3MB4A

Crystal structure of the fifth bromodomain of human poly-bromodomain containing protein 1 (pb1) with nmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
115
structure length
115
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein polybromo-1
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3mb4A00
5A5RA 4NRCA 5A5NA 5FFWA 2FSAA 3SVGA 5I80A 3P1EA 5D3NA 5IGLA 5A81A 5EWWA 3O34A 3JVKA 4A9JA 5E74A 4NYWA 4KV4A 4IR5A 5E73A 4BW1A 5I88A 4LC2A 5C89A 4NR5A 5F1HA 5LKXA 5EWVA 5CGPA 2L5EA 2I8NA 2YEMA 5I7YA 1F68A 4UYFB 4XUAA 4F3IA 2WP1A 2YDWA 5E9YA 5KTWA 2MJVB 3D7CA 4PTBA 3DWYA 3JVLA 3Q2FA 4NRAA 3MULA 2R10A 2YQDA 4UIWA 5A5SA 4LZRA 5LJ2A 5F36A 5F25A 5DX4A 4UIZA 2H60A 1WUMA 5HENA 5FE5A 4QSQA 3G0JA 4UIXA 2D82A 5LJ1A 2R0SA 5D26A 4O75A 2RO1A 3LQJA 4N4HA 5A85A 2I7KA 4NR9A 4QEVA 4CL9A 5E0RA 5L8TA 5CUCA 4O7AA 5EVAA 4TZ8A 5CQAA 5HM0A 4MEOA 4Z6HA 4YADA 5K29A 4Q0OA 4O77A 4OUFA 4QYDA 3HMFA 4X2IA 5IIDA 4IORA 4NRBA 2E3KA 5FE2A 4QNSA 5DFBA 4YY4A 4LRGA 2DVSA 4RVRA 4QY4A 5EWHA 5FE9A 5JWMA 4MEQA 4Z93A 4PY6A 4HXKA 5CQ6A 5L97A 4NQMA 4LYSA 5EM3A 5ENJA 5CUGA 5L8UA 4PS5A 4WHUA 5C85A 3AQAA 4YYGA 4O72A 4YAXA 5FE6A 3QZVA 4NR4A 5BT3A 3U5OA 3O33A 5D3PA 3O36A 3P5OA 4GPJA 5DW2A 4N4FA 5CQTA 3UV5A 4A9EA 4IR4A 5TB6A 4A9KA 3IU6A 4NUCA 5F61A 3U5NA 4QEWA 5F3AA 5FH6A 4CLBA 5CQ5A 5II2A 3UVXA 4HBXA 5DLXA 5HELA 3P1CA 2KTBB 5E3GA 5I86A 4Q0NA 4QYLA 5CUBA 1N72A 5CUDA 5E7DA 5EU1A 4YYIA 5JI8A 5FE7A 4UIUA 5TCMA 5CUEA 4O74A 2OO1A 5D7XA 5EGUA 4QBMA 5A83A 3LQIA 4TS8A 2G4AA 4UIVA 4HXLA 4CUTA 5EISA 4UYEA 5A5OA 4IR3A 4QZSA 4A9LA 2L85A 4YBMA 5G4RA 4OGJA 4C66A 1JSPB 3IU5A 4KCXA 4KV1A 5I83A 5FE0A 5ETBA 4QUTA 4QSUA 4XUBA 4YC9A 5AMFA 5F2PA 4O7CA 5FG6A 4UITA 3SVFA 5A7CA 2DATA 4ZW1A 4TTEA 5ENIA 4BW3A 5H85A 4C67A 4ZQLA 5DYCA 5DFDA 5FH7A 4YYKA 5A5PA 4YH4A 5DW1A 5I29A 5LKTA 5L98A 4PCEA 5CUAA 5FB1A 4CFLA 5CPEA 5I40A 4QR3A 2RFJA 4AKNA 5FH8A 2L84A 4FLPA 4QC1A 4PKLA 4NR6A 5D0CA 4BW4A 5D3LA 5DY7A 5FFVA 5J0DA 5HRVA 4BHWA 4OGIA 5LKZA 4IOOA 4Y03A 5HRWA 2RNXA 5I7XA 2WP2A 4YBSA 2R0VA 4YBTA 2DKWA 4QR5A 4YH3A 4QSWA 5D3HA 5HFRA 5C8GA 5AD2A 5E3DA 5ENHA 5L96A 4J3IA 5D3RA 5EPBA 2RS9B 5HQ5A 4O71A 3UW9A 5F63A 5E9VA 2F6NA 2GRCA 5H1UA 4O7BA 4WHWA 2RI7A 4CUPA 5EWCA 5BT5A 4HXOA 4LYWA 4NR8A 5FE8A 5FFYA 3RCWA 5HLSA 4QEUA 5ENGA 4ZC9A 3UV2A 5D24A 4HBWA 2F6JA 5EPSA 2E7OA 5EP7A 1WUGA 5HRXA 3UVYA 4QSRA 3QZSA 4O7FA 4QSSA 5EK9A 3O35A 5IBNA 3FKMX 5EV9A 3O37A 5DYXA 4QSXA 5G4SA 5I89A 3MB4A 4NR7A 5CQ7A 4N3WA 4NYVA 2DWWA 4XY8A 4E96A 3JVMA 3NXBA 5ENCA 4TZ2A 4LYIA 4YATA 5DLZA 2DVRA 3U5LA 5E9IA 3DAIA 4UIYA 4J0RA 3QZTA 4IOQA 4TT6A 5A5QA 2OUOA 5DYUA 5ENBA 5FDZA 5CFWA 5HFQA 5FE4A 3UV4A 4O7EA 4MEPA 5FB0A 5HQ7A 3I3JA 5KTXA 4A9FA 5KU3A 5KTUA 4NUEA 3JVJA 4MR6A 5CRZA 5FG4A 5LJ0A 5D3TA 3MUKA 4N4GA 5HCLA 5FBXA 5COIA 5CY9A 4TU6A 4TYLA 4ALHA 5II1A 2R0YA 5I1QA 5L99A 4ALGA 5LVRA 4HXMA 4YYHA 4QSTA 4TT4A 3U5JA 4YABA 5FE3A 2YYNA 3MQMA 5FE1A 2DVVA 4A9MA 4NXJA 5EPRA 4A9NA 3P1FA 4UYHA 2RNYA 4HXPA 5F5ZA 5LKUA 4Z1QA 4BJXA 5IGKA 5C87A 4XYAA 4QSVA 4IR6A 4CFKA 4HXNA 3K2JA 3U5PA 5AD3A 4HXRA 4CUUA 5CTLA 5EICA 2RNWA 4J1PA 2OSSA 3UVDA 4MR4A 4Z1SA 5CU8A 5EQ1A 3G0LA 4MR5A 3HMHA 5EWDA 4QSPA 4HXSA 4J0SA 3ONIA 4O76A 5F1LA 5IG6A 4PCIA 3LQHA 5EA1A 4NYXA 5ENFA 3HMEA 5KO4A 4LZ2A 4A9IA 4N4IA 5CZGA 5AMEA 5HQ6A 5DYAA 2NXBA 2LSPB 4YK0A 4UYDA 3TLPA 2YEKA 3ZYUA 5C4QA 4MENA 4TQNA 4A9OA 5EI4A 5LVQA 1JM4B 2YELA 4YYJA 4YYNA 3S92A 4QR4A 3Q2EA 5H1VA 5DKDA 3U5KA 4DONA 4TT2A 4BW2A 5ENEA 5ACYA 4Z6IA 3U5MA 2N9GA 5CP5A 2YW5A 4LZSA 4NUDA 4NS5A 4UYGA 4YYMA 4O78A 5HEMA 4CUSA 3AADA 4A9HA 4MR3A 5DKCA 5H1TA 5CQ4A 5E9KA 4XY9A 5E9LA 4WIVA 5ETDA 4HBYA 4LDFA 1E6IA 4UYFA 2DVQA 5C7NA 4YYDA 4YY6A 2E7NA 2D9EA 3P1DA 4QC3A 5LUUA 5D3SA 4QB3A 1X0JA 5BT4A 3MB3A 5DBMA 5IGMA 1EQFA 5CQ3A 5KHMA 4LR6A 5CS8A 5DKHA 3MXFA 4QUUA 5D3JA 3LJWA 3GG3A 5F60A 5CRMA 4CUQA 3S91A 5E9MA 5F62A 5IGNA 4O70A 5A82A 5CQ8A 3UVWA 3SVHA 4TU4A 5DFCA 4CURA 5D25A 5HJCA 5FG5A 1ZS5A 4HBVA 4NQNA 3LXJA
chains in the Genus database with same CATH superfamily
5A5RA 4NRCA 5A5NA 5FFWA 2FSAA 3SVGA 5I80A 3P1EA 5D3NA 5IGLA 5A81A 5EWWA 3ERRA 3O34A 3JVKA 4A9JA 5E74A 4NYWA 4KV4A 4IR5A 5E73A 4BW1A 5I88A 4LC2A 3VKGA 5C89A 4NR5A 5F1HA 5LKXA 5EWVA 5CGPA 2L5EA 2I8NA 2YEMA 5I7YA 1F68A 4UYFB 4XUAA 4F3IA 2WP1A 2YDWA 5E9YA 5KTWA 2MJVB 3D7CA 4PTBA 3DWYA 3JVLA 3Q2FA 4NRAA 3MULA 2R10A 2YQDA 4UIWA 5A5SA 4LZRA 5LJ2A 5F36A 5F25A 5DX4A 4UIZA 2H60A 1WUMA 5HENA 5FE5A 4QSQA 3G0JA 4UIXA 2D82A 5LJ1A 2R0SA 5D26A 4O75A 2RO1A 3LQJA 4N4HA 5A85A 2I7KA 4NR9A 4QEVA 4CL9A 5E0RA 5L8TA 5CUCA 4O7AA 5EVAA 4TZ8A 5CQAA 5HM0A 4MEOA 4Z6HA 4YADA 5K29A 4Q0OA 4O77A 4OUFA 4QYDA 3HMFA 4X2IA 5IIDA 4IORA 4NRBA 2E3KA 5FE2A 4QNSA 5DFBA 4YY4A 4LRGA 2DVSA 4RVRA 4QY4A 5EWHA 5FE9A 5JWMA 4MEQA 4Z93A 4PY6A 4HXKA 5CQ6A 5L97A 4NQMA 4LYSA 5EM3A 5ENJA 5CUGA 5L8UA 4PS5A 4WHUA 5C85A 3AQAA 4YYGA 4O72A 4YAXA 5FE6A 4AKHA 3QZVA 4NR4A 5BT3A 3U5OA 3O33A 5D3PA 3O36A 3P5OA 4GPJA 5DW2A 4N4FA 5CQTA 3UV5A 4A9EA 4IR4A 5TB6A 4A9KA 3IU6A 4NUCA 5F61A 3U5NA 4QEWA 5F3AA 5FH6A 4CLBA 5CQ5A 5II2A 3UVXA 4HBXA 5DLXA 5HELA 3P1CA 2KTBB 5E3GA 5I86A 4Q0NA 4QYLA 5CUBA 1N72A 5CUDA 1PUOA 5E7DA 5EU1A 4YYIA 5JI8A 5FE7A 4UIUA 5TCMA 5CUEA 4O74A 2OO1A 5D7XA 5EGUA 4QBMA 5A83A 3LQIA 4TS8A 2G4AA 4UIVA 4HXLA 4CUTA 5EISA 4UYEA 5A5OA 4IR3A 4QZSA 4A9LA 2L85A 4YBMA 5G4RA 4OGJA 4C66A 1JSPB 3IU5A 4KCXA 4KV1A 5I83A 5FE0A 5ETBA 4QUTA 4QSUA 4XUBA 4YC9A 5AMFA 5F2PA 4O7CA 5FG6A 4UITA 3SVFA 5A7CA 2DATA 4ZW1A 4TTEA 5ENIA 4BW3A 5H85A 4C67A 4ZQLA 5DYCA 5DFDA 5FH7A 4YYKA 5A5PA 4YH4A 5DW1A 5I29A 5LKTA 5L98A 4PCEA 5CUAA 5FB1A 4CFLA 5CPEA 5I40A 4QR3A 2RFJA 4AKNA 5FH8A 2L84A 4FLPA 4QC1A 4PKLA 4NR6A 5D0CA 4BW4A 5D3LA 5DY7A 5FFVA 5J0DA 5HRVA 4BHWA 4OGIA 5LKZA 3VKHA 4IOOA 4Y03A 5HRWA 2RNXA 5I7XA 2WP2A 4YBSA 2R0VA 4YBTA 2DKWA 4QR5A 4YH3A 4QSWA 5D3HA 5HFRA 5C8GA 5AD2A 5E3DA 5ENHA 5L96A 4J3IA 5D3RA 5EPBA 2RS9B 5HQ5A 4O71A 3UW9A 5F63A 5E9VA 2F6NA 2GRCA 5H1UA 4O7BA 4WHWA 2RI7A 4CUPA 5EWCA 5BT5A 4HXOA 4LYWA 4NR8A 5FE8A 5FFYA 3RCWA 5HLSA 4QEUA 5ENGA 4ZC9A 3UV2A 5D24A 4HBWA 2F6JA 5EPSA 2E7OA 3D1DA 5EP7A 1WUGA 5HRXA 4AKGA 3UVYA 4QSRA 3QZSA 4O7FA 4QSSA 5EK9A 3O35A 5IBNA 3FKMX 5EV9A 3O37A 5DYXA 4QSXA 5G4SA 5I89A 3MB4A 4NR7A 5CQ7A 4N3WA 4NYVA 2DWWA 4XY8A 4E96A 3JVMA 3NXBA 5ENCA 4TZ2A 4LYIA 4YATA 5DLZA 2DVRA 3U5LA 5E9IA 3DAIA 4UIYA 4J0RA 1ZKRA 3QZTA 4IOQA 4TT6A 5A5QA 2OUOA 5DYUA 5ENBA 5FDZA 5CFWA 5HFQA 5FE4A 3UV4A 4O7EA 4MEPA 5FB0A 5HQ7A 3I3JA 5KTXA 4A9FA 5KU3A 5KTUA 4NUEA 3JVJA 4MR6A 5CRZA 5FG4A 5LJ0A 5D3TA 3MUKA 4N4GA 5HCLA 5FBXA 5COIA 5CY9A 4TU6A 4TYLA 4ALHA 5II1A 2R0YA 5I1QA 5L99A 4ALGA 5LVRA 4HXMA 4YYHA 4QSTA 4TT4A 3U5JA 4YABA 5FE3A 2YYNA 3MQMA 5FE1A 2DVVA 4A9MA 4NXJA 5EPRA 4A9NA 3P1FA 4UYHA 2RNYA 4HXPA 5F5ZA 5LKUA 4Z1QA 4BJXA 5IGKA 5C87A 4XYAA 4QSVA 4IR6A 4CFKA 4HXNA 3K2JA 3U5PA 5AD3A 4HXRA 4CUUA 5CTLA 5EICA 2RNWA 4J1PA 2OSSA 3UVDA 4MR4A 4Z1SA 5CU8A 5EQ1A 3G0LA 4MR5A 3HMHA 5EWDA 4QSPA 4HXSA 4J0SA 3ONIA 4O76A 5F1LA 5IG6A 4PCIA 3LQHA 5EA1A 4NYXA 5ENFA 3HMEA 5KO4A 4LZ2A 4A9IA 4N4IA 5CZGA 5AMEA 5HQ6A 5DYAA 2NXBA 2LSPB 4YK0A 4UYDA 3TLPA 2YEKA 3ZYUA 5C4QA 4MENA 2EJNA 4TQNA 4A9OA 5EI4A 5LVQA 1JM4B 2YELA 4YYJA 4YYNA 3S92A 4QR4A 3Q2EA 5H1VA 5DKDA 3U5KA 4DONA 4AKIA 4TT2A 4BW2A 5ENEA 5ACYA 4Z6IA 3D1BA 3U5MA 2N9GA 5CP5A 2YW5A 4LZSA 4NUDA 4NS5A 4UYGA 4YYMA 4AI6A 4O78A 5HEMA 4CUSA 3AADA 4A9HA 4MR3A 5DKCA 5H1TA 5CQ4A 5E9KA 4XY9A 5E9LA 4WIVA 5ETDA 4HBYA 4LDFA 1E6IA 4UYFA 2DVQA 5C7NA 4YYDA 4YY6A 2E7NA 2D9EA 3P1DA 4QC3A 5LUUA 5D3SA 4QB3A 1X0JA 5BT4A 3MB3A 5DBMA 5IGMA 1EQFA 5CQ3A 5KHMA 4LR6A 5CS8A 5DKHA 3MXFA 4QUUA 5D3JA 3LJWA 3GG3A 5F60A 5CRMA 4CUQA 3S91A 5E9MA 5F62A 5IGNA 4O70A 5A82A 5CQ8A 3UVWA 3SVHA 4TU4A 5DFCA 4CURA 5D25A 5HJCA 5FG5A 1ZS5A 4HBVA 4NQNA 3LXJA
chains in the Genus database with same CATH topology
5A5RA 4NRCA 5A5NA 5FFWA 2FSAA 3SVGA 5I80A 3P1EA 5D3NA 5IGLA 5A81A 5EWWA 3O34A 3JVKA 4A9JA 5E74A 4NYWA 4KV4A 4IR5A 5E73A 4BW1A 5I88A 4LC2A 5C89A 4NR5A 5F1HA 5LKXA 5EWVA 5CGPA 2L5EA 2I8NA 2YEMA 5I7YA 1F68A 4UYFB 4XUAA 4F3IA 2WP1A 2YDWA 5E9YA 5KTWA 2MJVB 3D7CA 4PTBA 3DWYA 3JVLA 3Q2FA 4NRAA 3MULA 2R10A 2YQDA 4UIWA 5A5SA 4LZRA 5LJ2A 5F36A 5F25A 5DX4A 4UIZA 2H60A 1WUMA 5HENA 5FE5A 4QSQA 3G0JA 4UIXA 2D82A 5LJ1A 2R0SA 5D26A 4O75A 2RO1A 3LQJA 4N4HA 5A85A 2I7KA 4NR9A 4QEVA 4CL9A 5E0RA 5L8TA 5CUCA 4O7AA 5EVAA 4TZ8A 5CQAA 5HM0A 4MEOA 4Z6HA 4YADA 5K29A 4Q0OA 4O77A 4OUFA 4QYDA 3HMFA 4X2IA 5IIDA 4IORA 4NRBA 2E3KA 5FE2A 4QNSA 5DFBA 4YY4A 4LRGA 2DVSA 4RVRA 4QY4A 5EWHA 5FE9A 5JWMA 4MEQA 4Z93A 4PY6A 4HXKA 5CQ6A 5L97A 4NQMA 4LYSA 5EM3A 5ENJA 5CUGA 5L8UA 4PS5A 4WHUA 5C85A 3AQAA 4YYGA 4O72A 4YAXA 5FE6A 3QZVA 4NR4A 5BT3A 3U5OA 3O33A 5D3PA 3O36A 3P5OA 4GPJA 5DW2A 4N4FA 5CQTA 3UV5A 4A9EA 4IR4A 5TB6A 4A9KA 3IU6A 4NUCA 5F61A 3U5NA 4QEWA 5F3AA 5FH6A 4CLBA 5CQ5A 5II2A 3UVXA 4HBXA 5DLXA 5HELA 3P1CA 2KTBB 5E3GA 5I86A 4Q0NA 4QYLA 5CUBA 1N72A 5CUDA 5E7DA 5EU1A 4YYIA 5JI8A 5FE7A 4UIUA 5TCMA 5CUEA 4O74A 2OO1A 5D7XA 5EGUA 4QBMA 5A83A 3LQIA 4TS8A 2G4AA 4UIVA 4HXLA 4CUTA 5EISA 4UYEA 5A5OA 4IR3A 4QZSA 4A9LA 2L85A 4YBMA 5G4RA 4OGJA 4C66A 1JSPB 3IU5A 4KCXA 4KV1A 5I83A 5FE0A 5ETBA 4QUTA 4QSUA 4XUBA 4YC9A 5AMFA 5F2PA 4O7CA 5FG6A 4UITA 3SVFA 5A7CA 2DATA 4ZW1A 4TTEA 5ENIA 4BW3A 5H85A 4C67A 4ZQLA 5DYCA 5DFDA 5FH7A 4YYKA 5A5PA 4YH4A 5DW1A 5I29A 5LKTA 5L98A 4PCEA 5CUAA 5FB1A 4CFLA 5CPEA 5I40A 4QR3A 2RFJA 4AKNA 5FH8A 2L84A 4FLPA 4QC1A 4PKLA 4NR6A 5D0CA 4BW4A 5D3LA 5DY7A 5FFVA 5J0DA 5HRVA 4BHWA 4OGIA 5LKZA 4IOOA 4Y03A 5HRWA 2RNXA 5I7XA 2WP2A 4YBSA 2R0VA 4YBTA 2DKWA 4QR5A 4YH3A 4QSWA 5D3HA 5HFRA 5C8GA 5AD2A 5E3DA 5ENHA 5L96A 4J3IA 5D3RA 5EPBA 2RS9B 5HQ5A 4O71A 3UW9A 5F63A 5E9VA 2F6NA 2GRCA 5H1UA 4O7BA 4WHWA 2RI7A 4CUPA 5EWCA 5BT5A 4HXOA 4LYWA 4NR8A 5FE8A 5FFYA 3RCWA 5HLSA 4QEUA 5ENGA 4ZC9A 3UV2A 5D24A 4HBWA 2F6JA 5EPSA 2E7OA 5EP7A 1WUGA 5HRXA 3UVYA 4QSRA 3QZSA 4O7FA 4QSSA 5EK9A 3O35A 5IBNA 3FKMX 5EV9A 3O37A 5DYXA 4QSXA 5G4SA 5I89A 3MB4A 4NR7A 5CQ7A 4N3WA 4NYVA 2DWWA 4XY8A 4E96A 3JVMA 3NXBA 5ENCA 4TZ2A 4LYIA 4YATA 5DLZA 2DVRA 3U5LA 5E9IA 3DAIA 4UIYA 4J0RA 3QZTA 4IOQA 4TT6A 5A5QA 2OUOA 5DYUA 5ENBA 5FDZA 5CFWA 5HFQA 5FE4A 3UV4A 4O7EA 4MEPA 5FB0A 5HQ7A 3I3JA 5KTXA 4A9FA 5KU3A 5KTUA 4NUEA 3JVJA 4MR6A 5CRZA 5FG4A 5LJ0A 5D3TA 3MUKA 4N4GA 5HCLA 5FBXA 5COIA 5CY9A 4TU6A 4TYLA 4ALHA 5II1A 2R0YA 5I1QA 5L99A 4ALGA 5LVRA 4HXMA 4YYHA 4QSTA 4TT4A 3U5JA 4YABA 5FE3A 2YYNA 3MQMA 5FE1A 2DVVA 4A9MA 4NXJA 5EPRA 4A9NA 3P1FA 4UYHA 2RNYA 4HXPA 5F5ZA 5LKUA 4Z1QA 4BJXA 5IGKA 5C87A 4XYAA 4QSVA 4IR6A 4CFKA 4HXNA 3K2JA 3U5PA 5AD3A 4HXRA 4CUUA 5CTLA 5EICA 2RNWA 4J1PA 2OSSA 3UVDA 4MR4A 4Z1SA 5CU8A 5EQ1A 3G0LA 4MR5A 3HMHA 5EWDA 4QSPA 4HXSA 4J0SA 3ONIA 4O76A 5F1LA 5IG6A 4PCIA 3LQHA 5EA1A 4NYXA 5ENFA 3HMEA 5KO4A 4LZ2A 4A9IA 4N4IA 5CZGA 5AMEA 5HQ6A 5DYAA 2NXBA 2LSPB 4YK0A 4UYDA 3TLPA 2YEKA 3ZYUA 5C4QA 4MENA 4TQNA 4A9OA 5EI4A 5LVQA 1JM4B 2YELA 4YYJA 4YYNA 3S92A 4QR4A 3Q2EA 5H1VA 5DKDA 3U5KA 4DONA 4TT2A 4BW2A 5ENEA 5ACYA 4Z6IA 3U5MA 2N9GA 5CP5A 2YW5A 4LZSA 4NUDA 4NS5A 4UYGA 4YYMA 4O78A 5HEMA 4CUSA 3AADA 4A9HA 4MR3A 5DKCA 5H1TA 5CQ4A 5E9KA 4XY9A 5E9LA 4WIVA 5ETDA 4HBYA 4LDFA 1E6IA 4UYFA 2DVQA 5C7NA 4YYDA 4YY6A 2E7NA 2D9EA 3P1DA 4QC3A 5LUUA 5D3SA 4QB3A 1X0JA 5BT4A 3MB3A 5DBMA 5IGMA 1EQFA 5CQ3A 5KHMA 4LR6A 5CS8A 5DKHA 3MXFA 4QUUA 5D3JA 3LJWA 3GG3A 5F60A 5CRMA 4CUQA 3S91A 5E9MA 5F62A 5IGNA 4O70A 5A82A 5CQ8A 3UVWA 3SVHA 4TU4A 5DFCA 4CURA 5D25A 5HJCA 5FG5A 1ZS5A 4HBVA 4NQNA 3LXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A5R A;  4NRC A;  5A5N A;  5FFW A;  2FSA A;  3SVG A;  5I80 A;  3P1E A;  5D3N A;  5IGL A;  5A81 A;  5EWW A;  3O34 A;  3JVK A;  4A9J A;  5E74 A;  4NYW A;  4KV4 A;  4IR5 A;  5E73 A;  4BW1 A;  5I88 A;  4LC2 A;  5C89 A;  4NR5 A;  5F1H A;  5LKX A;  5EWV A;  5CGP A;  2L5E A;  2I8N A;  2YEM A;  5I7Y A;  1F68 A;  4UYF B;  4XUA A;  4F3I A;  2WP1 A;  2YDW A;  5E9Y A;  5KTW A;  2MJV B;  3D7C A;  4PTB A;  3DWY A;  3JVL A;  3Q2F A;  4NRA A;  3MUL A;  2R10 A;  2YQD A;  4UIW A;  5A5S A;  4LZR A;  5LJ2 A;  5F36 A;  5F25 A;  5DX4 A;  4UIZ A;  2H60 A;  1WUM A;  5HEN A;  5FE5 A;  4QSQ A;  3G0J A;  4UIX A;  2D82 A;  5LJ1 A;  2R0S A;  5D26 A;  4O75 A;  2RO1 A;  3LQJ A;  4N4H A;  5A85 A;  2I7K A;  4NR9 A;  4QEV A;  4CL9 A;  5E0R A;  5L8T A;  5CUC A;  4O7A A;  5EVA A;  4TZ8 A;  5CQA A;  5HM0 A;  4MEO A;  4Z6H A;  4YAD A;  5K29 A;  4Q0O A;  4O77 A;  4OUF A;  4QYD A;  3HMF A;  4X2I A;  5IID A;  4IOR A;  4NRB A;  2E3K A;  5FE2 A;  4QNS A;  5DFB A;  4YY4 A;  4LRG A;  2DVS A;  4RVR A;  4QY4 A;  5EWH A;  5FE9 A;  5JWM A;  4MEQ A;  4Z93 A;  4PY6 A;  4HXK A;  5CQ6 A;  5L97 A;  4NQM A;  4LYS A;  5EM3 A;  5ENJ A;  5CUG A;  5L8U A;  4PS5 A;  4WHU A;  5C85 A;  3AQA A;  4YYG A;  4O72 A;  4YAX A;  5FE6 A;  3QZV A;  4NR4 A;  5BT3 A;  3U5O A;  3O33 A;  5D3P A;  3O36 A;  3P5O A;  4GPJ A;  5DW2 A;  4N4F A;  5CQT A;  3UV5 A;  4A9E A;  4IR4 A;  5TB6 A;  4A9K A;  3IU6 A;  4NUC A;  5F61 A;  3U5N A;  4QEW A;  5F3A A;  5FH6 A;  4CLB A;  5CQ5 A;  5II2 A;  3UVX A;  4HBX A;  5DLX A;  5HEL A;  3P1C A;  2KTB B;  5E3G A;  5I86 A;  4Q0N A;  4QYL A;  5CUB A;  1N72 A;  5CUD A;  5E7D A;  5EU1 A;  4YYI A;  5JI8 A;  5FE7 A;  4UIU A;  5TCM A;  5CUE A;  4O74 A;  2OO1 A;  5D7X A;  5EGU A;  4QBM A;  5A83 A;  3LQI A;  4TS8 A;  2G4A A;  4UIV A;  4HXL A;  4CUT A;  5EIS A;  4UYE A;  5A5O A;  4IR3 A;  4QZS A;  4A9L A;  2L85 A;  4YBM A;  5G4R A;  4OGJ A;  4C66 A;  1JSP B;  3IU5 A;  4KCX A;  4KV1 A;  5I83 A;  5FE0 A;  5ETB A;  4QUT A;  4QSU A;  4XUB A;  4YC9 A;  5AMF A;  5F2P A;  4O7C A;  5FG6 A;  4UIT A;  3SVF A;  5A7C A;  2DAT A;  4ZW1 A;  4TTE A;  5ENI A;  4BW3 A;  5H85 A;  4C67 A;  4ZQL A;  5DYC A;  5DFD A;  5FH7 A;  4YYK A;  5A5P A;  4YH4 A;  5DW1 A;  5I29 A;  5LKT A;  5L98 A;  4PCE A;  5CUA A;  5FB1 A;  4CFL A;  5CPE A;  5I40 A;  4QR3 A;  2RFJ A;  4AKN A;  5FH8 A;  2L84 A;  4FLP A;  4QC1 A;  4PKL A;  4NR6 A;  5D0C A;  4BW4 A;  5D3L A;  5DY7 A;  5FFV A;  5J0D A;  5HRV A;  4BHW A;  4OGI A;  5LKZ A;  4IOO A;  4Y03 A;  5HRW A;  2RNX A;  5I7X A;  2WP2 A;  4YBS A;  2R0V A;  4YBT A;  2DKW A;  4QR5 A;  4YH3 A;  4QSW A;  5D3H A;  5HFR A;  5C8G A;  5AD2 A;  5E3D A;  5ENH A;  5L96 A;  4J3I A;  5D3R A;  5EPB A;  2RS9 B;  5HQ5 A;  4O71 A;  3UW9 A;  5F63 A;  5E9V A;  2F6N A;  2GRC A;  5H1U A;  4O7B A;  4WHW A;  2RI7 A;  4CUP A;  5EWC A;  5BT5 A;  4HXO A;  4LYW A;  4NR8 A;  5FE8 A;  5FFY A;  3RCW A;  5HLS A;  4QEU A;  5ENG A;  4ZC9 A;  3UV2 A;  5D24 A;  4HBW A;  2F6J A;  5EPS A;  2E7O A;  5EP7 A;  1WUG A;  5HRX A;  3UVY A;  4QSR A;  3QZS A;  4O7F A;  4QSS A;  5EK9 A;  3O35 A;  5IBN A;  3FKM X;  5EV9 A;  3O37 A;  5DYX A;  4QSX A;  5G4S A;  5I89 A;  3MB4 A;  4NR7 A;  5CQ7 A;  4N3W A;  4NYV A;  2DWW A;  4XY8 A;  4E96 A;  3JVM A;  3NXB A;  5ENC A;  4TZ2 A;  4LYI A;  4YAT A;  5DLZ A;  2DVR A;  3U5L A;  5E9I A;  3DAI A;  4UIY A;  4J0R A;  3QZT A;  4IOQ A;  4TT6 A;  5A5Q A;  2OUO A;  5DYU A;  5ENB A;  5FDZ A;  5CFW A;  5HFQ A;  5FE4 A;  3UV4 A;  4O7E A;  4MEP A;  5FB0 A;  5HQ7 A;  3I3J A;  5KTX A;  4A9F A;  5KU3 A;  5KTU A;  4NUE A;  3JVJ A;  4MR6 A;  5CRZ A;  5FG4 A;  5LJ0 A;  5D3T A;  3MUK A;  4N4G A;  5HCL A;  5FBX A;  5COI A;  5CY9 A;  4TU6 A;  4TYL A;  4ALH A;  5II1 A;  2R0Y A;  5I1Q A;  5L99 A;  4ALG A;  5LVR A;  4HXM A;  4YYH A;  4QST A;  4TT4 A;  3U5J A;  4YAB A;  5FE3 A;  2YYN A;  3MQM A;  5FE1 A;  2DVV A;  4A9M A;  4NXJ A;  5EPR A;  4A9N A;  3P1F A;  4UYH A;  2RNY A;  4HXP A;  5F5Z A;  5LKU A;  4Z1Q A;  4BJX A;  5IGK A;  5C87 A;  4XYA A;  4QSV A;  4IR6 A;  4CFK A;  4HXN A;  3K2J A;  3U5P A;  5AD3 A;  4HXR A;  4CUU A;  5CTL A;  5EIC A;  2RNW A;  4J1P A;  2OSS A;  3UVD A;  4MR4 A;  4Z1S A;  5CU8 A;  5EQ1 A;  3G0L A;  4MR5 A;  3HMH A;  5EWD A;  4QSP A;  4HXS A;  4J0S A;  3ONI A;  4O76 A;  5F1L A;  5IG6 A;  4PCI A;  3LQH A;  5EA1 A;  4NYX A;  5ENF A;  3HME A;  5KO4 A;  4LZ2 A;  4A9I A;  4N4I A;  5CZG A;  5AME A;  5HQ6 A;  5DYA A;  2NXB A;  2LSP B;  4YK0 A;  4UYD A;  3TLP A;  2YEK A;  3ZYU A;  5C4Q A;  4MEN A;  4TQN A;  4A9O A;  5EI4 A;  5LVQ A;  1JM4 B;  2YEL A;  4YYJ A;  4YYN A;  3S92 A;  4QR4 A;  3Q2E A;  5H1V A;  5DKD A;  3U5K A;  4DON A;  4TT2 A;  4BW2 A;  5ENE A;  5ACY A;  4Z6I A;  3U5M A;  2N9G A;  5CP5 A;  2YW5 A;  4LZS A;  4NUD A;  4NS5 A;  4UYG A;  4YYM A;  4O78 A;  5HEM A;  4CUS A;  3AAD A;  4A9H A;  4MR3 A;  5DKC A;  5H1T A;  5CQ4 A;  5E9K A;  4XY9 A;  5E9L A;  4WIV A;  5ETD A;  4HBY A;  4LDF A;  1E6I A;  4UYF A;  2DVQ A;  5C7N A;  4YYD A;  4YY6 A;  2E7N A;  2D9E A;  3P1D A;  4QC3 A;  5LUU A;  5D3S A;  4QB3 A;  1X0J A;  5BT4 A;  3MB3 A;  5DBM A;  5IGM A;  1EQF A;  5CQ3 A;  5KHM A;  4LR6 A;  5CS8 A;  5DKH A;  3MXF A;  4QUU A;  5D3J A;  3LJW A;  3GG3 A;  5F60 A;  5CRM A;  4CUQ A;  3S91 A;  5E9M A;  5F62 A;  5IGN A;  4O70 A;  5A82 A;  5CQ8 A;  3UVW A;  3SVH A;  4TU4 A;  5DFC A;  4CUR A;  5D25 A;  5HJC A;  5FG5 A;  1ZS5 A;  4HBV A;  4NQN A;  3LXJ A; 
#chains in the Genus database with same CATH topology
 5A5R A;  4NRC A;  5A5N A;  5FFW A;  2FSA A;  3SVG A;  5I80 A;  3P1E A;  5D3N A;  5IGL A;  5A81 A;  5EWW A;  3ERR A;  3O34 A;  3JVK A;  4A9J A;  5E74 A;  4NYW A;  4KV4 A;  4IR5 A;  5E73 A;  4BW1 A;  5I88 A;  4LC2 A;  3VKG A;  5C89 A;  4NR5 A;  5F1H A;  5LKX A;  5EWV A;  5CGP A;  2L5E A;  2I8N A;  2YEM A;  5I7Y A;  1F68 A;  4UYF B;  4XUA A;  4F3I A;  2WP1 A;  2YDW A;  5E9Y A;  5KTW A;  2MJV B;  3D7C A;  4PTB A;  3DWY A;  3JVL A;  3Q2F A;  4NRA A;  3MUL A;  2R10 A;  2YQD A;  4UIW A;  5A5S A;  4LZR A;  5LJ2 A;  5F36 A;  5F25 A;  5DX4 A;  4UIZ A;  2H60 A;  1WUM A;  5HEN A;  5FE5 A;  4QSQ A;  3G0J A;  4UIX A;  2D82 A;  5LJ1 A;  2R0S A;  5D26 A;  4O75 A;  2RO1 A;  3LQJ A;  4N4H A;  5A85 A;  2I7K A;  4NR9 A;  4QEV A;  4CL9 A;  5E0R A;  5L8T A;  5CUC A;  4O7A A;  5EVA A;  4TZ8 A;  5CQA A;  5HM0 A;  4MEO A;  4Z6H A;  4YAD A;  5K29 A;  4Q0O A;  4O77 A;  4OUF A;  4QYD A;  3HMF A;  4X2I A;  5IID A;  4IOR A;  4NRB A;  2E3K A;  5FE2 A;  4QNS A;  5DFB A;  4YY4 A;  4LRG A;  2DVS A;  4RVR A;  4QY4 A;  5EWH A;  5FE9 A;  5JWM A;  4MEQ A;  4Z93 A;  4PY6 A;  4HXK A;  5CQ6 A;  5L97 A;  4NQM A;  4LYS A;  5EM3 A;  5ENJ A;  5CUG A;  5L8U A;  4PS5 A;  4WHU A;  5C85 A;  3AQA A;  4YYG A;  4O72 A;  4YAX A;  5FE6 A;  4AKH A;  3QZV A;  4NR4 A;  5BT3 A;  3U5O A;  3O33 A;  5D3P A;  3O36 A;  3P5O A;  4GPJ A;  5DW2 A;  4N4F A;  5CQT A;  3UV5 A;  4A9E A;  4IR4 A;  5TB6 A;  4A9K A;  3IU6 A;  4NUC A;  5F61 A;  3U5N A;  4QEW A;  5F3A A;  5FH6 A;  4CLB A;  5CQ5 A;  5II2 A;  3UVX A;  4HBX A;  5DLX A;  5HEL A;  3P1C A;  2KTB B;  5E3G A;  5I86 A;  4Q0N A;  4QYL A;  5CUB A;  1N72 A;  5CUD A;  1PUO A;  5E7D A;  5EU1 A;  4YYI A;  5JI8 A;  5FE7 A;  4UIU A;  5TCM A;  5CUE A;  4O74 A;  2OO1 A;  5D7X A;  5EGU A;  4QBM A;  5A83 A;  3LQI A;  4TS8 A;  2G4A A;  4UIV A;  4HXL A;  4CUT A;  5EIS A;  4UYE A;  5A5O A;  4IR3 A;  4QZS A;  4A9L A;  2L85 A;  4YBM A;  5G4R A;  4OGJ A;  4C66 A;  1JSP B;  3IU5 A;  4KCX A;  4KV1 A;  5I83 A;  5FE0 A;  5ETB A;  4QUT A;  4QSU A;  4XUB A;  4YC9 A;  5AMF A;  5F2P A;  4O7C A;  5FG6 A;  4UIT A;  3SVF A;  5A7C A;  2DAT A;  4ZW1 A;  4TTE A;  5ENI A;  4BW3 A;  5H85 A;  4C67 A;  4ZQL A;  5DYC A;  5DFD A;  5FH7 A;  4YYK A;  5A5P A;  4YH4 A;  5DW1 A;  5I29 A;  5LKT A;  5L98 A;  4PCE A;  5CUA A;  5FB1 A;  4CFL A;  5CPE A;  5I40 A;  4QR3 A;  2RFJ A;  4AKN A;  5FH8 A;  2L84 A;  4FLP A;  4QC1 A;  4PKL A;  4NR6 A;  5D0C A;  4BW4 A;  5D3L A;  5DY7 A;  5FFV A;  5J0D A;  5HRV A;  4BHW A;  4OGI A;  5LKZ A;  3VKH A;  4IOO A;  4Y03 A;  5HRW A;  2RNX A;  5I7X A;  2WP2 A;  4YBS A;  2R0V A;  4YBT A;  2DKW A;  4QR5 A;  4YH3 A;  4QSW A;  5D3H A;  5HFR A;  5C8G A;  5AD2 A;  5E3D A;  5ENH A;  5L96 A;  4J3I A;  5D3R A;  5EPB A;  2RS9 B;  5HQ5 A;  4O71 A;  3UW9 A;  5F63 A;  5E9V A;  2F6N A;  2GRC A;  5H1U A;  4O7B A;  4WHW A;  2RI7 A;  4CUP A;  5EWC A;  5BT5 A;  4HXO A;  4LYW A;  4NR8 A;  5FE8 A;  5FFY A;  3RCW A;  5HLS A;  4QEU A;  5ENG A;  4ZC9 A;  3UV2 A;  5D24 A;  4HBW A;  2F6J A;  5EPS A;  2E7O A;  3D1D A;  5EP7 A;  1WUG A;  5HRX A;  4AKG A;  3UVY A;  4QSR A;  3QZS A;  4O7F A;  4QSS A;  5EK9 A;  3O35 A;  5IBN A;  3FKM X;  5EV9 A;  3O37 A;  5DYX A;  4QSX A;  5G4S A;  5I89 A;  3MB4 A;  4NR7 A;  5CQ7 A;  4N3W A;  4NYV A;  2DWW A;  4XY8 A;  4E96 A;  3JVM A;  3NXB A;  5ENC A;  4TZ2 A;  4LYI A;  4YAT A;  5DLZ A;  2DVR A;  3U5L A;  5E9I A;  3DAI A;  4UIY A;  4J0R A;  1ZKR A;  3QZT A;  4IOQ A;  4TT6 A;  5A5Q A;  2OUO A;  5DYU A;  5ENB A;  5FDZ A;  5CFW A;  5HFQ A;  5FE4 A;  3UV4 A;  4O7E A;  4MEP A;  5FB0 A;  5HQ7 A;  3I3J A;  5KTX A;  4A9F A;  5KU3 A;  5KTU A;  4NUE A;  3JVJ A;  4MR6 A;  5CRZ A;  5FG4 A;  5LJ0 A;  5D3T A;  3MUK A;  4N4G A;  5HCL A;  5FBX A;  5COI A;  5CY9 A;  4TU6 A;  4TYL A;  4ALH A;  5II1 A;  2R0Y A;  5I1Q A;  5L99 A;  4ALG A;  5LVR A;  4HXM A;  4YYH A;  4QST A;  4TT4 A;  3U5J A;  4YAB A;  5FE3 A;  2YYN A;  3MQM A;  5FE1 A;  2DVV A;  4A9M A;  4NXJ A;  5EPR A;  4A9N A;  3P1F A;  4UYH A;  2RNY A;  4HXP A;  5F5Z A;  5LKU A;  4Z1Q A;  4BJX A;  5IGK A;  5C87 A;  4XYA A;  4QSV A;  4IR6 A;  4CFK A;  4HXN A;  3K2J A;  3U5P A;  5AD3 A;  4HXR A;  4CUU A;  5CTL A;  5EIC A;  2RNW A;  4J1P A;  2OSS A;  3UVD A;  4MR4 A;  4Z1S A;  5CU8 A;  5EQ1 A;  3G0L A;  4MR5 A;  3HMH A;  5EWD A;  4QSP A;  4HXS A;  4J0S A;  3ONI A;  4O76 A;  5F1L A;  5IG6 A;  4PCI A;  3LQH A;  5EA1 A;  4NYX A;  5ENF A;  3HME A;  5KO4 A;  4LZ2 A;  4A9I A;  4N4I A;  5CZG A;  5AME A;  5HQ6 A;  5DYA A;  2NXB A;  2LSP B;  4YK0 A;  4UYD A;  3TLP A;  2YEK A;  3ZYU A;  5C4Q A;  4MEN A;  2EJN A;  4TQN A;  4A9O A;  5EI4 A;  5LVQ A;  1JM4 B;  2YEL A;  4YYJ A;  4YYN A;  3S92 A;  4QR4 A;  3Q2E A;  5H1V A;  5DKD A;  3U5K A;  4DON A;  4AKI A;  4TT2 A;  4BW2 A;  5ENE A;  5ACY A;  4Z6I A;  3D1B A;  3U5M A;  2N9G A;  5CP5 A;  2YW5 A;  4LZS A;  4NUD A;  4NS5 A;  4UYG A;  4YYM A;  4AI6 A;  4O78 A;  5HEM A;  4CUS A;  3AAD A;  4A9H A;  4MR3 A;  5DKC A;  5H1T A;  5CQ4 A;  5E9K A;  4XY9 A;  5E9L A;  4WIV A;  5ETD A;  4HBY A;  4LDF A;  1E6I A;  4UYF A;  2DVQ A;  5C7N A;  4YYD A;  4YY6 A;  2E7N A;  2D9E A;  3P1D A;  4QC3 A;  5LUU A;  5D3S A;  4QB3 A;  1X0J A;  5BT4 A;  3MB3 A;  5DBM A;  5IGM A;  1EQF A;  5CQ3 A;  5KHM A;  4LR6 A;  5CS8 A;  5DKH A;  3MXF A;  4QUU A;  5D3J A;  3LJW A;  3GG3 A;  5F60 A;  5CRM A;  4CUQ A;  3S91 A;  5E9M A;  5F62 A;  5IGN A;  4O70 A;  5A82 A;  5CQ8 A;  3UVW A;  3SVH A;  4TU4 A;  5DFC A;  4CUR A;  5D25 A;  5HJC A;  5FG5 A;  1ZS5 A;  4HBV A;  4NQN A;  3LXJ A; 
#chains in the Genus database with same CATH homology
 5A5R A;  4NRC A;  5A5N A;  5FFW A;  2FSA A;  3SVG A;  5I80 A;  3P1E A;  5D3N A;  5IGL A;  5A81 A;  5EWW A;  3O34 A;  3JVK A;  4A9J A;  5E74 A;  4NYW A;  4KV4 A;  4IR5 A;  5E73 A;  4BW1 A;  5I88 A;  4LC2 A;  5C89 A;  4NR5 A;  5F1H A;  5LKX A;  5EWV A;  5CGP A;  2L5E A;  2I8N A;  2YEM A;  5I7Y A;  1F68 A;  4UYF B;  4XUA A;  4F3I A;  2WP1 A;  2YDW A;  5E9Y A;  5KTW A;  2MJV B;  3D7C A;  4PTB A;  3DWY A;  3JVL A;  3Q2F A;  4NRA A;  3MUL A;  2R10 A;  2YQD A;  4UIW A;  5A5S A;  4LZR A;  5LJ2 A;  5F36 A;  5F25 A;  5DX4 A;  4UIZ A;  2H60 A;  1WUM A;  5HEN A;  5FE5 A;  4QSQ A;  3G0J A;  4UIX A;  2D82 A;  5LJ1 A;  2R0S A;  5D26 A;  4O75 A;  2RO1 A;  3LQJ A;  4N4H A;  5A85 A;  2I7K A;  4NR9 A;  4QEV A;  4CL9 A;  5E0R A;  5L8T A;  5CUC A;  4O7A A;  5EVA A;  4TZ8 A;  5CQA A;  5HM0 A;  4MEO A;  4Z6H A;  4YAD A;  5K29 A;  4Q0O A;  4O77 A;  4OUF A;  4QYD A;  3HMF A;  4X2I A;  5IID A;  4IOR A;  4NRB A;  2E3K A;  5FE2 A;  4QNS A;  5DFB A;  4YY4 A;  4LRG A;  2DVS A;  4RVR A;  4QY4 A;  5EWH A;  5FE9 A;  5JWM A;  4MEQ A;  4Z93 A;  4PY6 A;  4HXK A;  5CQ6 A;  5L97 A;  4NQM A;  4LYS A;  5EM3 A;  5ENJ A;  5CUG A;  5L8U A;  4PS5 A;  4WHU A;  5C85 A;  3AQA A;  4YYG A;  4O72 A;  4YAX A;  5FE6 A;  3QZV A;  4NR4 A;  5BT3 A;  3U5O A;  3O33 A;  5D3P A;  3O36 A;  3P5O A;  4GPJ A;  5DW2 A;  4N4F A;  5CQT A;  3UV5 A;  4A9E A;  4IR4 A;  5TB6 A;  4A9K A;  3IU6 A;  4NUC A;  5F61 A;  3U5N A;  4QEW A;  5F3A A;  5FH6 A;  4CLB A;  5CQ5 A;  5II2 A;  3UVX A;  4HBX A;  5DLX A;  5HEL A;  3P1C A;  2KTB B;  5E3G A;  5I86 A;  4Q0N A;  4QYL A;  5CUB A;  1N72 A;  5CUD A;  5E7D A;  5EU1 A;  4YYI A;  5JI8 A;  5FE7 A;  4UIU A;  5TCM A;  5CUE A;  4O74 A;  2OO1 A;  5D7X A;  5EGU A;  4QBM A;  5A83 A;  3LQI A;  4TS8 A;  2G4A A;  4UIV A;  4HXL A;  4CUT A;  5EIS A;  4UYE A;  5A5O A;  4IR3 A;  4QZS A;  4A9L A;  2L85 A;  4YBM A;  5G4R A;  4OGJ A;  4C66 A;  1JSP B;  3IU5 A;  4KCX A;  4KV1 A;  5I83 A;  5FE0 A;  5ETB A;  4QUT A;  4QSU A;  4XUB A;  4YC9 A;  5AMF A;  5F2P A;  4O7C A;  5FG6 A;  4UIT A;  3SVF A;  5A7C A;  2DAT A;  4ZW1 A;  4TTE A;  5ENI A;  4BW3 A;  5H85 A;  4C67 A;  4ZQL A;  5DYC A;  5DFD A;  5FH7 A;  4YYK A;  5A5P A;  4YH4 A;  5DW1 A;  5I29 A;  5LKT A;  5L98 A;  4PCE A;  5CUA A;  5FB1 A;  4CFL A;  5CPE A;  5I40 A;  4QR3 A;  2RFJ A;  4AKN A;  5FH8 A;  2L84 A;  4FLP A;  4QC1 A;  4PKL A;  4NR6 A;  5D0C A;  4BW4 A;  5D3L A;  5DY7 A;  5FFV A;  5J0D A;  5HRV A;  4BHW A;  4OGI A;  5LKZ A;  4IOO A;  4Y03 A;  5HRW A;  2RNX A;  5I7X A;  2WP2 A;  4YBS A;  2R0V A;  4YBT A;  2DKW A;  4QR5 A;  4YH3 A;  4QSW A;  5D3H A;  5HFR A;  5C8G A;  5AD2 A;  5E3D A;  5ENH A;  5L96 A;  4J3I A;  5D3R A;  5EPB A;  2RS9 B;  5HQ5 A;  4O71 A;  3UW9 A;  5F63 A;  5E9V A;  2F6N A;  2GRC A;  5H1U A;  4O7B A;  4WHW A;  2RI7 A;  4CUP A;  5EWC A;  5BT5 A;  4HXO A;  4LYW A;  4NR8 A;  5FE8 A;  5FFY A;  3RCW A;  5HLS A;  4QEU A;  5ENG A;  4ZC9 A;  3UV2 A;  5D24 A;  4HBW A;  2F6J A;  5EPS A;  2E7O A;  5EP7 A;  1WUG A;  5HRX A;  3UVY A;  4QSR A;  3QZS A;  4O7F A;  4QSS A;  5EK9 A;  3O35 A;  5IBN A;  3FKM X;  5EV9 A;  3O37 A;  5DYX A;  4QSX A;  5G4S A;  5I89 A;  3MB4 A;  4NR7 A;  5CQ7 A;  4N3W A;  4NYV A;  2DWW A;  4XY8 A;  4E96 A;  3JVM A;  3NXB A;  5ENC A;  4TZ2 A;  4LYI A;  4YAT A;  5DLZ A;  2DVR A;  3U5L A;  5E9I A;  3DAI A;  4UIY A;  4J0R A;  3QZT A;  4IOQ A;  4TT6 A;  5A5Q A;  2OUO A;  5DYU A;  5ENB A;  5FDZ A;  5CFW A;  5HFQ A;  5FE4 A;  3UV4 A;  4O7E A;  4MEP A;  5FB0 A;  5HQ7 A;  3I3J A;  5KTX A;  4A9F A;  5KU3 A;  5KTU A;  4NUE A;  3JVJ A;  4MR6 A;  5CRZ A;  5FG4 A;  5LJ0 A;  5D3T A;  3MUK A;  4N4G A;  5HCL A;  5FBX A;  5COI A;  5CY9 A;  4TU6 A;  4TYL A;  4ALH A;  5II1 A;  2R0Y A;  5I1Q A;  5L99 A;  4ALG A;  5LVR A;  4HXM A;  4YYH A;  4QST A;  4TT4 A;  3U5J A;  4YAB A;  5FE3 A;  2YYN A;  3MQM A;  5FE1 A;  2DVV A;  4A9M A;  4NXJ A;  5EPR A;  4A9N A;  3P1F A;  4UYH A;  2RNY A;  4HXP A;  5F5Z A;  5LKU A;  4Z1Q A;  4BJX A;  5IGK A;  5C87 A;  4XYA A;  4QSV A;  4IR6 A;  4CFK A;  4HXN A;  3K2J A;  3U5P A;  5AD3 A;  4HXR A;  4CUU A;  5CTL A;  5EIC A;  2RNW A;  4J1P A;  2OSS A;  3UVD A;  4MR4 A;  4Z1S A;  5CU8 A;  5EQ1 A;  3G0L A;  4MR5 A;  3HMH A;  5EWD A;  4QSP A;  4HXS A;  4J0S A;  3ONI A;  4O76 A;  5F1L A;  5IG6 A;  4PCI A;  3LQH A;  5EA1 A;  4NYX A;  5ENF A;  3HME A;  5KO4 A;  4LZ2 A;  4A9I A;  4N4I A;  5CZG A;  5AME A;  5HQ6 A;  5DYA A;  2NXB A;  2LSP B;  4YK0 A;  4UYD A;  3TLP A;  2YEK A;  3ZYU A;  5C4Q A;  4MEN A;  4TQN A;  4A9O A;  5EI4 A;  5LVQ A;  1JM4 B;  2YEL A;  4YYJ A;  4YYN A;  3S92 A;  4QR4 A;  3Q2E A;  5H1V A;  5DKD A;  3U5K A;  4DON A;  4TT2 A;  4BW2 A;  5ENE A;  5ACY A;  4Z6I A;  3U5M A;  2N9G A;  5CP5 A;  2YW5 A;  4LZS A;  4NUD A;  4NS5 A;  4UYG A;  4YYM A;  4O78 A;  5HEM A;  4CUS A;  3AAD A;  4A9H A;  4MR3 A;  5DKC A;  5H1T A;  5CQ4 A;  5E9K A;  4XY9 A;  5E9L A;  4WIV A;  5ETD A;  4HBY A;  4LDF A;  1E6I A;  4UYF A;  2DVQ A;  5C7N A;  4YYD A;  4YY6 A;  2E7N A;  2D9E A;  3P1D A;  4QC3 A;  5LUU A;  5D3S A;  4QB3 A;  1X0J A;  5BT4 A;  3MB3 A;  5DBM A;  5IGM A;  1EQF A;  5CQ3 A;  5KHM A;  4LR6 A;  5CS8 A;  5DKH A;  3MXF A;  4QUU A;  5D3J A;  3LJW A;  3GG3 A;  5F60 A;  5CRM A;  4CUQ A;  3S91 A;  5E9M A;  5F62 A;  5IGN A;  4O70 A;  5A82 A;  5CQ8 A;  3UVW A;  3SVH A;  4TU4 A;  5DFC A;  4CUR A;  5D25 A;  5HJC A;  5FG5 A;  1ZS5 A;  4HBV A;  4NQN A;  3LXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...