5DKHA

Crystal structure of the bromodomain of human brm (smarca2) in complex with a hydroxyphenyl propenone inhibitor 17
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
116
structure length
116
Chain Sequence
SPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Probable global transcription activator SNF2L2
publication title Crystal structure of the bromodomain of human BRM (SMARCA2) in complex with a hydroxyphenyl propenone inhibitor 17
rcsb
source organism Homo sapiens
total genus 40
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature ec 3.6.4.-:
pdb deposition date 2015-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5dkhA00
5HEMA 3UW9A 5D3SA 5EM3A 5CUCA 2RFJA 4NYXA 5CGPA 5D3HA 4NQMA 4N4HA 5E9YA 5EK9A 4O71A 5LVRA 3JVMA 5LKUA 3LXJA 4O72A 5DFDA 3MB3A 5E3GA 4O74A 2DVRA 5KO4A 4QSQA 5HRXA 4UIYA 2I8NA 5DY7A 4UYFA 4LDFA 4QSTA 4N3WA 3SVGA 4NRBA 5C7NA 5D0CA 2OSSA 5CQ3A 5LKTA 5DKHA 5I29A 3LQJA 4HXSA 5CQ6A 5HQ5A 4IR4A 5CTLA 4CFLA 3LQHA 5LJ1A 5COIA 4PS5A 5KTWA 3QZSA 4Z6HA 5FG4A 4UIZA 5CQ8A 5DW1A 4YH4A 5BT5A 3QZVA 3S92A 3NXBA 2LSPB 4O7BA 5EPSA 5HELA 4NR8A 3MQMA 4CFKA 5JI8A 4A9MA 4NXJA 2DVVA 2E3KA 5A7CA 5LKXA 5FE7A 3U5LA 4QR3A 5AD3A 3FKMX 2MJVB 2YELA 5CQ7A 3LJWA 5F1HA 5HFRA 4YABA 3MULA 2YDWA 1F68A 3UV2A 5FE3A 4WHUA 3ONIA 4O77A 3RCWA 3SVHA 3P1EA 5C89A 5E9LA 3IU6A 4LZRA 4QC3A 5FE9A 3P1CA 5FE2A 5E7DA 4QY4A 4NR7A 5A83A 2R0VA 1JSPB 4A9IA 3O37A 5FDZA 4YBSA 4OUFA 5ENFA 4O7FA 3P5OA 5FH6A 5LJ2A 1WUMA 4TT6A 4TZ2A 3MXFA 5DBMA 4CURA 5KTXA 4AKNA 5CS8A 4O7AA 4MR4A 5FH8A 5E9VA 5L99A 4QC1A 3O36A 2D82A 4QYDA 5EWDA 5E0RA 4NQNA 5D7XA 3K2JA 4QR4A 4NRAA 4BJXA 4UYEA 5CUBA 4CUTA 5D3PA 4QNSA 5IG6A 5CU8A 5II2A 2I7KA 2RS9B 3QZTA 3P1DA 5L8TA 3D7CA 5E3DA 4HXPA 3U5JA 4Z1QA 4HXRA 5IGKA 1ZS5A 2DATA 5DKCA 4TQNA 5ENBA 2D9EA 4UYDA 4XUAA 3UV5A 4A9NA 3UVDA 5DFCA 4QSRA 3Q2EA 5F3AA 3S91A 5ENEA 4LRGA 4NR5A 2DVQA 4NS5A 4A9FA 5EWHA 4YYJA 4HXOA 4QSVA 4UIWA 5L98A 4HBVA 5KTUA 5A5RA 2F6NA 3JVKA 4O7EA 5IIDA 2DWWA 3MUKA 2E7NA 4PKLA 4PTBA 3IU5A 4BW1A 2RNWA 5HFQA 3JVJA 3UVXA 2OO1A 5FE0A 2KTBB 4TTEA 4Y03A 3U5PA 3JVLA 5FG5A 1JM4B 5EA1A 5KHMA 5D3LA 2WP2A 4MR5A 3O33A 4IR3A 4PCEA 5D3RA 5DFBA 2H60A 4O7CA 4ZW1A 4A9JA 5EU1A 5FB0A 5HRWA 4XY8A 2YYNA 4YY4A 1WUGA 2GRCA 4YYKA 5I86A 4MR3A 3UV4A 5G4RA 4Q0OA 5C4QA 5DYXA 5D3TA 5A5OA 4NR4A 2R0YA 4YY6A 5ETDA 4XY9A 5H1UA 4YATA 5E9MA 5CUEA 5IGLA 3TLPA 5EI4A 5CQ5A 5A5QA 5E73A 4OGIA 5F25A 4ZQLA 4J3IA 4RVRA 5A5SA 4Z6IA 5F2PA 4CUQA 5ACYA 5FH7A 4A9LA 4Z93A 2E7OA 5E9KA 4BW3A 5EVAA 5H1TA 5I7YA 2L5EA 5TB6A 3DAIA 5EWCA 4NUEA 5EPRA 5D3JA 4YADA 5FFYA 4O76A 4ZC9A 5FE4A 2R10A 5BT3A 4QUTA 4BW4A 4CLBA 5HJCA 4GPJA 1EQFA 2N9GA 5I83A 2OUOA 4O78A 4MEQA 4UYHA 5F5ZA 1E6IA 4IR6A 5I7XA 4QSSA 4J0SA 4YYIA 5H1VA 4A9KA 5CQAA 5AMFA 4LR6A 5HQ6A 4HBXA 3LQIA 5DKDA 5F60A 4MENA 5ETBA 5CRZA 4FLPA 4HXKA 4Z1SA 4YBMA 2FSAA 5FE8A 2WP1A 4TYLA 5HM0A 4KV4A 2DKWA 5CZGA 2RNXA 2L85A 5A82A 4N4FA 5J0DA 4NR6A 5E9IA 4C66A 4O70A 4WIVA 5A85A 4IOQA 4Q0NA 4A9HA 4N4IA 4BHWA 5E74A 1N72A 5EICA 4QBMA 4YYDA 5DX4A 4UITA 5A81A 4NYWA 5CPEA 5DYUA 5CUAA 5D26A 5I88A 5IGNA 5HENA 5I80A 4TT4A 5F63A 5K29A 5FFWA 3U5OA 5CUDA 5L96A 4QSPA 4QB3A 4BW2A 5AD2A 4LYIA 4MEOA 4O75A 4TU4A 2RO1A 5EV9A 4KCXA 4CUUA 5LKZA 2L84A 4X2IA 5CUGA 5D3NA 2RI7A 3U5NA 4PY6A 5DLXA 4A9EA 5DYAA 5F36A 5EGUA 5F1LA 2DVSA 2YQDA 5EWWA 5LUUA 4HXMA 3DWYA 5KU3A 5EP7A 5CQ4A 5L8UA 4QR5A 3U5MA 5CY9A 2G4AA 4A9OA 4E96A 4C67A 3HMFA 5ENJA 1X0JA 4TU6A 5F62A 5C85A 4J0RA 5A5NA 3P1FA 4TS8A 4QZSA 3GG3A 2RNYA 5DLZA 5FG6A 5LVQA 4ALGA 4XYAA 4LZSA 4LC2A 3O35A 4HBWA 4UYGA 5AMEA 5ENHA 5HRVA 4QSWA 4KV1A 4CUSA 4QEUA 3G0JA 4CL9A 4WHWA 4NUCA 5EQ1A 5FE5A 2F6JA 5L97A 4NR9A 3HMHA 5FE1A 5I40A 4QYLA 3U5KA 4YK0A 4ALHA 4IOOA 5II1A 4YYHA 5FBXA 4TZ8A 5FFVA 2NXBA 4YAXA 5D24A 3HMEA 4YC9A 4HBYA 4QSUA 4N4GA 5EPBA 5ENGA 4NYVA 3SVFA 4F3IA 5A5PA 4HXNA 5DYCA 4XUBA 4LYWA 4YH3A 4QEVA 5EISA 4LZ2A 2YW5A 3O34A 5I89A 3ZYUA 5G4SA 5FB1A 4YYMA 3UVWA 3G0LA 3UVYA 3Q2FA 4J1PA 5IBNA 4CUPA 3MB4A 5TCMA 4LYSA 4YYGA 5HCLA 2YEMA 4QSXA 5CP5A 4YBTA 5HLSA 5IGMA 5DW2A 5CFWA 4QUUA 5ENIA 5FE6A 5LJ0A 4OGJA 4DONA 4QEWA 5C87A 5F61A 4HXLA 4IORA 4MR6A 5C8GA 4NUDA 4YYNA 5CRMA 5EWVA 4UIVA 3AQAA 2R0SA 3AADA 4IR5A 4TT2A 5H85A 5I1QA 4NRCA 5JWMA 3I3JA 4UIUA 5CQTA 5BT4A 2YEKA 5D25A 4PCIA 4UYFB 5ENCA 4MEPA 5HQ7A 4UIXA
chains in the Genus database with same CATH superfamily
5HEMA 3UW9A 5D3SA 5EM3A 5CUCA 2RFJA 4NYXA 5CGPA 5D3HA 4NQMA 4N4HA 5E9YA 5EK9A 4O71A 5LVRA 3JVMA 5LKUA 3LXJA 4O72A 5DFDA 3MB3A 5E3GA 4O74A 2DVRA 5KO4A 4QSQA 5HRXA 4UIYA 2I8NA 5DY7A 4UYFA 4LDFA 4AKIA 4QSTA 4N3WA 3SVGA 4NRBA 5C7NA 5D0CA 2OSSA 5CQ3A 5LKTA 5DKHA 5I29A 3LQJA 1ZKRA 4HXSA 5CQ6A 5HQ5A 4IR4A 5CTLA 4CFLA 3LQHA 2EJNA 5LJ1A 5COIA 4PS5A 5KTWA 3QZSA 4Z6HA 5FG4A 4UIZA 5CQ8A 5DW1A 4YH4A 5BT5A 3QZVA 3S92A 3NXBA 2LSPB 4O7BA 5EPSA 5HELA 4NR8A 3MQMA 4CFKA 5JI8A 4A9MA 4NXJA 2DVVA 2E3KA 5A7CA 5LKXA 5FE7A 3U5LA 4QR3A 5AD3A 3FKMX 2MJVB 2YELA 5CQ7A 3LJWA 5F1HA 5HFRA 4YABA 3MULA 2YDWA 1F68A 3UV2A 5FE3A 4WHUA 3ONIA 4O77A 3RCWA 4AKHA 3SVHA 3P1EA 5C89A 5E9LA 3IU6A 4LZRA 4QC3A 5FE9A 3P1CA 5FE2A 5E7DA 4QY4A 4NR7A 5A83A 2R0VA 1JSPB 4A9IA 3O37A 5FDZA 4YBSA 4OUFA 5ENFA 4O7FA 3P5OA 5FH6A 3D1BA 5LJ2A 1WUMA 4TT6A 4TZ2A 3MXFA 5DBMA 4CURA 5KTXA 4AKNA 5CS8A 4O7AA 4MR4A 5FH8A 5E9VA 5L99A 4QC1A 3O36A 2D82A 4QYDA 5EWDA 5E0RA 4NQNA 5D7XA 3K2JA 4QR4A 4NRAA 4BJXA 4UYEA 5CUBA 4CUTA 5D3PA 4QNSA 5IG6A 5CU8A 5II2A 2I7KA 2RS9B 3QZTA 3P1DA 5L8TA 3D7CA 5E3DA 4HXPA 3U5JA 4Z1QA 4HXRA 5IGKA 1ZS5A 2DATA 5DKCA 4TQNA 5ENBA 2D9EA 4UYDA 4XUAA 3UV5A 4A9NA 3UVDA 5DFCA 4QSRA 3Q2EA 5F3AA 3S91A 5ENEA 4LRGA 4NR5A 2DVQA 4NS5A 4A9FA 5EWHA 4YYJA 4HXOA 4QSVA 4UIWA 5L98A 4HBVA 5KTUA 5A5RA 2F6NA 3JVKA 4O7EA 5IIDA 2DWWA 3MUKA 2E7NA 4PKLA 4PTBA 3IU5A 4BW1A 2RNWA 5HFQA 3JVJA 3UVXA 2OO1A 5FE0A 2KTBB 4TTEA 4Y03A 3U5PA 3JVLA 5FG5A 1JM4B 5EA1A 5KHMA 3D1DA 5D3LA 2WP2A 4MR5A 3O33A 4IR3A 4PCEA 5D3RA 5DFBA 2H60A 4O7CA 4ZW1A 4A9JA 5EU1A 5FB0A 5HRWA 4XY8A 2YYNA 4YY4A 1WUGA 2GRCA 4YYKA 5I86A 4MR3A 3UV4A 5G4RA 4Q0OA 5C4QA 5DYXA 5D3TA 3VKHA 5A5OA 4NR4A 3ERRA 2R0YA 4YY6A 5ETDA 4XY9A 5H1UA 4YATA 5E9MA 5CUEA 5IGLA 3TLPA 5EI4A 5CQ5A 5A5QA 5E73A 4OGIA 5F25A 4ZQLA 4J3IA 4RVRA 5A5SA 4Z6IA 5F2PA 4CUQA 5ACYA 5FH7A 4A9LA 4Z93A 2E7OA 5E9KA 4BW3A 5EVAA 5H1TA 5I7YA 2L5EA 5TB6A 3DAIA 5EWCA 4NUEA 5EPRA 5D3JA 4YADA 5FFYA 4O76A 4ZC9A 5FE4A 2R10A 5BT3A 4QUTA 4BW4A 4CLBA 5HJCA 4GPJA 1EQFA 2N9GA 5I83A 2OUOA 4O78A 4MEQA 4UYHA 5F5ZA 1E6IA 4IR6A 5I7XA 4QSSA 4J0SA 4YYIA 5H1VA 4A9KA 5CQAA 5AMFA 4LR6A 5HQ6A 4HBXA 3LQIA 5DKDA 5F60A 4MENA 5ETBA 5CRZA 4FLPA 4HXKA 4Z1SA 4YBMA 2FSAA 5FE8A 2WP1A 4TYLA 5HM0A 4KV4A 2DKWA 5CZGA 2RNXA 2L85A 5A82A 4N4FA 5J0DA 4NR6A 5E9IA 4C66A 4O70A 4WIVA 5A85A 4IOQA 4Q0NA 4A9HA 4N4IA 4BHWA 5E74A 1N72A 5EICA 4QBMA 4YYDA 5DX4A 4UITA 5A81A 4NYWA 5CPEA 5DYUA 5CUAA 5D26A 5I88A 5IGNA 5HENA 5I80A 4TT4A 5F63A 5K29A 5FFWA 3U5OA 5CUDA 5L96A 4QSPA 4QB3A 4BW2A 5AD2A 4LYIA 4MEOA 4O75A 4TU4A 2RO1A 5EV9A 4KCXA 4CUUA 5LKZA 2L84A 4X2IA 5CUGA 5D3NA 2RI7A 3U5NA 4PY6A 5DLXA 4A9EA 5DYAA 5F36A 5EGUA 5F1LA 2DVSA 2YQDA 5EWWA 5LUUA 4HXMA 3DWYA 5KU3A 5EP7A 5CQ4A 5L8UA 4QR5A 3U5MA 5CY9A 2G4AA 4A9OA 4E96A 4C67A 3HMFA 5ENJA 1X0JA 4TU6A 5F62A 5C85A 4J0RA 5A5NA 3P1FA 4TS8A 4QZSA 3GG3A 2RNYA 5DLZA 5FG6A 5LVQA 4ALGA 4XYAA 4LZSA 4LC2A 3O35A 4HBWA 4UYGA 5AMEA 5ENHA 5HRVA 4QSWA 4KV1A 4CUSA 4QEUA 3G0JA 4CL9A 4WHWA 4NUCA 5EQ1A 5FE5A 2F6JA 5L97A 4NR9A 3HMHA 5FE1A 1PUOA 5I40A 4QYLA 4AI6A 3U5KA 4YK0A 4ALHA 4IOOA 5II1A 4YYHA 5FBXA 4TZ8A 5FFVA 2NXBA 4YAXA 5D24A 3HMEA 4YC9A 4HBYA 4QSUA 4N4GA 5EPBA 5ENGA 4NYVA 3SVFA 4F3IA 5A5PA 4HXNA 5DYCA 4XUBA 4LYWA 4YH3A 4QEVA 5EISA 4LZ2A 2YW5A 3O34A 5I89A 3ZYUA 5G4SA 5FB1A 4YYMA 3UVWA 3G0LA 3UVYA 3VKGA 3Q2FA 4J1PA 5IBNA 4CUPA 3MB4A 5TCMA 4LYSA 4YYGA 5HCLA 2YEMA 4QSXA 5CP5A 4YBTA 5HLSA 5IGMA 5DW2A 5CFWA 4QUUA 5ENIA 4AKGA 5FE6A 5LJ0A 4OGJA 4DONA 4QEWA 5C87A 5F61A 4HXLA 4IORA 4MR6A 5C8GA 4NUDA 4YYNA 5CRMA 5EWVA 4UIVA 3AQAA 2R0SA 3AADA 4IR5A 4TT2A 5H85A 5I1QA 4NRCA 5JWMA 3I3JA 4UIUA 5CQTA 5BT4A 2YEKA 5D25A 4PCIA 4UYFB 5ENCA 4MEPA 5HQ7A 4UIXA
chains in the Genus database with same CATH topology
5HEMA 3UW9A 5D3SA 5EM3A 5CUCA 2RFJA 4NYXA 5CGPA 5D3HA 4NQMA 4N4HA 5E9YA 5EK9A 4O71A 5LVRA 3JVMA 5LKUA 3LXJA 4O72A 5DFDA 3MB3A 5E3GA 4O74A 2DVRA 5KO4A 4QSQA 5HRXA 4UIYA 2I8NA 5DY7A 4UYFA 4LDFA 4QSTA 4N3WA 3SVGA 4NRBA 5C7NA 5D0CA 2OSSA 5CQ3A 5LKTA 5DKHA 5I29A 3LQJA 4HXSA 5CQ6A 5HQ5A 4IR4A 5CTLA 4CFLA 3LQHA 5LJ1A 5COIA 4PS5A 5KTWA 3QZSA 4Z6HA 5FG4A 4UIZA 5CQ8A 5DW1A 4YH4A 5BT5A 3QZVA 3S92A 3NXBA 2LSPB 4O7BA 5EPSA 5HELA 4NR8A 3MQMA 4CFKA 5JI8A 4A9MA 4NXJA 2DVVA 2E3KA 5A7CA 5LKXA 5FE7A 3U5LA 4QR3A 5AD3A 3FKMX 2MJVB 2YELA 5CQ7A 3LJWA 5F1HA 5HFRA 4YABA 3MULA 2YDWA 1F68A 3UV2A 5FE3A 4WHUA 3ONIA 4O77A 3RCWA 3SVHA 3P1EA 5C89A 5E9LA 3IU6A 4LZRA 4QC3A 5FE9A 3P1CA 5FE2A 5E7DA 4QY4A 4NR7A 5A83A 2R0VA 1JSPB 4A9IA 3O37A 5FDZA 4YBSA 4OUFA 5ENFA 4O7FA 3P5OA 5FH6A 5LJ2A 1WUMA 4TT6A 4TZ2A 3MXFA 5DBMA 4CURA 5KTXA 4AKNA 5CS8A 4O7AA 4MR4A 5FH8A 5E9VA 5L99A 4QC1A 3O36A 2D82A 4QYDA 5EWDA 5E0RA 4NQNA 5D7XA 3K2JA 4QR4A 4NRAA 4BJXA 4UYEA 5CUBA 4CUTA 5D3PA 4QNSA 5IG6A 5CU8A 5II2A 2I7KA 2RS9B 3QZTA 3P1DA 5L8TA 3D7CA 5E3DA 4HXPA 3U5JA 4Z1QA 4HXRA 5IGKA 1ZS5A 2DATA 5DKCA 4TQNA 5ENBA 2D9EA 4UYDA 4XUAA 3UV5A 4A9NA 3UVDA 5DFCA 4QSRA 3Q2EA 5F3AA 3S91A 5ENEA 4LRGA 4NR5A 2DVQA 4NS5A 4A9FA 5EWHA 4YYJA 4HXOA 4QSVA 4UIWA 5L98A 4HBVA 5KTUA 5A5RA 2F6NA 3JVKA 4O7EA 5IIDA 2DWWA 3MUKA 2E7NA 4PKLA 4PTBA 3IU5A 4BW1A 2RNWA 5HFQA 3JVJA 3UVXA 2OO1A 5FE0A 2KTBB 4TTEA 4Y03A 3U5PA 3JVLA 5FG5A 1JM4B 5EA1A 5KHMA 5D3LA 2WP2A 4MR5A 3O33A 4IR3A 4PCEA 5D3RA 5DFBA 2H60A 4O7CA 4ZW1A 4A9JA 5EU1A 5FB0A 5HRWA 4XY8A 2YYNA 4YY4A 1WUGA 2GRCA 4YYKA 5I86A 4MR3A 3UV4A 5G4RA 4Q0OA 5C4QA 5DYXA 5D3TA 5A5OA 4NR4A 2R0YA 4YY6A 5ETDA 4XY9A 5H1UA 4YATA 5E9MA 5CUEA 5IGLA 3TLPA 5EI4A 5CQ5A 5A5QA 5E73A 4OGIA 5F25A 4ZQLA 4J3IA 4RVRA 5A5SA 4Z6IA 5F2PA 4CUQA 5ACYA 5FH7A 4A9LA 4Z93A 2E7OA 5E9KA 4BW3A 5EVAA 5H1TA 5I7YA 2L5EA 5TB6A 3DAIA 5EWCA 4NUEA 5EPRA 5D3JA 4YADA 5FFYA 4O76A 4ZC9A 5FE4A 2R10A 5BT3A 4QUTA 4BW4A 4CLBA 5HJCA 4GPJA 1EQFA 2N9GA 5I83A 2OUOA 4O78A 4MEQA 4UYHA 5F5ZA 1E6IA 4IR6A 5I7XA 4QSSA 4J0SA 4YYIA 5H1VA 4A9KA 5CQAA 5AMFA 4LR6A 5HQ6A 4HBXA 3LQIA 5DKDA 5F60A 4MENA 5ETBA 5CRZA 4FLPA 4HXKA 4Z1SA 4YBMA 2FSAA 5FE8A 2WP1A 4TYLA 5HM0A 4KV4A 2DKWA 5CZGA 2RNXA 2L85A 5A82A 4N4FA 5J0DA 4NR6A 5E9IA 4C66A 4O70A 4WIVA 5A85A 4IOQA 4Q0NA 4A9HA 4N4IA 4BHWA 5E74A 1N72A 5EICA 4QBMA 4YYDA 5DX4A 4UITA 5A81A 4NYWA 5CPEA 5DYUA 5CUAA 5D26A 5I88A 5IGNA 5HENA 5I80A 4TT4A 5F63A 5K29A 5FFWA 3U5OA 5CUDA 5L96A 4QSPA 4QB3A 4BW2A 5AD2A 4LYIA 4MEOA 4O75A 4TU4A 2RO1A 5EV9A 4KCXA 4CUUA 5LKZA 2L84A 4X2IA 5CUGA 5D3NA 2RI7A 3U5NA 4PY6A 5DLXA 4A9EA 5DYAA 5F36A 5EGUA 5F1LA 2DVSA 2YQDA 5EWWA 5LUUA 4HXMA 3DWYA 5KU3A 5EP7A 5CQ4A 5L8UA 4QR5A 3U5MA 5CY9A 2G4AA 4A9OA 4E96A 4C67A 3HMFA 5ENJA 1X0JA 4TU6A 5F62A 5C85A 4J0RA 5A5NA 3P1FA 4TS8A 4QZSA 3GG3A 2RNYA 5DLZA 5FG6A 5LVQA 4ALGA 4XYAA 4LZSA 4LC2A 3O35A 4HBWA 4UYGA 5AMEA 5ENHA 5HRVA 4QSWA 4KV1A 4CUSA 4QEUA 3G0JA 4CL9A 4WHWA 4NUCA 5EQ1A 5FE5A 2F6JA 5L97A 4NR9A 3HMHA 5FE1A 5I40A 4QYLA 3U5KA 4YK0A 4ALHA 4IOOA 5II1A 4YYHA 5FBXA 4TZ8A 5FFVA 2NXBA 4YAXA 5D24A 3HMEA 4YC9A 4HBYA 4QSUA 4N4GA 5EPBA 5ENGA 4NYVA 3SVFA 4F3IA 5A5PA 4HXNA 5DYCA 4XUBA 4LYWA 4YH3A 4QEVA 5EISA 4LZ2A 2YW5A 3O34A 5I89A 3ZYUA 5G4SA 5FB1A 4YYMA 3UVWA 3G0LA 3UVYA 3Q2FA 4J1PA 5IBNA 4CUPA 3MB4A 5TCMA 4LYSA 4YYGA 5HCLA 2YEMA 4QSXA 5CP5A 4YBTA 5HLSA 5IGMA 5DW2A 5CFWA 4QUUA 5ENIA 5FE6A 5LJ0A 4OGJA 4DONA 4QEWA 5C87A 5F61A 4HXLA 4IORA 4MR6A 5C8GA 4NUDA 4YYNA 5CRMA 5EWVA 4UIVA 3AQAA 2R0SA 3AADA 4IR5A 4TT2A 5H85A 5I1QA 4NRCA 5JWMA 3I3JA 4UIUA 5CQTA 5BT4A 2YEKA 5D25A 4PCIA 4UYFB 5ENCA 4MEPA 5HQ7A 4UIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEM A;  3UW9 A;  5D3S A;  5EM3 A;  5CUC A;  2RFJ A;  4NYX A;  5CGP A;  5D3H A;  4NQM A;  4N4H A;  5E9Y A;  5EK9 A;  4O71 A;  5LVR A;  3JVM A;  5LKU A;  3LXJ A;  4O72 A;  5DFD A;  3MB3 A;  5E3G A;  4O74 A;  2DVR A;  5KO4 A;  4QSQ A;  5HRX A;  4UIY A;  2I8N A;  5DY7 A;  4UYF A;  4LDF A;  4QST A;  4N3W A;  3SVG A;  4NRB A;  5C7N A;  5D0C A;  2OSS A;  5CQ3 A;  5LKT A;  5DKH A;  5I29 A;  3LQJ A;  4HXS A;  5CQ6 A;  5HQ5 A;  4IR4 A;  5CTL A;  4CFL A;  3LQH A;  5LJ1 A;  5COI A;  4PS5 A;  5KTW A;  3QZS A;  4Z6H A;  5FG4 A;  4UIZ A;  5CQ8 A;  5DW1 A;  4YH4 A;  5BT5 A;  3QZV A;  3S92 A;  3NXB A;  2LSP B;  4O7B A;  5EPS A;  5HEL A;  4NR8 A;  3MQM A;  4CFK A;  5JI8 A;  4A9M A;  4NXJ A;  2DVV A;  2E3K A;  5A7C A;  5LKX A;  5FE7 A;  3U5L A;  4QR3 A;  5AD3 A;  3FKM X;  2MJV B;  2YEL A;  5CQ7 A;  3LJW A;  5F1H A;  5HFR A;  4YAB A;  3MUL A;  2YDW A;  1F68 A;  3UV2 A;  5FE3 A;  4WHU A;  3ONI A;  4O77 A;  3RCW A;  3SVH A;  3P1E A;  5C89 A;  5E9L A;  3IU6 A;  4LZR A;  4QC3 A;  5FE9 A;  3P1C A;  5FE2 A;  5E7D A;  4QY4 A;  4NR7 A;  5A83 A;  2R0V A;  1JSP B;  4A9I A;  3O37 A;  5FDZ A;  4YBS A;  4OUF A;  5ENF A;  4O7F A;  3P5O A;  5FH6 A;  5LJ2 A;  1WUM A;  4TT6 A;  4TZ2 A;  3MXF A;  5DBM A;  4CUR A;  5KTX A;  4AKN A;  5CS8 A;  4O7A A;  4MR4 A;  5FH8 A;  5E9V A;  5L99 A;  4QC1 A;  3O36 A;  2D82 A;  4QYD A;  5EWD A;  5E0R A;  4NQN A;  5D7X A;  3K2J A;  4QR4 A;  4NRA A;  4BJX A;  4UYE A;  5CUB A;  4CUT A;  5D3P A;  4QNS A;  5IG6 A;  5CU8 A;  5II2 A;  2I7K A;  2RS9 B;  3QZT A;  3P1D A;  5L8T A;  3D7C A;  5E3D A;  4HXP A;  3U5J A;  4Z1Q A;  4HXR A;  5IGK A;  1ZS5 A;  2DAT A;  5DKC A;  4TQN A;  5ENB A;  2D9E A;  4UYD A;  4XUA A;  3UV5 A;  4A9N A;  3UVD A;  5DFC A;  4QSR A;  3Q2E A;  5F3A A;  3S91 A;  5ENE A;  4LRG A;  4NR5 A;  2DVQ A;  4NS5 A;  4A9F A;  5EWH A;  4YYJ A;  4HXO A;  4QSV A;  4UIW A;  5L98 A;  4HBV A;  5KTU A;  5A5R A;  2F6N A;  3JVK A;  4O7E A;  5IID A;  2DWW A;  3MUK A;  2E7N A;  4PKL A;  4PTB A;  3IU5 A;  4BW1 A;  2RNW A;  5HFQ A;  3JVJ A;  3UVX A;  2OO1 A;  5FE0 A;  2KTB B;  4TTE A;  4Y03 A;  3U5P A;  3JVL A;  5FG5 A;  1JM4 B;  5EA1 A;  5KHM A;  5D3L A;  2WP2 A;  4MR5 A;  3O33 A;  4IR3 A;  4PCE A;  5D3R A;  5DFB A;  2H60 A;  4O7C A;  4ZW1 A;  4A9J A;  5EU1 A;  5FB0 A;  5HRW A;  4XY8 A;  2YYN A;  4YY4 A;  1WUG A;  2GRC A;  4YYK A;  5I86 A;  4MR3 A;  3UV4 A;  5G4R A;  4Q0O A;  5C4Q A;  5DYX A;  5D3T A;  5A5O A;  4NR4 A;  2R0Y A;  4YY6 A;  5ETD A;  4XY9 A;  5H1U A;  4YAT A;  5E9M A;  5CUE A;  5IGL A;  3TLP A;  5EI4 A;  5CQ5 A;  5A5Q A;  5E73 A;  4OGI A;  5F25 A;  4ZQL A;  4J3I A;  4RVR A;  5A5S A;  4Z6I A;  5F2P A;  4CUQ A;  5ACY A;  5FH7 A;  4A9L A;  4Z93 A;  2E7O A;  5E9K A;  4BW3 A;  5EVA A;  5H1T A;  5I7Y A;  2L5E A;  5TB6 A;  3DAI A;  5EWC A;  4NUE A;  5EPR A;  5D3J A;  4YAD A;  5FFY A;  4O76 A;  4ZC9 A;  5FE4 A;  2R10 A;  5BT3 A;  4QUT A;  4BW4 A;  4CLB A;  5HJC A;  4GPJ A;  1EQF A;  2N9G A;  5I83 A;  2OUO A;  4O78 A;  4MEQ A;  4UYH A;  5F5Z A;  1E6I A;  4IR6 A;  5I7X A;  4QSS A;  4J0S A;  4YYI A;  5H1V A;  4A9K A;  5CQA A;  5AMF A;  4LR6 A;  5HQ6 A;  4HBX A;  3LQI A;  5DKD A;  5F60 A;  4MEN A;  5ETB A;  5CRZ A;  4FLP A;  4HXK A;  4Z1S A;  4YBM A;  2FSA A;  5FE8 A;  2WP1 A;  4TYL A;  5HM0 A;  4KV4 A;  2DKW A;  5CZG A;  2RNX A;  2L85 A;  5A82 A;  4N4F A;  5J0D A;  4NR6 A;  5E9I A;  4C66 A;  4O70 A;  4WIV A;  5A85 A;  4IOQ A;  4Q0N A;  4A9H A;  4N4I A;  4BHW A;  5E74 A;  1N72 A;  5EIC A;  4QBM A;  4YYD A;  5DX4 A;  4UIT A;  5A81 A;  4NYW A;  5CPE A;  5DYU A;  5CUA A;  5D26 A;  5I88 A;  5IGN A;  5HEN A;  5I80 A;  4TT4 A;  5F63 A;  5K29 A;  5FFW A;  3U5O A;  5CUD A;  5L96 A;  4QSP A;  4QB3 A;  4BW2 A;  5AD2 A;  4LYI A;  4MEO A;  4O75 A;  4TU4 A;  2RO1 A;  5EV9 A;  4KCX A;  4CUU A;  5LKZ A;  2L84 A;  4X2I A;  5CUG A;  5D3N A;  2RI7 A;  3U5N A;  4PY6 A;  5DLX A;  4A9E A;  5DYA A;  5F36 A;  5EGU A;  5F1L A;  2DVS A;  2YQD A;  5EWW A;  5LUU A;  4HXM A;  3DWY A;  5KU3 A;  5EP7 A;  5CQ4 A;  5L8U A;  4QR5 A;  3U5M A;  5CY9 A;  2G4A A;  4A9O A;  4E96 A;  4C67 A;  3HMF A;  5ENJ A;  1X0J A;  4TU6 A;  5F62 A;  5C85 A;  4J0R A;  5A5N A;  3P1F A;  4TS8 A;  4QZS A;  3GG3 A;  2RNY A;  5DLZ A;  5FG6 A;  5LVQ A;  4ALG A;  4XYA A;  4LZS A;  4LC2 A;  3O35 A;  4HBW A;  4UYG A;  5AME A;  5ENH A;  5HRV A;  4QSW A;  4KV1 A;  4CUS A;  4QEU A;  3G0J A;  4CL9 A;  4WHW A;  4NUC A;  5EQ1 A;  5FE5 A;  2F6J A;  5L97 A;  4NR9 A;  3HMH A;  5FE1 A;  5I40 A;  4QYL A;  3U5K A;  4YK0 A;  4ALH A;  4IOO A;  5II1 A;  4YYH A;  5FBX A;  4TZ8 A;  5FFV A;  2NXB A;  4YAX A;  5D24 A;  3HME A;  4YC9 A;  4HBY A;  4QSU A;  4N4G A;  5EPB A;  5ENG A;  4NYV A;  3SVF A;  4F3I A;  5A5P A;  4HXN A;  5DYC A;  4XUB A;  4LYW A;  4YH3 A;  4QEV A;  5EIS A;  4LZ2 A;  2YW5 A;  3O34 A;  5I89 A;  3ZYU A;  5G4S A;  5FB1 A;  4YYM A;  3UVW A;  3G0L A;  3UVY A;  3Q2F A;  4J1P A;  5IBN A;  4CUP A;  3MB4 A;  5TCM A;  4LYS A;  4YYG A;  5HCL A;  2YEM A;  4QSX A;  5CP5 A;  4YBT A;  5HLS A;  5IGM A;  5DW2 A;  5CFW A;  4QUU A;  5ENI A;  5FE6 A;  5LJ0 A;  4OGJ A;  4DON A;  4QEW A;  5C87 A;  5F61 A;  4HXL A;  4IOR A;  4MR6 A;  5C8G A;  4NUD A;  4YYN A;  5CRM A;  5EWV A;  4UIV A;  3AQA A;  2R0S A;  3AAD A;  4IR5 A;  4TT2 A;  5H85 A;  5I1Q A;  4NRC A;  5JWM A;  3I3J A;  4UIU A;  5CQT A;  5BT4 A;  2YEK A;  5D25 A;  4PCI A;  4UYF B;  5ENC A;  4MEP A;  5HQ7 A;  4UIX A; 
#chains in the Genus database with same CATH topology
 5HEM A;  3UW9 A;  5D3S A;  5EM3 A;  5CUC A;  2RFJ A;  4NYX A;  5CGP A;  5D3H A;  4NQM A;  4N4H A;  5E9Y A;  5EK9 A;  4O71 A;  5LVR A;  3JVM A;  5LKU A;  3LXJ A;  4O72 A;  5DFD A;  3MB3 A;  5E3G A;  4O74 A;  2DVR A;  5KO4 A;  4QSQ A;  5HRX A;  4UIY A;  2I8N A;  5DY7 A;  4UYF A;  4LDF A;  4AKI A;  4QST A;  4N3W A;  3SVG A;  4NRB A;  5C7N A;  5D0C A;  2OSS A;  5CQ3 A;  5LKT A;  5DKH A;  5I29 A;  3LQJ A;  1ZKR A;  4HXS A;  5CQ6 A;  5HQ5 A;  4IR4 A;  5CTL A;  4CFL A;  3LQH A;  2EJN A;  5LJ1 A;  5COI A;  4PS5 A;  5KTW A;  3QZS A;  4Z6H A;  5FG4 A;  4UIZ A;  5CQ8 A;  5DW1 A;  4YH4 A;  5BT5 A;  3QZV A;  3S92 A;  3NXB A;  2LSP B;  4O7B A;  5EPS A;  5HEL A;  4NR8 A;  3MQM A;  4CFK A;  5JI8 A;  4A9M A;  4NXJ A;  2DVV A;  2E3K A;  5A7C A;  5LKX A;  5FE7 A;  3U5L A;  4QR3 A;  5AD3 A;  3FKM X;  2MJV B;  2YEL A;  5CQ7 A;  3LJW A;  5F1H A;  5HFR A;  4YAB A;  3MUL A;  2YDW A;  1F68 A;  3UV2 A;  5FE3 A;  4WHU A;  3ONI A;  4O77 A;  3RCW A;  4AKH A;  3SVH A;  3P1E A;  5C89 A;  5E9L A;  3IU6 A;  4LZR A;  4QC3 A;  5FE9 A;  3P1C A;  5FE2 A;  5E7D A;  4QY4 A;  4NR7 A;  5A83 A;  2R0V A;  1JSP B;  4A9I A;  3O37 A;  5FDZ A;  4YBS A;  4OUF A;  5ENF A;  4O7F A;  3P5O A;  5FH6 A;  3D1B A;  5LJ2 A;  1WUM A;  4TT6 A;  4TZ2 A;  3MXF A;  5DBM A;  4CUR A;  5KTX A;  4AKN A;  5CS8 A;  4O7A A;  4MR4 A;  5FH8 A;  5E9V A;  5L99 A;  4QC1 A;  3O36 A;  2D82 A;  4QYD A;  5EWD A;  5E0R A;  4NQN A;  5D7X A;  3K2J A;  4QR4 A;  4NRA A;  4BJX A;  4UYE A;  5CUB A;  4CUT A;  5D3P A;  4QNS A;  5IG6 A;  5CU8 A;  5II2 A;  2I7K A;  2RS9 B;  3QZT A;  3P1D A;  5L8T A;  3D7C A;  5E3D A;  4HXP A;  3U5J A;  4Z1Q A;  4HXR A;  5IGK A;  1ZS5 A;  2DAT A;  5DKC A;  4TQN A;  5ENB A;  2D9E A;  4UYD A;  4XUA A;  3UV5 A;  4A9N A;  3UVD A;  5DFC A;  4QSR A;  3Q2E A;  5F3A A;  3S91 A;  5ENE A;  4LRG A;  4NR5 A;  2DVQ A;  4NS5 A;  4A9F A;  5EWH A;  4YYJ A;  4HXO A;  4QSV A;  4UIW A;  5L98 A;  4HBV A;  5KTU A;  5A5R A;  2F6N A;  3JVK A;  4O7E A;  5IID A;  2DWW A;  3MUK A;  2E7N A;  4PKL A;  4PTB A;  3IU5 A;  4BW1 A;  2RNW A;  5HFQ A;  3JVJ A;  3UVX A;  2OO1 A;  5FE0 A;  2KTB B;  4TTE A;  4Y03 A;  3U5P A;  3JVL A;  5FG5 A;  1JM4 B;  5EA1 A;  5KHM A;  3D1D A;  5D3L A;  2WP2 A;  4MR5 A;  3O33 A;  4IR3 A;  4PCE A;  5D3R A;  5DFB A;  2H60 A;  4O7C A;  4ZW1 A;  4A9J A;  5EU1 A;  5FB0 A;  5HRW A;  4XY8 A;  2YYN A;  4YY4 A;  1WUG A;  2GRC A;  4YYK A;  5I86 A;  4MR3 A;  3UV4 A;  5G4R A;  4Q0O A;  5C4Q A;  5DYX A;  5D3T A;  3VKH A;  5A5O A;  4NR4 A;  3ERR A;  2R0Y A;  4YY6 A;  5ETD A;  4XY9 A;  5H1U A;  4YAT A;  5E9M A;  5CUE A;  5IGL A;  3TLP A;  5EI4 A;  5CQ5 A;  5A5Q A;  5E73 A;  4OGI A;  5F25 A;  4ZQL A;  4J3I A;  4RVR A;  5A5S A;  4Z6I A;  5F2P A;  4CUQ A;  5ACY A;  5FH7 A;  4A9L A;  4Z93 A;  2E7O A;  5E9K A;  4BW3 A;  5EVA A;  5H1T A;  5I7Y A;  2L5E A;  5TB6 A;  3DAI A;  5EWC A;  4NUE A;  5EPR A;  5D3J A;  4YAD A;  5FFY A;  4O76 A;  4ZC9 A;  5FE4 A;  2R10 A;  5BT3 A;  4QUT A;  4BW4 A;  4CLB A;  5HJC A;  4GPJ A;  1EQF A;  2N9G A;  5I83 A;  2OUO A;  4O78 A;  4MEQ A;  4UYH A;  5F5Z A;  1E6I A;  4IR6 A;  5I7X A;  4QSS A;  4J0S A;  4YYI A;  5H1V A;  4A9K A;  5CQA A;  5AMF A;  4LR6 A;  5HQ6 A;  4HBX A;  3LQI A;  5DKD A;  5F60 A;  4MEN A;  5ETB A;  5CRZ A;  4FLP A;  4HXK A;  4Z1S A;  4YBM A;  2FSA A;  5FE8 A;  2WP1 A;  4TYL A;  5HM0 A;  4KV4 A;  2DKW A;  5CZG A;  2RNX A;  2L85 A;  5A82 A;  4N4F A;  5J0D A;  4NR6 A;  5E9I A;  4C66 A;  4O70 A;  4WIV A;  5A85 A;  4IOQ A;  4Q0N A;  4A9H A;  4N4I A;  4BHW A;  5E74 A;  1N72 A;  5EIC A;  4QBM A;  4YYD A;  5DX4 A;  4UIT A;  5A81 A;  4NYW A;  5CPE A;  5DYU A;  5CUA A;  5D26 A;  5I88 A;  5IGN A;  5HEN A;  5I80 A;  4TT4 A;  5F63 A;  5K29 A;  5FFW A;  3U5O A;  5CUD A;  5L96 A;  4QSP A;  4QB3 A;  4BW2 A;  5AD2 A;  4LYI A;  4MEO A;  4O75 A;  4TU4 A;  2RO1 A;  5EV9 A;  4KCX A;  4CUU A;  5LKZ A;  2L84 A;  4X2I A;  5CUG A;  5D3N A;  2RI7 A;  3U5N A;  4PY6 A;  5DLX A;  4A9E A;  5DYA A;  5F36 A;  5EGU A;  5F1L A;  2DVS A;  2YQD A;  5EWW A;  5LUU A;  4HXM A;  3DWY A;  5KU3 A;  5EP7 A;  5CQ4 A;  5L8U A;  4QR5 A;  3U5M A;  5CY9 A;  2G4A A;  4A9O A;  4E96 A;  4C67 A;  3HMF A;  5ENJ A;  1X0J A;  4TU6 A;  5F62 A;  5C85 A;  4J0R A;  5A5N A;  3P1F A;  4TS8 A;  4QZS A;  3GG3 A;  2RNY A;  5DLZ A;  5FG6 A;  5LVQ A;  4ALG A;  4XYA A;  4LZS A;  4LC2 A;  3O35 A;  4HBW A;  4UYG A;  5AME A;  5ENH A;  5HRV A;  4QSW A;  4KV1 A;  4CUS A;  4QEU A;  3G0J A;  4CL9 A;  4WHW A;  4NUC A;  5EQ1 A;  5FE5 A;  2F6J A;  5L97 A;  4NR9 A;  3HMH A;  5FE1 A;  1PUO A;  5I40 A;  4QYL A;  4AI6 A;  3U5K A;  4YK0 A;  4ALH A;  4IOO A;  5II1 A;  4YYH A;  5FBX A;  4TZ8 A;  5FFV A;  2NXB A;  4YAX A;  5D24 A;  3HME A;  4YC9 A;  4HBY A;  4QSU A;  4N4G A;  5EPB A;  5ENG A;  4NYV A;  3SVF A;  4F3I A;  5A5P A;  4HXN A;  5DYC A;  4XUB A;  4LYW A;  4YH3 A;  4QEV A;  5EIS A;  4LZ2 A;  2YW5 A;  3O34 A;  5I89 A;  3ZYU A;  5G4S A;  5FB1 A;  4YYM A;  3UVW A;  3G0L A;  3UVY A;  3VKG A;  3Q2F A;  4J1P A;  5IBN A;  4CUP A;  3MB4 A;  5TCM A;  4LYS A;  4YYG A;  5HCL A;  2YEM A;  4QSX A;  5CP5 A;  4YBT A;  5HLS A;  5IGM A;  5DW2 A;  5CFW A;  4QUU A;  5ENI A;  4AKG A;  5FE6 A;  5LJ0 A;  4OGJ A;  4DON A;  4QEW A;  5C87 A;  5F61 A;  4HXL A;  4IOR A;  4MR6 A;  5C8G A;  4NUD A;  4YYN A;  5CRM A;  5EWV A;  4UIV A;  3AQA A;  2R0S A;  3AAD A;  4IR5 A;  4TT2 A;  5H85 A;  5I1Q A;  4NRC A;  5JWM A;  3I3J A;  4UIU A;  5CQT A;  5BT4 A;  2YEK A;  5D25 A;  4PCI A;  4UYF B;  5ENC A;  4MEP A;  5HQ7 A;  4UIX A; 
#chains in the Genus database with same CATH homology
 5HEM A;  3UW9 A;  5D3S A;  5EM3 A;  5CUC A;  2RFJ A;  4NYX A;  5CGP A;  5D3H A;  4NQM A;  4N4H A;  5E9Y A;  5EK9 A;  4O71 A;  5LVR A;  3JVM A;  5LKU A;  3LXJ A;  4O72 A;  5DFD A;  3MB3 A;  5E3G A;  4O74 A;  2DVR A;  5KO4 A;  4QSQ A;  5HRX A;  4UIY A;  2I8N A;  5DY7 A;  4UYF A;  4LDF A;  4QST A;  4N3W A;  3SVG A;  4NRB A;  5C7N A;  5D0C A;  2OSS A;  5CQ3 A;  5LKT A;  5DKH A;  5I29 A;  3LQJ A;  4HXS A;  5CQ6 A;  5HQ5 A;  4IR4 A;  5CTL A;  4CFL A;  3LQH A;  5LJ1 A;  5COI A;  4PS5 A;  5KTW A;  3QZS A;  4Z6H A;  5FG4 A;  4UIZ A;  5CQ8 A;  5DW1 A;  4YH4 A;  5BT5 A;  3QZV A;  3S92 A;  3NXB A;  2LSP B;  4O7B A;  5EPS A;  5HEL A;  4NR8 A;  3MQM A;  4CFK A;  5JI8 A;  4A9M A;  4NXJ A;  2DVV A;  2E3K A;  5A7C A;  5LKX A;  5FE7 A;  3U5L A;  4QR3 A;  5AD3 A;  3FKM X;  2MJV B;  2YEL A;  5CQ7 A;  3LJW A;  5F1H A;  5HFR A;  4YAB A;  3MUL A;  2YDW A;  1F68 A;  3UV2 A;  5FE3 A;  4WHU A;  3ONI A;  4O77 A;  3RCW A;  3SVH A;  3P1E A;  5C89 A;  5E9L A;  3IU6 A;  4LZR A;  4QC3 A;  5FE9 A;  3P1C A;  5FE2 A;  5E7D A;  4QY4 A;  4NR7 A;  5A83 A;  2R0V A;  1JSP B;  4A9I A;  3O37 A;  5FDZ A;  4YBS A;  4OUF A;  5ENF A;  4O7F A;  3P5O A;  5FH6 A;  5LJ2 A;  1WUM A;  4TT6 A;  4TZ2 A;  3MXF A;  5DBM A;  4CUR A;  5KTX A;  4AKN A;  5CS8 A;  4O7A A;  4MR4 A;  5FH8 A;  5E9V A;  5L99 A;  4QC1 A;  3O36 A;  2D82 A;  4QYD A;  5EWD A;  5E0R A;  4NQN A;  5D7X A;  3K2J A;  4QR4 A;  4NRA A;  4BJX A;  4UYE A;  5CUB A;  4CUT A;  5D3P A;  4QNS A;  5IG6 A;  5CU8 A;  5II2 A;  2I7K A;  2RS9 B;  3QZT A;  3P1D A;  5L8T A;  3D7C A;  5E3D A;  4HXP A;  3U5J A;  4Z1Q A;  4HXR A;  5IGK A;  1ZS5 A;  2DAT A;  5DKC A;  4TQN A;  5ENB A;  2D9E A;  4UYD A;  4XUA A;  3UV5 A;  4A9N A;  3UVD A;  5DFC A;  4QSR A;  3Q2E A;  5F3A A;  3S91 A;  5ENE A;  4LRG A;  4NR5 A;  2DVQ A;  4NS5 A;  4A9F A;  5EWH A;  4YYJ A;  4HXO A;  4QSV A;  4UIW A;  5L98 A;  4HBV A;  5KTU A;  5A5R A;  2F6N A;  3JVK A;  4O7E A;  5IID A;  2DWW A;  3MUK A;  2E7N A;  4PKL A;  4PTB A;  3IU5 A;  4BW1 A;  2RNW A;  5HFQ A;  3JVJ A;  3UVX A;  2OO1 A;  5FE0 A;  2KTB B;  4TTE A;  4Y03 A;  3U5P A;  3JVL A;  5FG5 A;  1JM4 B;  5EA1 A;  5KHM A;  5D3L A;  2WP2 A;  4MR5 A;  3O33 A;  4IR3 A;  4PCE A;  5D3R A;  5DFB A;  2H60 A;  4O7C A;  4ZW1 A;  4A9J A;  5EU1 A;  5FB0 A;  5HRW A;  4XY8 A;  2YYN A;  4YY4 A;  1WUG A;  2GRC A;  4YYK A;  5I86 A;  4MR3 A;  3UV4 A;  5G4R A;  4Q0O A;  5C4Q A;  5DYX A;  5D3T A;  5A5O A;  4NR4 A;  2R0Y A;  4YY6 A;  5ETD A;  4XY9 A;  5H1U A;  4YAT A;  5E9M A;  5CUE A;  5IGL A;  3TLP A;  5EI4 A;  5CQ5 A;  5A5Q A;  5E73 A;  4OGI A;  5F25 A;  4ZQL A;  4J3I A;  4RVR A;  5A5S A;  4Z6I A;  5F2P A;  4CUQ A;  5ACY A;  5FH7 A;  4A9L A;  4Z93 A;  2E7O A;  5E9K A;  4BW3 A;  5EVA A;  5H1T A;  5I7Y A;  2L5E A;  5TB6 A;  3DAI A;  5EWC A;  4NUE A;  5EPR A;  5D3J A;  4YAD A;  5FFY A;  4O76 A;  4ZC9 A;  5FE4 A;  2R10 A;  5BT3 A;  4QUT A;  4BW4 A;  4CLB A;  5HJC A;  4GPJ A;  1EQF A;  2N9G A;  5I83 A;  2OUO A;  4O78 A;  4MEQ A;  4UYH A;  5F5Z A;  1E6I A;  4IR6 A;  5I7X A;  4QSS A;  4J0S A;  4YYI A;  5H1V A;  4A9K A;  5CQA A;  5AMF A;  4LR6 A;  5HQ6 A;  4HBX A;  3LQI A;  5DKD A;  5F60 A;  4MEN A;  5ETB A;  5CRZ A;  4FLP A;  4HXK A;  4Z1S A;  4YBM A;  2FSA A;  5FE8 A;  2WP1 A;  4TYL A;  5HM0 A;  4KV4 A;  2DKW A;  5CZG A;  2RNX A;  2L85 A;  5A82 A;  4N4F A;  5J0D A;  4NR6 A;  5E9I A;  4C66 A;  4O70 A;  4WIV A;  5A85 A;  4IOQ A;  4Q0N A;  4A9H A;  4N4I A;  4BHW A;  5E74 A;  1N72 A;  5EIC A;  4QBM A;  4YYD A;  5DX4 A;  4UIT A;  5A81 A;  4NYW A;  5CPE A;  5DYU A;  5CUA A;  5D26 A;  5I88 A;  5IGN A;  5HEN A;  5I80 A;  4TT4 A;  5F63 A;  5K29 A;  5FFW A;  3U5O A;  5CUD A;  5L96 A;  4QSP A;  4QB3 A;  4BW2 A;  5AD2 A;  4LYI A;  4MEO A;  4O75 A;  4TU4 A;  2RO1 A;  5EV9 A;  4KCX A;  4CUU A;  5LKZ A;  2L84 A;  4X2I A;  5CUG A;  5D3N A;  2RI7 A;  3U5N A;  4PY6 A;  5DLX A;  4A9E A;  5DYA A;  5F36 A;  5EGU A;  5F1L A;  2DVS A;  2YQD A;  5EWW A;  5LUU A;  4HXM A;  3DWY A;  5KU3 A;  5EP7 A;  5CQ4 A;  5L8U A;  4QR5 A;  3U5M A;  5CY9 A;  2G4A A;  4A9O A;  4E96 A;  4C67 A;  3HMF A;  5ENJ A;  1X0J A;  4TU6 A;  5F62 A;  5C85 A;  4J0R A;  5A5N A;  3P1F A;  4TS8 A;  4QZS A;  3GG3 A;  2RNY A;  5DLZ A;  5FG6 A;  5LVQ A;  4ALG A;  4XYA A;  4LZS A;  4LC2 A;  3O35 A;  4HBW A;  4UYG A;  5AME A;  5ENH A;  5HRV A;  4QSW A;  4KV1 A;  4CUS A;  4QEU A;  3G0J A;  4CL9 A;  4WHW A;  4NUC A;  5EQ1 A;  5FE5 A;  2F6J A;  5L97 A;  4NR9 A;  3HMH A;  5FE1 A;  5I40 A;  4QYL A;  3U5K A;  4YK0 A;  4ALH A;  4IOO A;  5II1 A;  4YYH A;  5FBX A;  4TZ8 A;  5FFV A;  2NXB A;  4YAX A;  5D24 A;  3HME A;  4YC9 A;  4HBY A;  4QSU A;  4N4G A;  5EPB A;  5ENG A;  4NYV A;  3SVF A;  4F3I A;  5A5P A;  4HXN A;  5DYC A;  4XUB A;  4LYW A;  4YH3 A;  4QEV A;  5EIS A;  4LZ2 A;  2YW5 A;  3O34 A;  5I89 A;  3ZYU A;  5G4S A;  5FB1 A;  4YYM A;  3UVW A;  3G0L A;  3UVY A;  3Q2F A;  4J1P A;  5IBN A;  4CUP A;  3MB4 A;  5TCM A;  4LYS A;  4YYG A;  5HCL A;  2YEM A;  4QSX A;  5CP5 A;  4YBT A;  5HLS A;  5IGM A;  5DW2 A;  5CFW A;  4QUU A;  5ENI A;  5FE6 A;  5LJ0 A;  4OGJ A;  4DON A;  4QEW A;  5C87 A;  5F61 A;  4HXL A;  4IOR A;  4MR6 A;  5C8G A;  4NUD A;  4YYN A;  5CRM A;  5EWV A;  4UIV A;  3AQA A;  2R0S A;  3AAD A;  4IR5 A;  4TT2 A;  5H85 A;  5I1Q A;  4NRC A;  5JWM A;  3I3J A;  4UIU A;  5CQT A;  5BT4 A;  2YEK A;  5D25 A;  4PCI A;  4UYF B;  5ENC A;  4MEP A;  5HQ7 A;  4UIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...