5DKHA

Crystal structure of the bromodomain of human brm (smarca2) in complex with a hydroxyphenyl propenone inhibitor 17
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
116
structure length
116
Chain Sequence
SPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable global transcription activator SNF2L2
publication title Crystal structure of the bromodomain of human BRM (SMARCA2) in complex with a hydroxyphenyl propenone inhibitor 17
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature ec 3.6.4.-:
pdb deposition date 2015-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5dkhA00
4AKNA 5IGMA 4GPJA 2RO1A 4PCIA 5CUEA 4QC1A 5ENGA 3U5LA 5EWVA 4BJXA 5F60A 5D3PA 5DFBA 3SVGA 4YBSA 4WHWA 4TT6A 4NR8A 5F63A 4LYSA 5G4RA 5A5QA 5C87A 3JVLA 2DVSA 4O71A 4O78A 4TTEA 5KTUA 3QZSA 2YEKA 4TU6A 3S91A 4DONA 5CY9A 5L8TA 3I3JA 5EICA 4IORA 5C85A 5LKXA 2RI7A 3UV4A 5JI8A 2I7KA 5COIA 5EWDA 5F3AA 4NR5A 5A85A 4HBYA 4MEQA 3LJWA 4YY4A 5CQAA 4TS8A 5HCLA 3P5OA 5FB0A 4ALHA 3U5KA 3IU6A 5J0DA 5CP5A 3TLPA 4XY9A 5II2A 5A5PA 4WHUA 4IOQA 5HFRA 4LYWA 4TU4A 5CFWA 4HXNA 4HXRA 5E73A 2RNXA 3DAIA 2RNYA 4LZRA 5ETBA 4N4GA 4O7AA 5C7NA 5DYXA 3AQAA 5D25A 5ENHA 4QNSA 4RVRA 4TZ2A 4A9EA 5HFQA 5KO4A 2DVRA 2L84A 5I7YA 4Z1QA 4NQNA 5FG6A 4O72A 3G0JA 2GRCA 4LC2A 4YBTA 5D3HA 4KV1A 5E3DA 5C8GA 5TCMA 2YEMA 3MB3A 5HELA 2WP2A 4QR4A 5CUBA 2OO1A 4IR5A 4ALGA 5CUCA 5E3GA 5I88A 2WP1A 4QSPA 4O75A 4NRAA 4TZ8A 5A81A 5FE3A 2RS9B 3DWYA 5KU3A 2KTBB 4NYVA 5CTLA 4Y03A 4PY6A 4YYGA 4UITA 4OUFA 4CFKA 4NRBA 4CFLA 4YK0A 3JVJA 4C66A 5I7XA 5FE1A 5D3SA 5ENJA 4QUTA 4UIYA 5G4SA 3SVHA 4KCXA 4OGIA 3HMEA 4N4IA 4Q0OA 5E9MA 5F5ZA 2D82A 2G4AA 5LVQA 4CUTA 5AMFA 5CU8A 4QYLA 4UIZA 5I40A 5FH8A 4NR6A 3P1EA 4QZSA 2H60A 4QSTA 4QEVA 5D24A 5EPSA 3LQIA 4IR3A 5FG5A 4YYHA 5EWCA 4XUAA 5FE7A 2DWWA 2YQDA 4Z6HA 5ENCA 5F62A 5FE6A 5LKZA 4UIVA 4UYHA 4O74A 4UYDA 5A5RA 4O7BA 4C67A 3MB4A 4UYGA 4QSXA 5CQTA 5ENEA 5DY7A 3HMFA 4HBXA 5F2PA 5DYUA 5I80A 5CQ8A 5EU1A 5K29A 5E9LA 3QZVA 3LQJA 5LJ2A 4HXMA 4ZQLA 4MR4A 4N4HA 4QEUA 4YYIA 4CUQA 3O36A 4A9JA 4NUEA 5A83A 4YY6A 4BW4A 4CURA 5CUDA 5AD2A 5BT3A 5CQ6A 3U5MA 4BW1A 4N3WA 5D3RA 4MR6A 5D0CA 4YH3A 5D26A 5IGLA 5HQ6A 4A9NA 3AADA 3U5OA 3P1CA 5H85A 5FE8A 4ZC9A 2D9EA 2L85A 2DATA 4O70A 4UIWA 2YYNA 2DKWA 5CS8A 4QY4A 3O35A 1EQFA 4A9MA 1JSPB 5I83A 2OUOA 5TB6A 3P1FA 5DX4A 5D7XA 3MQMA 2R10A 3QZTA 4MR5A 5CUGA 4Z93A 4CLBA 2E7NA 4XUBA 5DBMA 5E74A 3MXFA 4MEPA 4PCEA 4WIVA 5EPBA 4BW2A 5BT4A 5A82A 4UYFB 2R0YA 5FH7A 4Z6IA 5E9KA 2E3KA 4XYAA 5DW2A 2YDWA 3U5NA 5ETDA 5CZGA 5DKDA 4TT4A 5EI4A 5IBNA 3FKMX 4MEOA 3U5JA 4QSVA 5DW1A 3GG3A 5LJ1A 5CQ7A 5FH6A 5EM3A 5DYCA 4UIXA 5LKUA 5E9IA 4YYMA 5A7CA 3O37A 5A5SA 4QSUA 1ZS5A 5FE4A 5EWHA 4YC9A 5HQ5A 4LRGA 5F25A 4YABA 5EVAA 5A5OA 4QUUA 5D3NA 3IU5A 3UVXA 4CL9A 3UVYA 4X2IA 5C89A 5BT5A 2RFJA 4LYIA 3D7CA 4FLPA 5EISA 4N4FA 3ONIA 5D3JA 5I86A 4QBMA 4QYDA 5CUAA 2L5EA 5II1A 4LZSA 4XY8A 5EK9A 5E0RA 4UYEA 5HRVA 4HXPA 4LZ2A 5LVRA 5EP7A 4NQMA 5E9YA 5HEMA 5ACYA 4NS5A 4BW3A 4YYKA 4J1PA 4MENA 1N72A 5FG4A 5IGNA 4TT2A 2F6JA 5CPEA 5FFVA 5E9VA 3S92A 4MR3A 4Q0NA 4CUUA 5DFCA 5L96A 5LUUA 2R0SA 5H1VA 3JVMA 3LXJA 3JVKA 4YYDA 3UW9A 5I1QA 4YAXA 1WUMA 5DLZA 5L97A 4J0RA 4NUCA 5EQ1A 5F1LA 5CGPA 4NR9A 5CQ5A 4NYXA 2R0VA 3MULA 3LQHA 5AD3A 4QC3A 5HENA 4HXSA 5IIDA 5DKHA 4HXKA 4QR5A 3HMHA 5D3LA 5FB1A 5I29A 5A5NA 3ZYUA 4NUDA 4F3IA 4YH4A 5I89A 4QSQA 3Q2EA 4KV4A 5H1TA 5HRWA 5FFWA 5HRXA 4O7CA 3G0LA 2F6NA 2YELA 3MUKA 3O34A 5DKCA 3UV2A 5DYAA 4TYLA 4QR3A 3UVWA 4O76A 5FE0A 4PTBA 1E6IA 4NR7A 4IR6A 5EV9A 4Z1SA 2FSAA 4YBMA 5FE9A 4QSRA 2OSSA 5LJ0A 5KTWA 4O7EA 4E96A 4HXLA 5KHMA 3RCWA 4J3IA 5CRMA 5IGKA 5FDZA 2N9GA 3U5PA 5ENBA 4NYWA 4LDFA 5FFYA 5FBXA 3UVDA 4IOOA 1WUGA 5JWMA 5HJCA 3SVFA 4QSWA 3Q2FA 4A9LA 3UV5A 4NXJA 5C4QA 4PS5A 4BHWA 5L99A 5HM0A 2DVQA 4YATA 2NXBA 4O7FA 5CRZA 5ENIA 4UIUA 5HLSA 5L98A 5ENFA 5EA1A 4A9HA 2MJVB 4CUPA 5EPRA 5EWWA 2YW5A 5H1UA 3O33A 4QSSA 5CQ3A 4YYNA 2I8NA 5EGUA 4LR6A 2E7OA 5CQ4A 4QB3A 4OGJA 5DLXA 4ZW1A 5F1HA 5LKTA 4UYFA 3K2JA 4HBWA 4A9OA 5IG6A 5HQ7A 4QEWA 4NRCA 4TQNA 5FE2A 3NXBA 1X0JA 2LSPB 3P1DA 2RNWA 4YADA 4A9IA 4HBVA 5FE5A 2DVVA 5E7DA 4J0SA 4PKLA 5L8UA 5F36A 5AMEA 4NR4A 4HXOA 4A9FA 4O77A 4CUSA 4IR4A 4YYJA 1JM4B 5DFDA 1F68A 5KTXA 5D3TA 5F61A 4A9KA
chains in the Genus database with same CATH superfamily
4AKNA 5IGMA 4GPJA 2RO1A 4PCIA 5CUEA 4QC1A 5ENGA 3U5LA 5EWVA 4BJXA 5F60A 5D3PA 5DFBA 3SVGA 4YBSA 4WHWA 4TT6A 4NR8A 5F63A 4LYSA 5G4RA 5A5QA 5C87A 3JVLA 2DVSA 4O71A 4O78A 4TTEA 5KTUA 3QZSA 2YEKA 4TU6A 3S91A 4DONA 5CY9A 5L8TA 3I3JA 5EICA 4IORA 5C85A 5LKXA 2RI7A 3UV4A 5JI8A 2I7KA 5COIA 5EWDA 5F3AA 4NR5A 5A85A 4HBYA 4MEQA 3LJWA 4YY4A 5CQAA 4TS8A 5HCLA 3P5OA 5FB0A 4ALHA 3U5KA 3IU6A 5J0DA 5CP5A 3TLPA 4XY9A 5II2A 5A5PA 4WHUA 4IOQA 5HFRA 4LYWA 4TU4A 5CFWA 4HXNA 4HXRA 5E73A 2RNXA 4AKHA 3DAIA 2RNYA 4LZRA 5ETBA 4N4GA 4O7AA 5C7NA 5DYXA 3AQAA 5D25A 5ENHA 4QNSA 4RVRA 4TZ2A 4A9EA 5HFQA 5KO4A 2DVRA 2L84A 5I7YA 4Z1QA 4NQNA 5FG6A 4O72A 3G0JA 2GRCA 4LC2A 4YBTA 5D3HA 4KV1A 5E3DA 5C8GA 5TCMA 2YEMA 3MB3A 5HELA 2WP2A 4QR4A 5CUBA 2OO1A 4IR5A 4ALGA 5CUCA 5E3GA 5I88A 2WP1A 4QSPA 4O75A 4NRAA 4TZ8A 5A81A 5FE3A 2RS9B 3DWYA 5KU3A 2KTBB 4NYVA 5CTLA 4Y03A 4PY6A 4YYGA 4UITA 4OUFA 4CFKA 4NRBA 4CFLA 4YK0A 3JVJA 4C66A 5I7XA 5FE1A 5D3SA 5ENJA 4QUTA 4UIYA 5G4SA 3SVHA 4KCXA 4OGIA 3HMEA 4N4IA 4Q0OA 5E9MA 5F5ZA 2D82A 2G4AA 5LVQA 4CUTA 5AMFA 5CU8A 4QYLA 4UIZA 5I40A 5FH8A 4NR6A 3P1EA 4QZSA 2H60A 4QSTA 4QEVA 5D24A 5EPSA 3LQIA 4IR3A 5FG5A 4YYHA 5EWCA 4XUAA 5FE7A 2DWWA 2YQDA 4Z6HA 5ENCA 5F62A 5FE6A 5LKZA 4UIVA 4UYHA 4O74A 4UYDA 5A5RA 4O7BA 4C67A 3MB4A 4UYGA 4QSXA 5CQTA 5ENEA 5DY7A 3HMFA 4HBXA 5F2PA 5DYUA 5I80A 5CQ8A 5EU1A 5K29A 5E9LA 3QZVA 3LQJA 5LJ2A 3ERRA 4HXMA 4ZQLA 4MR4A 4N4HA 4QEUA 4YYIA 4CUQA 3O36A 4A9JA 4NUEA 5A83A 4YY6A 4BW4A 4CURA 5CUDA 5AD2A 5BT3A 5CQ6A 3U5MA 4BW1A 4N3WA 5D3RA 4MR6A 5D0CA 4YH3A 5D26A 5IGLA 5HQ6A 4A9NA 3AADA 3U5OA 3P1CA 5H85A 5FE8A 4ZC9A 2D9EA 2L85A 2DATA 4O70A 4UIWA 2YYNA 2DKWA 5CS8A 4QY4A 3O35A 1EQFA 4A9MA 1JSPB 5I83A 2OUOA 5TB6A 3P1FA 5DX4A 5D7XA 3MQMA 2R10A 3QZTA 4MR5A 5CUGA 4Z93A 4CLBA 2E7NA 4XUBA 5DBMA 3VKGA 5E74A 3MXFA 4MEPA 4PCEA 4WIVA 5EPBA 4BW2A 5BT4A 5A82A 4UYFB 2R0YA 5FH7A 4Z6IA 5E9KA 2E3KA 4XYAA 5DW2A 2YDWA 3U5NA 4AKGA 5ETDA 5CZGA 5DKDA 4TT4A 5EI4A 5IBNA 3FKMX 4MEOA 3U5JA 4QSVA 5DW1A 3GG3A 5LJ1A 5CQ7A 2EJNA 5FH6A 5EM3A 5DYCA 4UIXA 5LKUA 5E9IA 4YYMA 5A7CA 3O37A 5A5SA 4QSUA 1ZS5A 5FE4A 5EWHA 4YC9A 5HQ5A 4LRGA 5F25A 4YABA 5EVAA 5A5OA 4QUUA 5D3NA 3IU5A 3UVXA 4CL9A 3UVYA 4X2IA 5C89A 5BT5A 2RFJA 4LYIA 3D7CA 4FLPA 5EISA 4N4FA 1PUOA 3ONIA 5D3JA 5I86A 4QBMA 4QYDA 5CUAA 2L5EA 5II1A 4LZSA 4XY8A 5EK9A 5E0RA 3D1BA 4UYEA 5HRVA 4HXPA 4AI6A 4LZ2A 5LVRA 5EP7A 4NQMA 5E9YA 5HEMA 5ACYA 4NS5A 4BW3A 4YYKA 4J1PA 4MENA 1N72A 5FG4A 5IGNA 4TT2A 2F6JA 5CPEA 5FFVA 5E9VA 3S92A 4MR3A 4Q0NA 4CUUA 5DFCA 5L96A 5LUUA 3D1DA 2R0SA 5H1VA 3JVMA 3LXJA 3JVKA 4YYDA 3UW9A 5I1QA 4YAXA 1WUMA 5DLZA 5L97A 4J0RA 4NUCA 5EQ1A 5F1LA 5CGPA 4NR9A 5CQ5A 4NYXA 2R0VA 3MULA 3LQHA 4AKIA 5AD3A 4QC3A 3VKHA 5HENA 4HXSA 5IIDA 5DKHA 4HXKA 4QR5A 3HMHA 5D3LA 5FB1A 5I29A 5A5NA 3ZYUA 4NUDA 4F3IA 4YH4A 5I89A 1ZKRA 4QSQA 3Q2EA 4KV4A 5H1TA 5HRWA 5FFWA 5HRXA 4O7CA 3G0LA 2F6NA 2YELA 3MUKA 3O34A 5DKCA 3UV2A 5DYAA 4TYLA 4QR3A 3UVWA 4O76A 5FE0A 4PTBA 1E6IA 4NR7A 4IR6A 5EV9A 4Z1SA 2FSAA 4YBMA 5FE9A 4QSRA 2OSSA 5LJ0A 5KTWA 4O7EA 4E96A 4HXLA 5KHMA 3RCWA 4J3IA 5CRMA 5IGKA 5FDZA 2N9GA 3U5PA 5ENBA 4NYWA 4LDFA 5FFYA 5FBXA 3UVDA 4IOOA 1WUGA 5JWMA 5HJCA 3SVFA 4QSWA 3Q2FA 4A9LA 3UV5A 4NXJA 5C4QA 4PS5A 4BHWA 5L99A 5HM0A 2DVQA 4YATA 2NXBA 4O7FA 5CRZA 5ENIA 4UIUA 5HLSA 5L98A 5ENFA 5EA1A 4A9HA 2MJVB 4CUPA 5EPRA 5EWWA 2YW5A 5H1UA 3O33A 4QSSA 5CQ3A 4YYNA 2I8NA 5EGUA 4LR6A 2E7OA 5CQ4A 4QB3A 4OGJA 5DLXA 4ZW1A 5F1HA 5LKTA 4UYFA 3K2JA 4HBWA 4A9OA 5IG6A 5HQ7A 4QEWA 4NRCA 4TQNA 5FE2A 3NXBA 1X0JA 2LSPB 3P1DA 2RNWA 4YADA 4A9IA 4HBVA 5FE5A 2DVVA 5E7DA 4J0SA 4PKLA 5L8UA 5F36A 5AMEA 4NR4A 4HXOA 4A9FA 4O77A 4CUSA 4IR4A 4YYJA 1JM4B 5DFDA 1F68A 5KTXA 5D3TA 5F61A 4A9KA
chains in the Genus database with same CATH topology
4AKNA 5IGMA 4GPJA 2RO1A 4PCIA 5CUEA 4QC1A 5ENGA 3U5LA 5EWVA 4BJXA 5F60A 5D3PA 5DFBA 3SVGA 4YBSA 4WHWA 4TT6A 4NR8A 5F63A 4LYSA 5G4RA 5A5QA 5C87A 3JVLA 2DVSA 4O71A 4O78A 4TTEA 5KTUA 3QZSA 2YEKA 4TU6A 3S91A 4DONA 5CY9A 5L8TA 3I3JA 5EICA 4IORA 5C85A 5LKXA 2RI7A 3UV4A 5JI8A 2I7KA 5COIA 5EWDA 5F3AA 4NR5A 5A85A 4HBYA 4MEQA 3LJWA 4YY4A 5CQAA 4TS8A 5HCLA 3P5OA 5FB0A 4ALHA 3U5KA 3IU6A 5J0DA 5CP5A 3TLPA 4XY9A 5II2A 5A5PA 4WHUA 4IOQA 5HFRA 4LYWA 4TU4A 5CFWA 4HXNA 4HXRA 5E73A 2RNXA 3DAIA 2RNYA 4LZRA 5ETBA 4N4GA 4O7AA 5C7NA 5DYXA 3AQAA 5D25A 5ENHA 4QNSA 4RVRA 4TZ2A 4A9EA 5HFQA 5KO4A 2DVRA 2L84A 5I7YA 4Z1QA 4NQNA 5FG6A 4O72A 3G0JA 2GRCA 4LC2A 4YBTA 5D3HA 4KV1A 5E3DA 5C8GA 5TCMA 2YEMA 3MB3A 5HELA 2WP2A 4QR4A 5CUBA 2OO1A 4IR5A 4ALGA 5CUCA 5E3GA 5I88A 2WP1A 4QSPA 4O75A 4NRAA 4TZ8A 5A81A 5FE3A 2RS9B 3DWYA 5KU3A 2KTBB 4NYVA 5CTLA 4Y03A 4PY6A 4YYGA 4UITA 4OUFA 4CFKA 4NRBA 4CFLA 4YK0A 3JVJA 4C66A 5I7XA 5FE1A 5D3SA 5ENJA 4QUTA 4UIYA 5G4SA 3SVHA 4KCXA 4OGIA 3HMEA 4N4IA 4Q0OA 5E9MA 5F5ZA 2D82A 2G4AA 5LVQA 4CUTA 5AMFA 5CU8A 4QYLA 4UIZA 5I40A 5FH8A 4NR6A 3P1EA 4QZSA 2H60A 4QSTA 4QEVA 5D24A 5EPSA 3LQIA 4IR3A 5FG5A 4YYHA 5EWCA 4XUAA 5FE7A 2DWWA 2YQDA 4Z6HA 5ENCA 5F62A 5FE6A 5LKZA 4UIVA 4UYHA 4O74A 4UYDA 5A5RA 4O7BA 4C67A 3MB4A 4UYGA 4QSXA 5CQTA 5ENEA 5DY7A 3HMFA 4HBXA 5F2PA 5DYUA 5I80A 5CQ8A 5EU1A 5K29A 5E9LA 3QZVA 3LQJA 5LJ2A 4HXMA 4ZQLA 4MR4A 4N4HA 4QEUA 4YYIA 4CUQA 3O36A 4A9JA 4NUEA 5A83A 4YY6A 4BW4A 4CURA 5CUDA 5AD2A 5BT3A 5CQ6A 3U5MA 4BW1A 4N3WA 5D3RA 4MR6A 5D0CA 4YH3A 5D26A 5IGLA 5HQ6A 4A9NA 3AADA 3U5OA 3P1CA 5H85A 5FE8A 4ZC9A 2D9EA 2L85A 2DATA 4O70A 4UIWA 2YYNA 2DKWA 5CS8A 4QY4A 3O35A 1EQFA 4A9MA 1JSPB 5I83A 2OUOA 5TB6A 3P1FA 5DX4A 5D7XA 3MQMA 2R10A 3QZTA 4MR5A 5CUGA 4Z93A 4CLBA 2E7NA 4XUBA 5DBMA 5E74A 3MXFA 4MEPA 4PCEA 4WIVA 5EPBA 4BW2A 5BT4A 5A82A 4UYFB 2R0YA 5FH7A 4Z6IA 5E9KA 2E3KA 4XYAA 5DW2A 2YDWA 3U5NA 5ETDA 5CZGA 5DKDA 4TT4A 5EI4A 5IBNA 3FKMX 4MEOA 3U5JA 4QSVA 5DW1A 3GG3A 5LJ1A 5CQ7A 5FH6A 5EM3A 5DYCA 4UIXA 5LKUA 5E9IA 4YYMA 5A7CA 3O37A 5A5SA 4QSUA 1ZS5A 5FE4A 5EWHA 4YC9A 5HQ5A 4LRGA 5F25A 4YABA 5EVAA 5A5OA 4QUUA 5D3NA 3IU5A 3UVXA 4CL9A 3UVYA 4X2IA 5C89A 5BT5A 2RFJA 4LYIA 3D7CA 4FLPA 5EISA 4N4FA 3ONIA 5D3JA 5I86A 4QBMA 4QYDA 5CUAA 2L5EA 5II1A 4LZSA 4XY8A 5EK9A 5E0RA 4UYEA 5HRVA 4HXPA 4LZ2A 5LVRA 5EP7A 4NQMA 5E9YA 5HEMA 5ACYA 4NS5A 4BW3A 4YYKA 4J1PA 4MENA 1N72A 5FG4A 5IGNA 4TT2A 2F6JA 5CPEA 5FFVA 5E9VA 3S92A 4MR3A 4Q0NA 4CUUA 5DFCA 5L96A 5LUUA 2R0SA 5H1VA 3JVMA 3LXJA 3JVKA 4YYDA 3UW9A 5I1QA 4YAXA 1WUMA 5DLZA 5L97A 4J0RA 4NUCA 5EQ1A 5F1LA 5CGPA 4NR9A 5CQ5A 4NYXA 2R0VA 3MULA 3LQHA 5AD3A 4QC3A 5HENA 4HXSA 5IIDA 5DKHA 4HXKA 4QR5A 3HMHA 5D3LA 5FB1A 5I29A 5A5NA 3ZYUA 4NUDA 4F3IA 4YH4A 5I89A 4QSQA 3Q2EA 4KV4A 5H1TA 5HRWA 5FFWA 5HRXA 4O7CA 3G0LA 2F6NA 2YELA 3MUKA 3O34A 5DKCA 3UV2A 5DYAA 4TYLA 4QR3A 3UVWA 4O76A 5FE0A 4PTBA 1E6IA 4NR7A 4IR6A 5EV9A 4Z1SA 2FSAA 4YBMA 5FE9A 4QSRA 2OSSA 5LJ0A 5KTWA 4O7EA 4E96A 4HXLA 5KHMA 3RCWA 4J3IA 5CRMA 5IGKA 5FDZA 2N9GA 3U5PA 5ENBA 4NYWA 4LDFA 5FFYA 5FBXA 3UVDA 4IOOA 1WUGA 5JWMA 5HJCA 3SVFA 4QSWA 3Q2FA 4A9LA 3UV5A 4NXJA 5C4QA 4PS5A 4BHWA 5L99A 5HM0A 2DVQA 4YATA 2NXBA 4O7FA 5CRZA 5ENIA 4UIUA 5HLSA 5L98A 5ENFA 5EA1A 4A9HA 2MJVB 4CUPA 5EPRA 5EWWA 2YW5A 5H1UA 3O33A 4QSSA 5CQ3A 4YYNA 2I8NA 5EGUA 4LR6A 2E7OA 5CQ4A 4QB3A 4OGJA 5DLXA 4ZW1A 5F1HA 5LKTA 4UYFA 3K2JA 4HBWA 4A9OA 5IG6A 5HQ7A 4QEWA 4NRCA 4TQNA 5FE2A 3NXBA 1X0JA 2LSPB 3P1DA 2RNWA 4YADA 4A9IA 4HBVA 5FE5A 2DVVA 5E7DA 4J0SA 4PKLA 5L8UA 5F36A 5AMEA 4NR4A 4HXOA 4A9FA 4O77A 4CUSA 4IR4A 4YYJA 1JM4B 5DFDA 1F68A 5KTXA 5D3TA 5F61A 4A9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKN A;  5IGM A;  4GPJ A;  2RO1 A;  4PCI A;  5CUE A;  4QC1 A;  5ENG A;  3U5L A;  5EWV A;  4BJX A;  5F60 A;  5D3P A;  5DFB A;  3SVG A;  4YBS A;  4WHW A;  4TT6 A;  4NR8 A;  5F63 A;  4LYS A;  5G4R A;  5A5Q A;  5C87 A;  3JVL A;  2DVS A;  4O71 A;  4O78 A;  4TTE A;  5KTU A;  3QZS A;  2YEK A;  4TU6 A;  3S91 A;  4DON A;  5CY9 A;  5L8T A;  3I3J A;  5EIC A;  4IOR A;  5C85 A;  5LKX A;  2RI7 A;  3UV4 A;  5JI8 A;  2I7K A;  5COI A;  5EWD A;  5F3A A;  4NR5 A;  5A85 A;  4HBY A;  4MEQ A;  3LJW A;  4YY4 A;  5CQA A;  4TS8 A;  5HCL A;  3P5O A;  5FB0 A;  4ALH A;  3U5K A;  3IU6 A;  5J0D A;  5CP5 A;  3TLP A;  4XY9 A;  5II2 A;  5A5P A;  4WHU A;  4IOQ A;  5HFR A;  4LYW A;  4TU4 A;  5CFW A;  4HXN A;  4HXR A;  5E73 A;  2RNX A;  3DAI A;  2RNY A;  4LZR A;  5ETB A;  4N4G A;  4O7A A;  5C7N A;  5DYX A;  3AQA A;  5D25 A;  5ENH A;  4QNS A;  4RVR A;  4TZ2 A;  4A9E A;  5HFQ A;  5KO4 A;  2DVR A;  2L84 A;  5I7Y A;  4Z1Q A;  4NQN A;  5FG6 A;  4O72 A;  3G0J A;  2GRC A;  4LC2 A;  4YBT A;  5D3H A;  4KV1 A;  5E3D A;  5C8G A;  5TCM A;  2YEM A;  3MB3 A;  5HEL A;  2WP2 A;  4QR4 A;  5CUB A;  2OO1 A;  4IR5 A;  4ALG A;  5CUC A;  5E3G A;  5I88 A;  2WP1 A;  4QSP A;  4O75 A;  4NRA A;  4TZ8 A;  5A81 A;  5FE3 A;  2RS9 B;  3DWY A;  5KU3 A;  2KTB B;  4NYV A;  5CTL A;  4Y03 A;  4PY6 A;  4YYG A;  4UIT A;  4OUF A;  4CFK A;  4NRB A;  4CFL A;  4YK0 A;  3JVJ A;  4C66 A;  5I7X A;  5FE1 A;  5D3S A;  5ENJ A;  4QUT A;  4UIY A;  5G4S A;  3SVH A;  4KCX A;  4OGI A;  3HME A;  4N4I A;  4Q0O A;  5E9M A;  5F5Z A;  2D82 A;  2G4A A;  5LVQ A;  4CUT A;  5AMF A;  5CU8 A;  4QYL A;  4UIZ A;  5I40 A;  5FH8 A;  4NR6 A;  3P1E A;  4QZS A;  2H60 A;  4QST A;  4QEV A;  5D24 A;  5EPS A;  3LQI A;  4IR3 A;  5FG5 A;  4YYH A;  5EWC A;  4XUA A;  5FE7 A;  2DWW A;  2YQD A;  4Z6H A;  5ENC A;  5F62 A;  5FE6 A;  5LKZ A;  4UIV A;  4UYH A;  4O74 A;  4UYD A;  5A5R A;  4O7B A;  4C67 A;  3MB4 A;  4UYG A;  4QSX A;  5CQT A;  5ENE A;  5DY7 A;  3HMF A;  4HBX A;  5F2P A;  5DYU A;  5I80 A;  5CQ8 A;  5EU1 A;  5K29 A;  5E9L A;  3QZV A;  3LQJ A;  5LJ2 A;  4HXM A;  4ZQL A;  4MR4 A;  4N4H A;  4QEU A;  4YYI A;  4CUQ A;  3O36 A;  4A9J A;  4NUE A;  5A83 A;  4YY6 A;  4BW4 A;  4CUR A;  5CUD A;  5AD2 A;  5BT3 A;  5CQ6 A;  3U5M A;  4BW1 A;  4N3W A;  5D3R A;  4MR6 A;  5D0C A;  4YH3 A;  5D26 A;  5IGL A;  5HQ6 A;  4A9N A;  3AAD A;  3U5O A;  3P1C A;  5H85 A;  5FE8 A;  4ZC9 A;  2D9E A;  2L85 A;  2DAT A;  4O70 A;  4UIW A;  2YYN A;  2DKW A;  5CS8 A;  4QY4 A;  3O35 A;  1EQF A;  4A9M A;  1JSP B;  5I83 A;  2OUO A;  5TB6 A;  3P1F A;  5DX4 A;  5D7X A;  3MQM A;  2R10 A;  3QZT A;  4MR5 A;  5CUG A;  4Z93 A;  4CLB A;  2E7N A;  4XUB A;  5DBM A;  5E74 A;  3MXF A;  4MEP A;  4PCE A;  4WIV A;  5EPB A;  4BW2 A;  5BT4 A;  5A82 A;  4UYF B;  2R0Y A;  5FH7 A;  4Z6I A;  5E9K A;  2E3K A;  4XYA A;  5DW2 A;  2YDW A;  3U5N A;  5ETD A;  5CZG A;  5DKD A;  4TT4 A;  5EI4 A;  5IBN A;  3FKM X;  4MEO A;  3U5J A;  4QSV A;  5DW1 A;  3GG3 A;  5LJ1 A;  5CQ7 A;  5FH6 A;  5EM3 A;  5DYC A;  4UIX A;  5LKU A;  5E9I A;  4YYM A;  5A7C A;  3O37 A;  5A5S A;  4QSU A;  1ZS5 A;  5FE4 A;  5EWH A;  4YC9 A;  5HQ5 A;  4LRG A;  5F25 A;  4YAB A;  5EVA A;  5A5O A;  4QUU A;  5D3N A;  3IU5 A;  3UVX A;  4CL9 A;  3UVY A;  4X2I A;  5C89 A;  5BT5 A;  2RFJ A;  4LYI A;  3D7C A;  4FLP A;  5EIS A;  4N4F A;  3ONI A;  5D3J A;  5I86 A;  4QBM A;  4QYD A;  5CUA A;  2L5E A;  5II1 A;  4LZS A;  4XY8 A;  5EK9 A;  5E0R A;  4UYE A;  5HRV A;  4HXP A;  4LZ2 A;  5LVR A;  5EP7 A;  4NQM A;  5E9Y A;  5HEM A;  5ACY A;  4NS5 A;  4BW3 A;  4YYK A;  4J1P A;  4MEN A;  1N72 A;  5FG4 A;  5IGN A;  4TT2 A;  2F6J A;  5CPE A;  5FFV A;  5E9V A;  3S92 A;  4MR3 A;  4Q0N A;  4CUU A;  5DFC A;  5L96 A;  5LUU A;  2R0S A;  5H1V A;  3JVM A;  3LXJ A;  3JVK A;  4YYD A;  3UW9 A;  5I1Q A;  4YAX A;  1WUM A;  5DLZ A;  5L97 A;  4J0R A;  4NUC A;  5EQ1 A;  5F1L A;  5CGP A;  4NR9 A;  5CQ5 A;  4NYX A;  2R0V A;  3MUL A;  3LQH A;  5AD3 A;  4QC3 A;  5HEN A;  4HXS A;  5IID A;  5DKH A;  4HXK A;  4QR5 A;  3HMH A;  5D3L A;  5FB1 A;  5I29 A;  5A5N A;  3ZYU A;  4NUD A;  4F3I A;  4YH4 A;  5I89 A;  4QSQ A;  3Q2E A;  4KV4 A;  5H1T A;  5HRW A;  5FFW A;  5HRX A;  4O7C A;  3G0L A;  2F6N A;  2YEL A;  3MUK A;  3O34 A;  5DKC A;  3UV2 A;  5DYA A;  4TYL A;  4QR3 A;  3UVW A;  4O76 A;  5FE0 A;  4PTB A;  1E6I A;  4NR7 A;  4IR6 A;  5EV9 A;  4Z1S A;  2FSA A;  4YBM A;  5FE9 A;  4QSR A;  2OSS A;  5LJ0 A;  5KTW A;  4O7E A;  4E96 A;  4HXL A;  5KHM A;  3RCW A;  4J3I A;  5CRM A;  5IGK A;  5FDZ A;  2N9G A;  3U5P A;  5ENB A;  4NYW A;  4LDF A;  5FFY A;  5FBX A;  3UVD A;  4IOO A;  1WUG A;  5JWM A;  5HJC A;  3SVF A;  4QSW A;  3Q2F A;  4A9L A;  3UV5 A;  4NXJ A;  5C4Q A;  4PS5 A;  4BHW A;  5L99 A;  5HM0 A;  2DVQ A;  4YAT A;  2NXB A;  4O7F A;  5CRZ A;  5ENI A;  4UIU A;  5HLS A;  5L98 A;  5ENF A;  5EA1 A;  4A9H A;  2MJV B;  4CUP A;  5EPR A;  5EWW A;  2YW5 A;  5H1U A;  3O33 A;  4QSS A;  5CQ3 A;  4YYN A;  2I8N A;  5EGU A;  4LR6 A;  2E7O A;  5CQ4 A;  4QB3 A;  4OGJ A;  5DLX A;  4ZW1 A;  5F1H A;  5LKT A;  4UYF A;  3K2J A;  4HBW A;  4A9O A;  5IG6 A;  5HQ7 A;  4QEW A;  4NRC A;  4TQN A;  5FE2 A;  3NXB A;  1X0J A;  2LSP B;  3P1D A;  2RNW A;  4YAD A;  4A9I A;  4HBV A;  5FE5 A;  2DVV A;  5E7D A;  4J0S A;  4PKL A;  5L8U A;  5F36 A;  5AME A;  4NR4 A;  4HXO A;  4A9F A;  4O77 A;  4CUS A;  4IR4 A;  4YYJ A;  1JM4 B;  5DFD A;  1F68 A;  5KTX A;  5D3T A;  5F61 A;  4A9K A; 
#chains in the Genus database with same CATH topology
 4AKN A;  5IGM A;  4GPJ A;  2RO1 A;  4PCI A;  5CUE A;  4QC1 A;  5ENG A;  3U5L A;  5EWV A;  4BJX A;  5F60 A;  5D3P A;  5DFB A;  3SVG A;  4YBS A;  4WHW A;  4TT6 A;  4NR8 A;  5F63 A;  4LYS A;  5G4R A;  5A5Q A;  5C87 A;  3JVL A;  2DVS A;  4O71 A;  4O78 A;  4TTE A;  5KTU A;  3QZS A;  2YEK A;  4TU6 A;  3S91 A;  4DON A;  5CY9 A;  5L8T A;  3I3J A;  5EIC A;  4IOR A;  5C85 A;  5LKX A;  2RI7 A;  3UV4 A;  5JI8 A;  2I7K A;  5COI A;  5EWD A;  5F3A A;  4NR5 A;  5A85 A;  4HBY A;  4MEQ A;  3LJW A;  4YY4 A;  5CQA A;  4TS8 A;  5HCL A;  3P5O A;  5FB0 A;  4ALH A;  3U5K A;  3IU6 A;  5J0D A;  5CP5 A;  3TLP A;  4XY9 A;  5II2 A;  5A5P A;  4WHU A;  4IOQ A;  5HFR A;  4LYW A;  4TU4 A;  5CFW A;  4HXN A;  4HXR A;  5E73 A;  2RNX A;  4AKH A;  3DAI A;  2RNY A;  4LZR A;  5ETB A;  4N4G A;  4O7A A;  5C7N A;  5DYX A;  3AQA A;  5D25 A;  5ENH A;  4QNS A;  4RVR A;  4TZ2 A;  4A9E A;  5HFQ A;  5KO4 A;  2DVR A;  2L84 A;  5I7Y A;  4Z1Q A;  4NQN A;  5FG6 A;  4O72 A;  3G0J A;  2GRC A;  4LC2 A;  4YBT A;  5D3H A;  4KV1 A;  5E3D A;  5C8G A;  5TCM A;  2YEM A;  3MB3 A;  5HEL A;  2WP2 A;  4QR4 A;  5CUB A;  2OO1 A;  4IR5 A;  4ALG A;  5CUC A;  5E3G A;  5I88 A;  2WP1 A;  4QSP A;  4O75 A;  4NRA A;  4TZ8 A;  5A81 A;  5FE3 A;  2RS9 B;  3DWY A;  5KU3 A;  2KTB B;  4NYV A;  5CTL A;  4Y03 A;  4PY6 A;  4YYG A;  4UIT A;  4OUF A;  4CFK A;  4NRB A;  4CFL A;  4YK0 A;  3JVJ A;  4C66 A;  5I7X A;  5FE1 A;  5D3S A;  5ENJ A;  4QUT A;  4UIY A;  5G4S A;  3SVH A;  4KCX A;  4OGI A;  3HME A;  4N4I A;  4Q0O A;  5E9M A;  5F5Z A;  2D82 A;  2G4A A;  5LVQ A;  4CUT A;  5AMF A;  5CU8 A;  4QYL A;  4UIZ A;  5I40 A;  5FH8 A;  4NR6 A;  3P1E A;  4QZS A;  2H60 A;  4QST A;  4QEV A;  5D24 A;  5EPS A;  3LQI A;  4IR3 A;  5FG5 A;  4YYH A;  5EWC A;  4XUA A;  5FE7 A;  2DWW A;  2YQD A;  4Z6H A;  5ENC A;  5F62 A;  5FE6 A;  5LKZ A;  4UIV A;  4UYH A;  4O74 A;  4UYD A;  5A5R A;  4O7B A;  4C67 A;  3MB4 A;  4UYG A;  4QSX A;  5CQT A;  5ENE A;  5DY7 A;  3HMF A;  4HBX A;  5F2P A;  5DYU A;  5I80 A;  5CQ8 A;  5EU1 A;  5K29 A;  5E9L A;  3QZV A;  3LQJ A;  5LJ2 A;  3ERR A;  4HXM A;  4ZQL A;  4MR4 A;  4N4H A;  4QEU A;  4YYI A;  4CUQ A;  3O36 A;  4A9J A;  4NUE A;  5A83 A;  4YY6 A;  4BW4 A;  4CUR A;  5CUD A;  5AD2 A;  5BT3 A;  5CQ6 A;  3U5M A;  4BW1 A;  4N3W A;  5D3R A;  4MR6 A;  5D0C A;  4YH3 A;  5D26 A;  5IGL A;  5HQ6 A;  4A9N A;  3AAD A;  3U5O A;  3P1C A;  5H85 A;  5FE8 A;  4ZC9 A;  2D9E A;  2L85 A;  2DAT A;  4O70 A;  4UIW A;  2YYN A;  2DKW A;  5CS8 A;  4QY4 A;  3O35 A;  1EQF A;  4A9M A;  1JSP B;  5I83 A;  2OUO A;  5TB6 A;  3P1F A;  5DX4 A;  5D7X A;  3MQM A;  2R10 A;  3QZT A;  4MR5 A;  5CUG A;  4Z93 A;  4CLB A;  2E7N A;  4XUB A;  5DBM A;  3VKG A;  5E74 A;  3MXF A;  4MEP A;  4PCE A;  4WIV A;  5EPB A;  4BW2 A;  5BT4 A;  5A82 A;  4UYF B;  2R0Y A;  5FH7 A;  4Z6I A;  5E9K A;  2E3K A;  4XYA A;  5DW2 A;  2YDW A;  3U5N A;  4AKG A;  5ETD A;  5CZG A;  5DKD A;  4TT4 A;  5EI4 A;  5IBN A;  3FKM X;  4MEO A;  3U5J A;  4QSV A;  5DW1 A;  3GG3 A;  5LJ1 A;  5CQ7 A;  2EJN A;  5FH6 A;  5EM3 A;  5DYC A;  4UIX A;  5LKU A;  5E9I A;  4YYM A;  5A7C A;  3O37 A;  5A5S A;  4QSU A;  1ZS5 A;  5FE4 A;  5EWH A;  4YC9 A;  5HQ5 A;  4LRG A;  5F25 A;  4YAB A;  5EVA A;  5A5O A;  4QUU A;  5D3N A;  3IU5 A;  3UVX A;  4CL9 A;  3UVY A;  4X2I A;  5C89 A;  5BT5 A;  2RFJ A;  4LYI A;  3D7C A;  4FLP A;  5EIS A;  4N4F A;  1PUO A;  3ONI A;  5D3J A;  5I86 A;  4QBM A;  4QYD A;  5CUA A;  2L5E A;  5II1 A;  4LZS A;  4XY8 A;  5EK9 A;  5E0R A;  3D1B A;  4UYE A;  5HRV A;  4HXP A;  4AI6 A;  4LZ2 A;  5LVR A;  5EP7 A;  4NQM A;  5E9Y A;  5HEM A;  5ACY A;  4NS5 A;  4BW3 A;  4YYK A;  4J1P A;  4MEN A;  1N72 A;  5FG4 A;  5IGN A;  4TT2 A;  2F6J A;  5CPE A;  5FFV A;  5E9V A;  3S92 A;  4MR3 A;  4Q0N A;  4CUU A;  5DFC A;  5L96 A;  5LUU A;  3D1D A;  2R0S A;  5H1V A;  3JVM A;  3LXJ A;  3JVK A;  4YYD A;  3UW9 A;  5I1Q A;  4YAX A;  1WUM A;  5DLZ A;  5L97 A;  4J0R A;  4NUC A;  5EQ1 A;  5F1L A;  5CGP A;  4NR9 A;  5CQ5 A;  4NYX A;  2R0V A;  3MUL A;  3LQH A;  4AKI A;  5AD3 A;  4QC3 A;  3VKH A;  5HEN A;  4HXS A;  5IID A;  5DKH A;  4HXK A;  4QR5 A;  3HMH A;  5D3L A;  5FB1 A;  5I29 A;  5A5N A;  3ZYU A;  4NUD A;  4F3I A;  4YH4 A;  5I89 A;  1ZKR A;  4QSQ A;  3Q2E A;  4KV4 A;  5H1T A;  5HRW A;  5FFW A;  5HRX A;  4O7C A;  3G0L A;  2F6N A;  2YEL A;  3MUK A;  3O34 A;  5DKC A;  3UV2 A;  5DYA A;  4TYL A;  4QR3 A;  3UVW A;  4O76 A;  5FE0 A;  4PTB A;  1E6I A;  4NR7 A;  4IR6 A;  5EV9 A;  4Z1S A;  2FSA A;  4YBM A;  5FE9 A;  4QSR A;  2OSS A;  5LJ0 A;  5KTW A;  4O7E A;  4E96 A;  4HXL A;  5KHM A;  3RCW A;  4J3I A;  5CRM A;  5IGK A;  5FDZ A;  2N9G A;  3U5P A;  5ENB A;  4NYW A;  4LDF A;  5FFY A;  5FBX A;  3UVD A;  4IOO A;  1WUG A;  5JWM A;  5HJC A;  3SVF A;  4QSW A;  3Q2F A;  4A9L A;  3UV5 A;  4NXJ A;  5C4Q A;  4PS5 A;  4BHW A;  5L99 A;  5HM0 A;  2DVQ A;  4YAT A;  2NXB A;  4O7F A;  5CRZ A;  5ENI A;  4UIU A;  5HLS A;  5L98 A;  5ENF A;  5EA1 A;  4A9H A;  2MJV B;  4CUP A;  5EPR A;  5EWW A;  2YW5 A;  5H1U A;  3O33 A;  4QSS A;  5CQ3 A;  4YYN A;  2I8N A;  5EGU A;  4LR6 A;  2E7O A;  5CQ4 A;  4QB3 A;  4OGJ A;  5DLX A;  4ZW1 A;  5F1H A;  5LKT A;  4UYF A;  3K2J A;  4HBW A;  4A9O A;  5IG6 A;  5HQ7 A;  4QEW A;  4NRC A;  4TQN A;  5FE2 A;  3NXB A;  1X0J A;  2LSP B;  3P1D A;  2RNW A;  4YAD A;  4A9I A;  4HBV A;  5FE5 A;  2DVV A;  5E7D A;  4J0S A;  4PKL A;  5L8U A;  5F36 A;  5AME A;  4NR4 A;  4HXO A;  4A9F A;  4O77 A;  4CUS A;  4IR4 A;  4YYJ A;  1JM4 B;  5DFD A;  1F68 A;  5KTX A;  5D3T A;  5F61 A;  4A9K A; 
#chains in the Genus database with same CATH homology
 4AKN A;  5IGM A;  4GPJ A;  2RO1 A;  4PCI A;  5CUE A;  4QC1 A;  5ENG A;  3U5L A;  5EWV A;  4BJX A;  5F60 A;  5D3P A;  5DFB A;  3SVG A;  4YBS A;  4WHW A;  4TT6 A;  4NR8 A;  5F63 A;  4LYS A;  5G4R A;  5A5Q A;  5C87 A;  3JVL A;  2DVS A;  4O71 A;  4O78 A;  4TTE A;  5KTU A;  3QZS A;  2YEK A;  4TU6 A;  3S91 A;  4DON A;  5CY9 A;  5L8T A;  3I3J A;  5EIC A;  4IOR A;  5C85 A;  5LKX A;  2RI7 A;  3UV4 A;  5JI8 A;  2I7K A;  5COI A;  5EWD A;  5F3A A;  4NR5 A;  5A85 A;  4HBY A;  4MEQ A;  3LJW A;  4YY4 A;  5CQA A;  4TS8 A;  5HCL A;  3P5O A;  5FB0 A;  4ALH A;  3U5K A;  3IU6 A;  5J0D A;  5CP5 A;  3TLP A;  4XY9 A;  5II2 A;  5A5P A;  4WHU A;  4IOQ A;  5HFR A;  4LYW A;  4TU4 A;  5CFW A;  4HXN A;  4HXR A;  5E73 A;  2RNX A;  3DAI A;  2RNY A;  4LZR A;  5ETB A;  4N4G A;  4O7A A;  5C7N A;  5DYX A;  3AQA A;  5D25 A;  5ENH A;  4QNS A;  4RVR A;  4TZ2 A;  4A9E A;  5HFQ A;  5KO4 A;  2DVR A;  2L84 A;  5I7Y A;  4Z1Q A;  4NQN A;  5FG6 A;  4O72 A;  3G0J A;  2GRC A;  4LC2 A;  4YBT A;  5D3H A;  4KV1 A;  5E3D A;  5C8G A;  5TCM A;  2YEM A;  3MB3 A;  5HEL A;  2WP2 A;  4QR4 A;  5CUB A;  2OO1 A;  4IR5 A;  4ALG A;  5CUC A;  5E3G A;  5I88 A;  2WP1 A;  4QSP A;  4O75 A;  4NRA A;  4TZ8 A;  5A81 A;  5FE3 A;  2RS9 B;  3DWY A;  5KU3 A;  2KTB B;  4NYV A;  5CTL A;  4Y03 A;  4PY6 A;  4YYG A;  4UIT A;  4OUF A;  4CFK A;  4NRB A;  4CFL A;  4YK0 A;  3JVJ A;  4C66 A;  5I7X A;  5FE1 A;  5D3S A;  5ENJ A;  4QUT A;  4UIY A;  5G4S A;  3SVH A;  4KCX A;  4OGI A;  3HME A;  4N4I A;  4Q0O A;  5E9M A;  5F5Z A;  2D82 A;  2G4A A;  5LVQ A;  4CUT A;  5AMF A;  5CU8 A;  4QYL A;  4UIZ A;  5I40 A;  5FH8 A;  4NR6 A;  3P1E A;  4QZS A;  2H60 A;  4QST A;  4QEV A;  5D24 A;  5EPS A;  3LQI A;  4IR3 A;  5FG5 A;  4YYH A;  5EWC A;  4XUA A;  5FE7 A;  2DWW A;  2YQD A;  4Z6H A;  5ENC A;  5F62 A;  5FE6 A;  5LKZ A;  4UIV A;  4UYH A;  4O74 A;  4UYD A;  5A5R A;  4O7B A;  4C67 A;  3MB4 A;  4UYG A;  4QSX A;  5CQT A;  5ENE A;  5DY7 A;  3HMF A;  4HBX A;  5F2P A;  5DYU A;  5I80 A;  5CQ8 A;  5EU1 A;  5K29 A;  5E9L A;  3QZV A;  3LQJ A;  5LJ2 A;  4HXM A;  4ZQL A;  4MR4 A;  4N4H A;  4QEU A;  4YYI A;  4CUQ A;  3O36 A;  4A9J A;  4NUE A;  5A83 A;  4YY6 A;  4BW4 A;  4CUR A;  5CUD A;  5AD2 A;  5BT3 A;  5CQ6 A;  3U5M A;  4BW1 A;  4N3W A;  5D3R A;  4MR6 A;  5D0C A;  4YH3 A;  5D26 A;  5IGL A;  5HQ6 A;  4A9N A;  3AAD A;  3U5O A;  3P1C A;  5H85 A;  5FE8 A;  4ZC9 A;  2D9E A;  2L85 A;  2DAT A;  4O70 A;  4UIW A;  2YYN A;  2DKW A;  5CS8 A;  4QY4 A;  3O35 A;  1EQF A;  4A9M A;  1JSP B;  5I83 A;  2OUO A;  5TB6 A;  3P1F A;  5DX4 A;  5D7X A;  3MQM A;  2R10 A;  3QZT A;  4MR5 A;  5CUG A;  4Z93 A;  4CLB A;  2E7N A;  4XUB A;  5DBM A;  5E74 A;  3MXF A;  4MEP A;  4PCE A;  4WIV A;  5EPB A;  4BW2 A;  5BT4 A;  5A82 A;  4UYF B;  2R0Y A;  5FH7 A;  4Z6I A;  5E9K A;  2E3K A;  4XYA A;  5DW2 A;  2YDW A;  3U5N A;  5ETD A;  5CZG A;  5DKD A;  4TT4 A;  5EI4 A;  5IBN A;  3FKM X;  4MEO A;  3U5J A;  4QSV A;  5DW1 A;  3GG3 A;  5LJ1 A;  5CQ7 A;  5FH6 A;  5EM3 A;  5DYC A;  4UIX A;  5LKU A;  5E9I A;  4YYM A;  5A7C A;  3O37 A;  5A5S A;  4QSU A;  1ZS5 A;  5FE4 A;  5EWH A;  4YC9 A;  5HQ5 A;  4LRG A;  5F25 A;  4YAB A;  5EVA A;  5A5O A;  4QUU A;  5D3N A;  3IU5 A;  3UVX A;  4CL9 A;  3UVY A;  4X2I A;  5C89 A;  5BT5 A;  2RFJ A;  4LYI A;  3D7C A;  4FLP A;  5EIS A;  4N4F A;  3ONI A;  5D3J A;  5I86 A;  4QBM A;  4QYD A;  5CUA A;  2L5E A;  5II1 A;  4LZS A;  4XY8 A;  5EK9 A;  5E0R A;  4UYE A;  5HRV A;  4HXP A;  4LZ2 A;  5LVR A;  5EP7 A;  4NQM A;  5E9Y A;  5HEM A;  5ACY A;  4NS5 A;  4BW3 A;  4YYK A;  4J1P A;  4MEN A;  1N72 A;  5FG4 A;  5IGN A;  4TT2 A;  2F6J A;  5CPE A;  5FFV A;  5E9V A;  3S92 A;  4MR3 A;  4Q0N A;  4CUU A;  5DFC A;  5L96 A;  5LUU A;  2R0S A;  5H1V A;  3JVM A;  3LXJ A;  3JVK A;  4YYD A;  3UW9 A;  5I1Q A;  4YAX A;  1WUM A;  5DLZ A;  5L97 A;  4J0R A;  4NUC A;  5EQ1 A;  5F1L A;  5CGP A;  4NR9 A;  5CQ5 A;  4NYX A;  2R0V A;  3MUL A;  3LQH A;  5AD3 A;  4QC3 A;  5HEN A;  4HXS A;  5IID A;  5DKH A;  4HXK A;  4QR5 A;  3HMH A;  5D3L A;  5FB1 A;  5I29 A;  5A5N A;  3ZYU A;  4NUD A;  4F3I A;  4YH4 A;  5I89 A;  4QSQ A;  3Q2E A;  4KV4 A;  5H1T A;  5HRW A;  5FFW A;  5HRX A;  4O7C A;  3G0L A;  2F6N A;  2YEL A;  3MUK A;  3O34 A;  5DKC A;  3UV2 A;  5DYA A;  4TYL A;  4QR3 A;  3UVW A;  4O76 A;  5FE0 A;  4PTB A;  1E6I A;  4NR7 A;  4IR6 A;  5EV9 A;  4Z1S A;  2FSA A;  4YBM A;  5FE9 A;  4QSR A;  2OSS A;  5LJ0 A;  5KTW A;  4O7E A;  4E96 A;  4HXL A;  5KHM A;  3RCW A;  4J3I A;  5CRM A;  5IGK A;  5FDZ A;  2N9G A;  3U5P A;  5ENB A;  4NYW A;  4LDF A;  5FFY A;  5FBX A;  3UVD A;  4IOO A;  1WUG A;  5JWM A;  5HJC A;  3SVF A;  4QSW A;  3Q2F A;  4A9L A;  3UV5 A;  4NXJ A;  5C4Q A;  4PS5 A;  4BHW A;  5L99 A;  5HM0 A;  2DVQ A;  4YAT A;  2NXB A;  4O7F A;  5CRZ A;  5ENI A;  4UIU A;  5HLS A;  5L98 A;  5ENF A;  5EA1 A;  4A9H A;  2MJV B;  4CUP A;  5EPR A;  5EWW A;  2YW5 A;  5H1U A;  3O33 A;  4QSS A;  5CQ3 A;  4YYN A;  2I8N A;  5EGU A;  4LR6 A;  2E7O A;  5CQ4 A;  4QB3 A;  4OGJ A;  5DLX A;  4ZW1 A;  5F1H A;  5LKT A;  4UYF A;  3K2J A;  4HBW A;  4A9O A;  5IG6 A;  5HQ7 A;  4QEW A;  4NRC A;  4TQN A;  5FE2 A;  3NXB A;  1X0J A;  2LSP B;  3P1D A;  2RNW A;  4YAD A;  4A9I A;  4HBV A;  5FE5 A;  2DVV A;  5E7D A;  4J0S A;  4PKL A;  5L8U A;  5F36 A;  5AME A;  4NR4 A;  4HXO A;  4A9F A;  4O77 A;  4CUS A;  4IR4 A;  4YYJ A;  1JM4 B;  5DFD A;  1F68 A;  5KTX A;  5D3T A;  5F61 A;  4A9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...