;  4MR3 A;  4NRC A;  5DKH A;  4TQN A;  5EM3 A;  1JSP B;  4IR6 A;  3O34 A;  5LVR A;  4QNS A;  4TT6 A;  4CUP A;  5IID A;  4IOR A;  4UYF B;  4UIT A;  2R0S A;  3MUL A;  4YAX A;  3TLP A;  1X0J A;  5CQ6 A;  5D3H A;  2F6N A;  5DFC A;  3P5O A;  4PY6 A;  5I7Y A;  3SVH A;  4LZ2 A;  4MEO A;  4NUD A;  5FFW A;  4TU6 A;  3U5M A;  5I1Q A;  4UYD A;  5EPB A;  3UW9 A;  4MEP A;  4TZ2 A;  3S91 A;  4YYJ A;  2DVR A;  4OGI A;  5DW1 A;  5HFQ A;  4NS5 A;  4YAD A;  4PKL A;  5DKC A;  5ENG A;  5LJ1 A;  5HQ6 A;  3MUK A;  4QC3 A;  4UYG A;  4HXN A;  5DW2 A;  3DAI A;  5CQ4 A;  5ENC A;  4CUT A;  3P1E A;  5DFB A;  4QYL A;  2YW5 A;  4CUS A;  3QZS A;  5FE7 A;  4YYH A;  5FE1 A;  4QR5 A;  2H60 A;  3MQM A;  5JI8 A;  3AAD A;  5KHM A;  4A9L A;  5C87 A;  1JM4 B;  4C67 A;  3ZYU A;  4UIY A;  4YY6 A;  1N72 A;  4QYD A;  4OUF A;  5F36 A;  5E0R A;  5A5R A;  4YYD A;  3UV2 A;  4YC9 A;  2RO1 A;  5E3D A;  4MEQ A;  5LUU A;  4Z1S A;  4MEN A;  4TT2 A;  5A83 A;  5I29 A;  3U5N A;  5FE8 A;  5TCM A;  4J1P A;  5CQA A;  5DBM A;  4NR9 A;  4KCX A;  3RCW A;  4QSX A;  5I83 A;  2FSA A;  5LJ2 A;  5FE3 A;  3QZT A;  5IBN A;  3JVJ A;  4YK0 A;  3O37 A;  5LKT A;  4WHU A;  5LKU A;  4E96 A;  2R0V A;  5H1U A;  5LKX A;  5AME A;  5CRZ A;  4XY8 A;  5TB6 A;  3U5K A;  2L85 A;  4XUA A;  2E7N A;  5CRM A;  5EPS A;  4CUR A;  5HM0 A;  4O75 A;  5C89 A;  5IGM A;  5DFD A;  4NUE A;  4LZR A;  5FE9 A;  4AKN A;  4PTB A;  3DWY A;  5EU1 A;  2YYN A;  1EQF A;  4QSW A;  4Z93 A;  4CLB A;  5EA1 A;  5FB1 A;  3ONI A;  4KV1 A;  4ZC9 A;  4BW1 A;  4MR6 A;  5EI4 A;  5A5O A;  4UIV A;  4X2I A;  4A9M A;  5DYU A;  2N9G A;  5I86 A;  5II1 A;  3UVD A;  4YAT A;  4O7A A;  5ENJ A;  5FH8 A;  5CUC A;  2RFJ A;  2G4A A;  4Y03 A;  5EIC A;  4QY4 A;  5A82 A;  5EPR A;  2RS9 B;  4Q0O A;  4XYA A;  5LVQ A;  4O76 A;  4O77 A;  4QR3 A;  4QZS A;  4GPJ A;  2L5E A;  4HXP A;  4O70 A;  3FKM X;  4LYS A;  3U5O A;  4BW2 A;  5D3P A;  2WP2 A;  4UIX A;  5ETD A;  2YQD A;  4HBX A;  3UVX A;  3MB4 A;  4N3W A;  5C8G A;  2KTB B;  5BT4 A;  3SVF A;  4QST A;  5EIS A;  5EQ1 A;  3MXF A;  5FE0 A;  5ENB A;  5CUD A;  2OSS A;  5CQT A;  4YBS A;  4A9H A;  4O71 A;  5I7X A;  4O7B A;  4OGJ A;  4J0R A;  5E9M A;  5C4Q A;  5ENI A;  5CP5 A;  5DYC A;  2DKW A;  5CZG A;  4Z6H A;  5L8T A;  3U5P A;  4TT4 A;  4LYI A;  5D3J A;  5D7X A;  5A5N A;  4YBM A;  3U5J A;  4LC2 A;  3K2J A;  2F6J A;  5F25 A;  5H1T A;  5I80 A;  1WUM A;  2D9E A;  5CPE A;  5I40 A;  2YEK A;  3NXB A;  5FE4 A;  5F2P A;  3O33 A;  5F63 A;  5EGU A;  5AD3 A;  4YBT A;  3Q2E A;  4NYW A;  2GRC A;  5FG6 A;  5DKD A;  4KV4 A;  5IG6 A;  5J0D A;  5FFY A;  5EWV A;  3QZV A;  4QSR A;  4C66 A;  2R0Y A;  1WUG A;  3LJW A;  4NYX A;  4O78 A;  5KTW A;  5DYX A;  3S92 A;  5E7D A;  2I7K A;  4HBY A;  4QBM A;  3JVK A;  5CQ3 A;  5HLS A;  4QSP A;  5D3T A;  5E73 A;  5G4R A;  5EK9 A;  4QSV A;  5ENE A;  5A85 A;  4TYL A;  3IU6 A;  3U5L A;  4NR7 A;  5DLX A;  2NXB A;  4IR3 A;  4NRA A;  4UYE A;  5CQ7 A;  4FLP A;  4DON A;  2I8N A;  5ENH A;  4YH3 A;  5H1V A;  5F5Z A;  4NQN A;  4NUC A;  5HQ5 A;  2YEL A;  3P1F A;  4TS8 A;  4QR4 A;  5EVA A;  5A5P A;  5E9Y A;  4WHW A;  2E7O A;  5DY7 A;  4BJX A;  3Q2F A;  5CUA A;  5E9K A;  4F3I A;  4A9N A;  4O7C A;  2RNX A;  2OO1 A;  4J0S A;  5HQ7 A;  5D3L A;  3AQA A;  4NR5 A;  4QB3 A;  3G0L A;  4HXO A;  5FFV A;  5KU3 A;  4Q0N A;  5FDZ A;  5A5Q A;  4Z6I A;  4XUB A;  5JWM A;  4PCE A;  4PS5 A;  5D3S A;  5F3A A;  5I89 A;  1ZS5 A;  4NR4 A;  5CY9 A;  3UV5 A;  2RNY A;  3I3J A;  4N4I A;  3HMF A;  1F68 A;  5A5S A;  5L8U A;  5KO4 A;  4TU4 A;  4LYW A;  5CUE A;  4A9K A;  4J3I A;  5HJC A;  5I88 A;  3UVW A;  4NR6 A;  4YYG A;  5BT5 A;  4O7E A;  4HXR A;  5EWH A;  4YYK A;  5CFW A;  5E9L A;  4LR6 A;  2E3K A;  4QEV A;  4A9F A;  4NQM A;  5HEL A;  4ALH A;  4HXK A;  3G0J A;  5FE2 A;  4QSU A;  5CU8 A;  5HRV A;  4IR5 A;  5EP7 A;  5LKZ A;  4YYM A;  4O72 A;  4UYH A;  4NRB A;  4O74 A;  3JVM A;  5L98 A;  5K29 A;  5E9V A;  4CFL A;  5H85 A;  5FB0 A;  5FH6 A;  5BT3 A;  5IGK A;  2OUO A;  5G4S A;  4HBV A;  4NXJ A;  5CGP A;  5F1H A;  5D24 A;  3P1C A;  4CL9 A;  4NR8 A;  4CUU A;  4N4G A;  5EV9 A;  4LDF A;  3LQI A;  4UIW A;  2DVV A;  4BW3 A;  5EWD A;  4LRG A;  3O36 A;  5A81 A;  5FE5 A;  4YYI A;  5D26 A;  4IOQ A;  4WIV A;  3UV4 A;  4ZW1 A;  4QC1 A;  5FE6 A;  4BHW A;  5E3G A;  5E74 A;  5L96 A;  2L84 A;  5CS8 A;  4QUT A;  4CUQ A;  5F62 A;  5L99 A;  4MR5 A;  5HRX A;  5HEN A;  5FG4 A;  4TZ8 A;  5E9I A;  2DVS A;  5HEM A;  4YH4 A;  5ETB A;  3JVL A;  5C7N A;  4MR4 A;  4ALG A;  4HBW A;  4QSS A;  5F60 A;  3UVY A;  3GG3 A;  2YDW A;  3D7C A;  2RNW A;  3LQJ A;  3HME A;  2RI7 A;  5II2 A;  3IU5 A;  5D0C A;  2YEM A;  2DAT A;  5AD2 A;  4LZS A;  4HXS A;  5DLZ A;  4TTE A;  4YAB A;  5L97 A;  4Z1Q A;  4QEU A;  4IOO A;  2DWW A;  4QUU A;  2MJV B;  5F61 A;  4IR4 A;  5CTL A;  4HXM A;  5CQ8 A;  5F1L A;  5FG5 A;  4A9I A;  2LSP B;  3HMH A;  5FBX A;  4NYV A;  5IGN A;  4PCI A;  5EWC A;  4XY9 A;  4CFK A;  5COI A;  3MB3 A;  5A7C A;  5AMF A;  3O35 A;  4HXL A;  5D25 A;  5IGL A;  1E6I A;  5CQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...