3MB4A

Crystal structure of the fifth bromodomain of human poly-bromodomain containing protein 1 (pb1) with nmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
115
structure length
115
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3mb4A00
2RO1A 5HQ5A 4QNSA 2DVQA 2GRCA 4QUUA 2RNYA 4UYDA 4UYHA 5IG6A 4HXRA 4QSTA 4LYWA 4UIVA 5EQ1A 5F61A 5CQ7A 5D3TA 4Z1QA 5DW1A 3UVYA 3GG3A 4LZ2A 4A9JA 5KTWA 5CS8A 4J3IA 4QR3A 3UV5A 4UYEA 4IR6A 5HLSA 5CUEA 5I83A 4QYDA 5A5SA 5IIDA 5EA1A 5FG6A 5E7DA 4C66A 4WHWA 4N4HA 4CUPA 4O77A 5FH8A 4A9FA 3QZVA 4A9LA 2RI7A 4NS5A 3LXJA 4N4IA 1JSPB 2N9GA 2YYNA 4QSXA 5II2A 4TYLA 4NYXA 3UVXA 5C8GA 4YBTA 2E7OA 4PY6A 5EU1A 4A9KA 4AKNA 5ENHA 4MEQA 5I89A 4QZSA 5DYXA 4KV4A 4CLBA 2YDWA 5IGNA 4TS8A 2D9EA 5EM3A 4LZSA 4O7EA 5E74A 5I7XA 5CTLA 5IGMA 4XUBA 3O35A 5LJ1A 5DW2A 4CFKA 5L8TA 5I1QA 5HRXA 5CQ4A 4IR4A 5DLXA 3P1CA 5CUDA 4PCEA 2YELA 5D3HA 3MUKA 5ENGA 5EWWA 4QSWA 5HFQA 4IR5A 4O7AA 4YYGA 5F36A 4UIZA 3K2JA 4LYSA 1X0JA 2I7KA 4Z1SA 5H1TA 4KCXA 3UW9A 5CFWA 5FE1A 4NRCA 5FE6A 4WIVA 4MR6A 5FE8A 3HMEA 3S92A 5AD2A 5F1HA 2OUOA 4QB3A 2KTBB 3HMFA 5CQ3A 5E9MA 4F3IA 5LKXA 4HXLA 4QUTA 4YY6A 5TB6A 5LVQA 5DBMA 5E9KA 5A5RA 4O76A 4YYHA 5EV9A 4N4GA 3O34A 4XY9A 5KTXA 5CUCA 2DVSA 4CURA 4OGJA 5EWCA 2YW5A 4O7FA 3U5OA 4Q0OA 5A5PA 3UVDA 5I88A 4YYMA 5H1VA 4TU4A 5COIA 5D7XA 5ENBA 5J0DA 5A7CA 1E6IA 4IR3A 5DKCA 3S91A 2RNXA 4BW3A 3U5PA 5IGLA 5E3DA 2G4AA 5EVAA 5FDZA 4NQMA 5HELA 5CUAA 5ENFA 4PS5A 5HQ7A 3SVHA 4QY4A 5K29A 3MB4A 5A85A 5FFYA 5CY9A 5G4SA 4O7BA 5E3GA 4UIUA 4O71A 5F1LA 4NR6A 4HBVA 4ZC9A 5E9YA 3I3JA 4MENA 4XY8A 3P1DA 5H85A 1WUMA 4FLPA 4QC1A 5E0RA 2WP1A 4O78A 1ZS5A 5LUUA 4NQNA 3JVMA 4ALGA 2OO1A 4YYIA 5DYAA 4QC3A 2RFJA 2YEKA 4WHUA 4MEOA 5EPRA 5HEMA 2DVRA 4BW4A 3RCWA 2NXBA 4J1PA 4Z6IA 5I80A 2R0VA 3JVKA 5A5NA 3ONIA 5HRVA 4DONA 5HCLA 5DYCA 5CPEA 4UIYA 2L5EA 5ENJA 5I86A 1EQFA 2MJVB 2RNWA 2R0SA 5L96A 5FE5A 5C85A 5D24A 4J0SA 4TU6A 5ACYA 4LYIA 4UITA 4HXKA 3U5NA 5FE2A 4XYAA 4QEVA 5A83A 5DLZA 5FH7A 4UIXA 5HENA 5CZGA 4QR4A 4TT2A 4CUQA 3AQAA 3IU5A 3O37A 5E73A 4CFLA 4A9MA 5DFBA 5FB1A 4ZW1A 3U5LA 4RVRA 4NR9A 4YYDA 4QEUA 5EWDA 2R0YA 2YQDA 5F60A 4MR5A 5I40A 5C7NA 4Z6HA 4QSVA 5CU8A 4NUDA 5EICA 4J0RA 4A9IA 4HXNA 5LJ0A 5D25A 4NR4A 5D3PA 4Y03A 5A5QA 2DATA 4TZ2A 4A9HA 5BT4A 5CGPA 5F25A 3DWYA 5C87A 3Q2FA 5LKTA 3JVJA 3UV4A 4O74A 4HBWA 5DYUA 4LZRA 2DVVA 2L84A 5A82A 5FBXA 5HFRA 4CL9A 5DX4A 4YYJA 5E9IA 4HXPA 3LQJA 4HXMA 5FE9A 4ZQLA 4IOOA 3MB3A 4NYWA 3G0LA 2L85A 5CUGA 2DKWA 5KTUA 3UV2A 5FE7A 4BJXA 4UYFB 2E7NA 4UYFA 4YC9A 3MULA 4YH3A 2I8NA 5HRWA 4UIWA 4NUEA 4IOQA 4NYVA 3U5KA 4YABA 5ETBA 4YK0A 5LJ2A 5CQ6A 3AADA 5EWHA 5FH6A 2F6NA 4C67A 4KV1A 2E3KA 5EPBA 4O72A 5BT5A 4QSUA 5FE3A 4LC2A 4NRBA 1JM4B 4TT4A 4LR6A 5E9LA 5F62A 5CUBA 5IGKA 4NXJA 4OGIA 5ENEA 4Q0NA 4N3WA 4YYKA 5D3SA 4NRAA 5L8UA 5I29A 5FE4A 3U5JA 2YEMA 4YAXA 4YBSA 4QSPA 3P1FA 5D3JA 5JWMA 3LJWA 4OUFA 3MXFA 5FG4A 4NUCA 4A9EA 4TQNA 4CUTA 5H1UA 3QZTA 5II1A 3Q2EA 4NR8A 5EISA 4O75A 5JI8A 4Z93A 3FKMX 4O70A 4NR5A 3U5MA 2WP2A 5TCMA 5FFWA 5FE0A 4QSSA 3UVWA 2OSSA 1WUGA 5EP7A 5ETDA 4QBMA 5F2PA 4E96A 4N4FA 5CQ8A 5EWVA 5F3AA 4A9NA 5L99A 4MR4A 4BW1A 4YH4A 5CRMA 5G4RA 2FSAA 5DFCA 3LQIA 5L97A 4MR3A 5HM0A 2F6JA 5FG5A 3SVGA 4LRGA 5CQAA 4HXSA 5FFVA 4YATA 2RS9B 4CUUA 4QR5A 4TT6A 5KU3A 5F63A 3NXBA 5ENIA 3QZSA 5E9VA 5EI4A 5F5ZA 5IBNA 5DKDA 4YBMA 4LDFA 5EK9A 5LKZA 4MEPA 4QSRA 2H60A 4GPJA 4NR7A 2DWWA 4ALHA 5LKUA 3TLPA 5DFDA 4QEWA 4X2IA 3P1EA 5C4QA 4PKLA 5D3NA 3D7CA 4YADA 5AMEA 5AD3A 3IU6A 5LVRA 2LSPB 3LQHA 2R10A 5AMFA 5CQTA 4HBXA 5CP5A 5C89A 4PTBA 5CQ5A 4BHWA 4HXOA 5FB0A 4PCIA 4YYNA 5D3RA 5ENCA 5DY7A 3MQMA 3ZYUA 5HQ6A 3P5OA 5KO4A 3JVLA 5D3LA 3DAIA 5I7YA 4XUAA 5D0CA 4HBYA 5DKHA 4QSQA 4TZ8A 5KHMA 4CUSA 2D82A 5EGUA 4UYGA 4BW2A 5A5OA 4A9OA 4QYLA 1N72A 5EPSA 5D26A 4YY4A 1F68A 3O36A 4TTEA 5BT3A 5A81A 5CRZA 3HMHA 5L98A 3G0JA 5HJCA 3O33A 4O7CA 3SVFA 4IORA
chains in the Genus database with same CATH superfamily
2RO1A 5HQ5A 4QNSA 2DVQA 2GRCA 4QUUA 2RNYA 4UYDA 4UYHA 5IG6A 4HXRA 4QSTA 4LYWA 4UIVA 5EQ1A 5F61A 5CQ7A 5D3TA 4Z1QA 5DW1A 3UVYA 3GG3A 4LZ2A 4A9JA 5KTWA 5CS8A 4J3IA 4QR3A 3UV5A 4UYEA 4IR6A 5HLSA 3VKGA 5CUEA 5I83A 4QYDA 5A5SA 5IIDA 5EA1A 5FG6A 5E7DA 4C66A 4WHWA 4N4HA 4CUPA 4O77A 5FH8A 4A9FA 3QZVA 4A9LA 2RI7A 4NS5A 3LXJA 4N4IA 1JSPB 2N9GA 2YYNA 4QSXA 5II2A 4TYLA 4NYXA 3UVXA 5C8GA 4YBTA 2E7OA 4PY6A 5EU1A 4A9KA 4AKNA 5ENHA 4MEQA 5I89A 4QZSA 5DYXA 4KV4A 4CLBA 2YDWA 5IGNA 4TS8A 2D9EA 5EM3A 4LZSA 4O7EA 5E74A 5I7XA 5CTLA 5IGMA 4XUBA 3O35A 5LJ1A 5DW2A 4CFKA 5L8TA 5I1QA 5HRXA 5CQ4A 4IR4A 5DLXA 3P1CA 5CUDA 4PCEA 2YELA 5D3HA 3MUKA 5ENGA 5EWWA 4QSWA 5HFQA 4IR5A 4O7AA 4YYGA 5F36A 4UIZA 3K2JA 4LYSA 1X0JA 2I7KA 4Z1SA 1PUOA 5H1TA 4KCXA 3UW9A 5CFWA 5FE1A 4NRCA 5FE6A 4WIVA 4MR6A 5FE8A 3HMEA 3S92A 5AD2A 5F1HA 2OUOA 4QB3A 2KTBB 3HMFA 5CQ3A 5E9MA 4F3IA 5LKXA 4HXLA 4QUTA 4YY6A 5TB6A 5LVQA 5DBMA 5E9KA 5A5RA 4O76A 4YYHA 5EV9A 4N4GA 3O34A 4XY9A 5KTXA 5CUCA 2DVSA 2EJNA 4OGJA 4CURA 5EWCA 2YW5A 4O7FA 3U5OA 4Q0OA 5A5PA 3UVDA 5I88A 4YYMA 5H1VA 4TU4A 5COIA 5D7XA 5ENBA 5J0DA 5A7CA 1E6IA 4IR3A 5DKCA 3S91A 2RNXA 4BW3A 3U5PA 5IGLA 5E3DA 2G4AA 5EVAA 5FDZA 4NQMA 5HELA 5CUAA 5ENFA 4PS5A 5HQ7A 3SVHA 4QY4A 5K29A 3MB4A 5A85A 5FFYA 5CY9A 5G4SA 4O7BA 5E3GA 4UIUA 4O71A 5F1LA 4NR6A 4HBVA 4ZC9A 5E9YA 3I3JA 4MENA 4XY8A 3P1DA 5H85A 1WUMA 4FLPA 4QC1A 5E0RA 2WP1A 4O78A 1ZS5A 5LUUA 4NQNA 3JVMA 4ALGA 2OO1A 4YYIA 5DYAA 4QC3A 2RFJA 2YEKA 4WHUA 4MEOA 5EPRA 5HEMA 2DVRA 4BW4A 3RCWA 2NXBA 4J1PA 4Z6IA 5I80A 2R0VA 3JVKA 5A5NA 3ONIA 5HRVA 4DONA 5HCLA 5DYCA 5CPEA 4UIYA 2L5EA 5ENJA 5I86A 1EQFA 2MJVB 2RNWA 2R0SA 5L96A 5FE5A 5C85A 5D24A 4J0SA 4TU6A 5ACYA 4LYIA 4UITA 4HXKA 3U5NA 5FE2A 4XYAA 4QEVA 5A83A 5DLZA 5FH7A 4UIXA 5HENA 5CZGA 4QR4A 4TT2A 4CUQA 3AQAA 3IU5A 3O37A 5E73A 4CFLA 4A9MA 5DFBA 5FB1A 4ZW1A 3U5LA 3D1BA 4RVRA 4NR9A 4YYDA 4QEUA 5EWDA 2R0YA 2YQDA 5F60A 4MR5A 5I40A 5C7NA 4Z6HA 4QSVA 5CU8A 4NUDA 5EICA 4J0RA 4A9IA 4HXNA 5LJ0A 5D25A 4NR4A 5D3PA 4Y03A 5A5QA 2DATA 4TZ2A 4A9HA 5BT4A 5CGPA 5F25A 3DWYA 5C87A 3Q2FA 5LKTA 3JVJA 1ZKRA 4O74A 4HBWA 5DYUA 3UV4A 4LZRA 2DVVA 2L84A 5A82A 5FBXA 5HFRA 4CL9A 5DX4A 4YYJA 5E9IA 4HXPA 3LQJA 4HXMA 5FE9A 4ZQLA 4IOOA 3MB3A 4NYWA 3G0LA 2L85A 5CUGA 2DKWA 5KTUA 3UV2A 5FE7A 4BJXA 4UYFB 2E7NA 4UYFA 4YC9A 3MULA 4YH3A 2I8NA 5HRWA 4UIWA 4NUEA 4IOQA 4NYVA 3U5KA 4YABA 5ETBA 4YK0A 5LJ2A 5CQ6A 3AADA 5EWHA 5FH6A 2F6NA 4C67A 4KV1A 2E3KA 5EPBA 4O72A 5BT5A 4QSUA 5FE3A 4LC2A 4NRBA 1JM4B 4TT4A 4LR6A 5E9LA 5F62A 5CUBA 5IGKA 4NXJA 4OGIA 5ENEA 4Q0NA 4N3WA 4YYKA 5D3SA 4NRAA 5L8UA 5I29A 5FE4A 3U5JA 4YAXA 2YEMA 4YBSA 4QSPA 3P1FA 5D3JA 5JWMA 3LJWA 4OUFA 3MXFA 5FG4A 4NUCA 4A9EA 4TQNA 4CUTA 3ERRA 5H1UA 3QZTA 5II1A 3Q2EA 4NR8A 5EISA 3D1DA 4O75A 5JI8A 4Z93A 3FKMX 4O70A 4NR5A 3U5MA 2WP2A 5TCMA 5FFWA 5FE0A 4QSSA 3UVWA 2OSSA 1WUGA 5EP7A 5ETDA 4QBMA 5F2PA 4AKIA 4E96A 4N4FA 5CQ8A 5EWVA 5F3AA 4A9NA 5L99A 4MR4A 4BW1A 4YH4A 5CRMA 5G4RA 2FSAA 5DFCA 3LQIA 5L97A 4MR3A 5HM0A 2F6JA 5FG5A 3SVGA 4LRGA 5CQAA 4HXSA 4AKGA 5FFVA 4YATA 2RS9B 4CUUA 4QR5A 4TT6A 5KU3A 5F63A 3NXBA 5ENIA 3QZSA 5E9VA 5EI4A 5F5ZA 5IBNA 4AI6A 5DKDA 4YBMA 4LDFA 5EK9A 5LKZA 4MEPA 4QSRA 2H60A 4GPJA 4NR7A 2DWWA 4ALHA 5LKUA 3TLPA 5DFDA 4QEWA 4X2IA 3P1EA 5C4QA 4PKLA 5D3NA 3D7CA 4YADA 5AMEA 5AD3A 3IU6A 5LVRA 2LSPB 3LQHA 2R10A 5AMFA 5CQTA 4HBXA 5CP5A 5C89A 4PTBA 5CQ5A 4BHWA 4HXOA 5FB0A 4PCIA 4YYNA 5D3RA 5ENCA 4AKHA 5DY7A 3MQMA 3ZYUA 5HQ6A 3P5OA 5KO4A 3JVLA 5D3LA 3DAIA 5I7YA 4XUAA 5D0CA 4HBYA 5DKHA 4QSQA 4TZ8A 5KHMA 4CUSA 2D82A 5EGUA 3VKHA 4UYGA 4BW2A 5A5OA 4A9OA 4QYLA 1N72A 5EPSA 5D26A 4YY4A 1F68A 3O36A 4TTEA 5BT3A 5A81A 5CRZA 3HMHA 5L98A 3G0JA 5HJCA 3O33A 4O7CA 3SVFA 4IORA
chains in the Genus database with same CATH topology
2RO1A 5HQ5A 4QNSA 2DVQA 2GRCA 4QUUA 2RNYA 4UYDA 4UYHA 5IG6A 4HXRA 4QSTA 4LYWA 4UIVA 5EQ1A 5F61A 5CQ7A 5D3TA 4Z1QA 5DW1A 3UVYA 3GG3A 4LZ2A 4A9JA 5KTWA 5CS8A 4J3IA 4QR3A 3UV5A 4UYEA 4IR6A 5HLSA 5CUEA 5I83A 4QYDA 5A5SA 5IIDA 5EA1A 5FG6A 5E7DA 4C66A 4WHWA 4N4HA 4CUPA 4O77A 5FH8A 4A9FA 3QZVA 4A9LA 2RI7A 4NS5A 3LXJA 4N4IA 1JSPB 2N9GA 2YYNA 4QSXA 5II2A 4TYLA 4NYXA 3UVXA 5C8GA 4YBTA 2E7OA 4PY6A 5EU1A 4A9KA 4AKNA 5ENHA 4MEQA 5I89A 4QZSA 5DYXA 4KV4A 4CLBA 2YDWA 5IGNA 4TS8A 2D9EA 5EM3A 4LZSA 4O7EA 5E74A 5I7XA 5CTLA 5IGMA 4XUBA 3O35A 5LJ1A 5DW2A 4CFKA 5L8TA 5I1QA 5HRXA 5CQ4A 4IR4A 5DLXA 3P1CA 5CUDA 4PCEA 2YELA 5D3HA 3MUKA 5ENGA 5EWWA 4QSWA 5HFQA 4IR5A 4O7AA 4YYGA 5F36A 4UIZA 3K2JA 4LYSA 1X0JA 2I7KA 4Z1SA 5H1TA 4KCXA 3UW9A 5CFWA 5FE1A 4NRCA 5FE6A 4WIVA 4MR6A 5FE8A 3HMEA 3S92A 5AD2A 5F1HA 2OUOA 4QB3A 2KTBB 3HMFA 5CQ3A 5E9MA 4F3IA 5LKXA 4HXLA 4QUTA 4YY6A 5TB6A 5LVQA 5DBMA 5E9KA 5A5RA 4O76A 4YYHA 5EV9A 4N4GA 3O34A 4XY9A 5KTXA 5CUCA 2DVSA 4CURA 4OGJA 5EWCA 2YW5A 4O7FA 3U5OA 4Q0OA 5A5PA 3UVDA 5I88A 4YYMA 5H1VA 4TU4A 5COIA 5D7XA 5ENBA 5J0DA 5A7CA 1E6IA 4IR3A 5DKCA 3S91A 2RNXA 4BW3A 3U5PA 5IGLA 5E3DA 2G4AA 5EVAA 5FDZA 4NQMA 5HELA 5CUAA 5ENFA 4PS5A 5HQ7A 3SVHA 4QY4A 5K29A 3MB4A 5A85A 5FFYA 5CY9A 5G4SA 4O7BA 5E3GA 4UIUA 4O71A 5F1LA 4NR6A 4HBVA 4ZC9A 5E9YA 3I3JA 4MENA 4XY8A 3P1DA 5H85A 1WUMA 4FLPA 4QC1A 5E0RA 2WP1A 4O78A 1ZS5A 5LUUA 4NQNA 3JVMA 4ALGA 2OO1A 4YYIA 5DYAA 4QC3A 2RFJA 2YEKA 4WHUA 4MEOA 5EPRA 5HEMA 2DVRA 4BW4A 3RCWA 2NXBA 4J1PA 4Z6IA 5I80A 2R0VA 3JVKA 5A5NA 3ONIA 5HRVA 4DONA 5HCLA 5DYCA 5CPEA 4UIYA 2L5EA 5ENJA 5I86A 1EQFA 2MJVB 2RNWA 2R0SA 5L96A 5FE5A 5C85A 5D24A 4J0SA 4TU6A 5ACYA 4LYIA 4UITA 4HXKA 3U5NA 5FE2A 4XYAA 4QEVA 5A83A 5DLZA 5FH7A 4UIXA 5HENA 5CZGA 4QR4A 4TT2A 4CUQA 3AQAA 3IU5A 3O37A 5E73A 4CFLA 4A9MA 5DFBA 5FB1A 4ZW1A 3U5LA 4RVRA 4NR9A 4YYDA 4QEUA 5EWDA 2R0YA 2YQDA 5F60A 4MR5A 5I40A 5C7NA 4Z6HA 4QSVA 5CU8A 4NUDA 5EICA 4J0RA 4A9IA 4HXNA 5LJ0A 5D25A 4NR4A 5D3PA 4Y03A 5A5QA 2DATA 4TZ2A 4A9HA 5BT4A 5CGPA 5F25A 3DWYA 5C87A 3Q2FA 5LKTA 3JVJA 3UV4A 4O74A 4HBWA 5DYUA 4LZRA 2DVVA 2L84A 5A82A 5FBXA 5HFRA 4CL9A 5DX4A 4YYJA 5E9IA 4HXPA 3LQJA 4HXMA 5FE9A 4ZQLA 4IOOA 3MB3A 4NYWA 3G0LA 2L85A 5CUGA 2DKWA 5KTUA 3UV2A 5FE7A 4BJXA 4UYFB 2E7NA 4UYFA 4YC9A 3MULA 4YH3A 2I8NA 5HRWA 4UIWA 4NUEA 4IOQA 4NYVA 3U5KA 4YABA 5ETBA 4YK0A 5LJ2A 5CQ6A 3AADA 5EWHA 5FH6A 2F6NA 4C67A 4KV1A 2E3KA 5EPBA 4O72A 5BT5A 4QSUA 5FE3A 4LC2A 4NRBA 1JM4B 4TT4A 4LR6A 5E9LA 5F62A 5CUBA 5IGKA 4NXJA 4OGIA 5ENEA 4Q0NA 4N3WA 4YYKA 5D3SA 4NRAA 5L8UA 5I29A 5FE4A 3U5JA 2YEMA 4YAXA 4YBSA 4QSPA 3P1FA 5D3JA 5JWMA 3LJWA 4OUFA 3MXFA 5FG4A 4NUCA 4A9EA 4TQNA 4CUTA 5H1UA 3QZTA 5II1A 3Q2EA 4NR8A 5EISA 4O75A 5JI8A 4Z93A 3FKMX 4O70A 4NR5A 3U5MA 2WP2A 5TCMA 5FFWA 5FE0A 4QSSA 3UVWA 2OSSA 1WUGA 5EP7A 5ETDA 4QBMA 5F2PA 4E96A 4N4FA 5CQ8A 5EWVA 5F3AA 4A9NA 5L99A 4MR4A 4BW1A 4YH4A 5CRMA 5G4RA 2FSAA 5DFCA 3LQIA 5L97A 4MR3A 5HM0A 2F6JA 5FG5A 3SVGA 4LRGA 5CQAA 4HXSA 5FFVA 4YATA 2RS9B 4CUUA 4QR5A 4TT6A 5KU3A 5F63A 3NXBA 5ENIA 3QZSA 5E9VA 5EI4A 5F5ZA 5IBNA 5DKDA 4YBMA 4LDFA 5EK9A 5LKZA 4MEPA 4QSRA 2H60A 4GPJA 4NR7A 2DWWA 4ALHA 5LKUA 3TLPA 5DFDA 4QEWA 4X2IA 3P1EA 5C4QA 4PKLA 5D3NA 3D7CA 4YADA 5AMEA 5AD3A 3IU6A 5LVRA 2LSPB 3LQHA 2R10A 5AMFA 5CQTA 4HBXA 5CP5A 5C89A 4PTBA 5CQ5A 4BHWA 4HXOA 5FB0A 4PCIA 4YYNA 5D3RA 5ENCA 5DY7A 3MQMA 3ZYUA 5HQ6A 3P5OA 5KO4A 3JVLA 5D3LA 3DAIA 5I7YA 4XUAA 5D0CA 4HBYA 5DKHA 4QSQA 4TZ8A 5KHMA 4CUSA 2D82A 5EGUA 4UYGA 4BW2A 5A5OA 4A9OA 4QYLA 1N72A 5EPSA 5D26A 4YY4A 1F68A 3O36A 4TTEA 5BT3A 5A81A 5CRZA 3HMHA 5L98A 3G0JA 5HJCA 3O33A 4O7CA 3SVFA 4IORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RO1 A;  5HQ5 A;  4QNS A;  2DVQ A;  2GRC A;  4QUU A;  2RNY A;  4UYD A;  4UYH A;  5IG6 A;  4HXR A;  4QST A;  4LYW A;  4UIV A;  5EQ1 A;  5F61 A;  5CQ7 A;  5D3T A;  4Z1Q A;  5DW1 A;  3UVY A;  3GG3 A;  4LZ2 A;  4A9J A;  5KTW A;  5CS8 A;  4J3I A;  4QR3 A;  3UV5 A;  4UYE A;  4IR6 A;  5HLS A;  5CUE A;  5I83 A;  4QYD A;  5A5S A;  5IID A;  5EA1 A;  5FG6 A;  5E7D A;  4C66 A;  4WHW A;  4N4H A;  4CUP A;  4O77 A;  5FH8 A;  4A9F A;  3QZV A;  4A9L A;  2RI7 A;  4NS5 A;  3LXJ A;  4N4I A;  1JSP B;  2N9G A;  2YYN A;  4QSX A;  5II2 A;  4TYL A;  4NYX A;  3UVX A;  5C8G A;  4YBT A;  2E7O A;  4PY6 A;  5EU1 A;  4A9K A;  4AKN A;  5ENH A;  4MEQ A;  5I89 A;  4QZS A;  5DYX A;  4KV4 A;  4CLB A;  2YDW A;  5IGN A;  4TS8 A;  2D9E A;  5EM3 A;  4LZS A;  4O7E A;  5E74 A;  5I7X A;  5CTL A;  5IGM A;  4XUB A;  3O35 A;  5LJ1 A;  5DW2 A;  4CFK A;  5L8T A;  5I1Q A;  5HRX A;  5CQ4 A;  4IR4 A;  5DLX A;  3P1C A;  5CUD A;  4PCE A;  2YEL A;  5D3H A;  3MUK A;  5ENG A;  5EWW A;  4QSW A;  5HFQ A;  4IR5 A;  4O7A A;  4YYG A;  5F36 A;  4UIZ A;  3K2J A;  4LYS A;  1X0J A;  2I7K A;  4Z1S A;  5H1T A;  4KCX A;  3UW9 A;  5CFW A;  5FE1 A;  4NRC A;  5FE6 A;  4WIV A;  4MR6 A;  5FE8 A;  3HME A;  3S92 A;  5AD2 A;  5F1H A;  2OUO A;  4QB3 A;  2KTB B;  3HMF A;  5CQ3 A;  5E9M A;  4F3I A;  5LKX A;  4HXL A;  4QUT A;  4YY6 A;  5TB6 A;  5LVQ A;  5DBM A;  5E9K A;  5A5R A;  4O76 A;  4YYH A;  5EV9 A;  4N4G A;  3O34 A;  4XY9 A;  5KTX A;  5CUC A;  2DVS A;  4CUR A;  4OGJ A;  5EWC A;  2YW5 A;  4O7F A;  3U5O A;  4Q0O A;  5A5P A;  3UVD A;  5I88 A;  4YYM A;  5H1V A;  4TU4 A;  5COI A;  5D7X A;  5ENB A;  5J0D A;  5A7C A;  1E6I A;  4IR3 A;  5DKC A;  3S91 A;  2RNX A;  4BW3 A;  3U5P A;  5IGL A;  5E3D A;  2G4A A;  5EVA A;  5FDZ A;  4NQM A;  5HEL A;  5CUA A;  5ENF A;  4PS5 A;  5HQ7 A;  3SVH A;  4QY4 A;  5K29 A;  3MB4 A;  5A85 A;  5FFY A;  5CY9 A;  5G4S A;  4O7B A;  5E3G A;  4UIU A;  4O71 A;  5F1L A;  4NR6 A;  4HBV A;  4ZC9 A;  5E9Y A;  3I3J A;  4MEN A;  4XY8 A;  3P1D A;  5H85 A;  1WUM A;  4FLP A;  4QC1 A;  5E0R A;  2WP1 A;  4O78 A;  1ZS5 A;  5LUU A;  4NQN A;  3JVM A;  4ALG A;  2OO1 A;  4YYI A;  5DYA A;  4QC3 A;  2RFJ A;  2YEK A;  4WHU A;  4MEO A;  5EPR A;  5HEM A;  2DVR A;  4BW4 A;  3RCW A;  2NXB A;  4J1P A;  4Z6I A;  5I80 A;  2R0V A;  3JVK A;  5A5N A;  3ONI A;  5HRV A;  4DON A;  5HCL A;  5DYC A;  5CPE A;  4UIY A;  2L5E A;  5ENJ A;  5I86 A;  1EQF A;  2MJV B;  2RNW A;  2R0S A;  5L96 A;  5FE5 A;  5C85 A;  5D24 A;  4J0S A;  4TU6 A;  5ACY A;  4LYI A;  4UIT A;  4HXK A;  3U5N A;  5FE2 A;  4XYA A;  4QEV A;  5A83 A;  5DLZ A;  5FH7 A;  4UIX A;  5HEN A;  5CZG A;  4QR4 A;  4TT2 A;  4CUQ A;  3AQA A;  3IU5 A;  3O37 A;  5E73 A;  4CFL A;  4A9M A;  5DFB A;  5FB1 A;  4ZW1 A;  3U5L A;  4RVR A;  4NR9 A;  4YYD A;  4QEU A;  5EWD A;  2R0Y A;  2YQD A;  5F60 A;  4MR5 A;  5I40 A;  5C7N A;  4Z6H A;  4QSV A;  5CU8 A;  4NUD A;  5EIC A;  4J0R A;  4A9I A;  4HXN A;  5LJ0 A;  5D25 A;  4NR4 A;  5D3P A;  4Y03 A;  5A5Q A;  2DAT A;  4TZ2 A;  4A9H A;  5BT4 A;  5CGP A;  5F25 A;  3DWY A;  5C87 A;  3Q2F A;  5LKT A;  3JVJ A;  3UV4 A;  4O74 A;  4HBW A;  5DYU A;  4LZR A;  2DVV A;  2L84 A;  5A82 A;  5FBX A;  5HFR A;  4CL9 A;  5DX4 A;  4YYJ A;  5E9I A;  4HXP A;  3LQJ A;  4HXM A;  5FE9 A;  4ZQL A;  4IOO A;  3MB3 A;  4NYW A;  3G0L A;  2L85 A;  5CUG A;  2DKW A;  5KTU A;  3UV2 A;  5FE7 A;  4BJX A;  4UYF B;  2E7N A;  4UYF A;  4YC9 A;  3MUL A;  4YH3 A;  2I8N A;  5HRW A;  4UIW A;  4NUE A;  4IOQ A;  4NYV A;  3U5K A;  4YAB A;  5ETB A;  4YK0 A;  5LJ2 A;  5CQ6 A;  3AAD A;  5EWH A;  5FH6 A;  2F6N A;  4C67 A;  4KV1 A;  2E3K A;  5EPB A;  4O72 A;  5BT5 A;  4QSU A;  5FE3 A;  4LC2 A;  4NRB A;  1JM4 B;  4TT4 A;  4LR6 A;  5E9L A;  5F62 A;  5CUB A;  5IGK A;  4NXJ A;  4OGI A;  5ENE A;  4Q0N A;  4N3W A;  4YYK A;  5D3S A;  4NRA A;  5L8U A;  5I29 A;  5FE4 A;  3U5J A;  2YEM A;  4YAX A;  4YBS A;  4QSP A;  3P1F A;  5D3J A;  5JWM A;  3LJW A;  4OUF A;  3MXF A;  5FG4 A;  4NUC A;  4A9E A;  4TQN A;  4CUT A;  5H1U A;  3QZT A;  5II1 A;  3Q2E A;  4NR8 A;  5EIS A;  4O75 A;  5JI8 A;  4Z93 A;  3FKM X;  4O70 A;  4NR5 A;  3U5M A;  2WP2 A;  5TCM A;  5FFW A;  5FE0 A;  4QSS A;  3UVW A;  2OSS A;  1WUG A;  5EP7 A;  5ETD A;  4QBM A;  5F2P A;  4E96 A;  4N4F A;  5CQ8 A;  5EWV A;  5F3A A;  4A9N A;  5L99 A;  4MR4 A;  4BW1 A;  4YH4 A;  5CRM A;  5G4R A;  2FSA A;  5DFC A;  3LQI A;  5L97 A;  4MR3 A;  5HM0 A;  2F6J A;  5FG5 A;  3SVG A;  4LRG A;  5CQA A;  4HXS A;  5FFV A;  4YAT A;  2RS9 B;  4CUU A;  4QR5 A;  4TT6 A;  5KU3 A;  5F63 A;  3NXB A;  5ENI A;  3QZS A;  5E9V A;  5EI4 A;  5F5Z A;  5IBN A;  5DKD A;  4YBM A;  4LDF A;  5EK9 A;  5LKZ A;  4MEP A;  4QSR A;  2H60 A;  4GPJ A;  4NR7 A;  2DWW A;  4ALH A;  5LKU A;  3TLP A;  5DFD A;  4QEW A;  4X2I A;  3P1E A;  5C4Q A;  4PKL A;  5D3N A;  3D7C A;  4YAD A;  5AME A;  5AD3 A;  3IU6 A;  5LVR A;  2LSP B;  3LQH A;  2R10 A;  5AMF A;  5CQT A;  4HBX A;  5CP5 A;  5C89 A;  4PTB A;  5CQ5 A;  4BHW A;  4HXO A;  5FB0 A;  4PCI A;  4YYN A;  5D3R A;  5ENC A;  5DY7 A;  3MQM A;  3ZYU A;  5HQ6 A;  3P5O A;  5KO4 A;  3JVL A;  5D3L A;  3DAI A;  5I7Y A;  4XUA A;  5D0C A;  4HBY A;  5DKH A;  4QSQ A;  4TZ8 A;  5KHM A;  4CUS A;  2D82 A;  5EGU A;  4UYG A;  4BW2 A;  5A5O A;  4A9O A;  4QYL A;  1N72 A;  5EPS A;  5D26 A;  4YY4 A;  1F68 A;  3O36 A;  4TTE A;  5BT3 A;  5A81 A;  5CRZ A;  3HMH A;  5L98 A;  3G0J A;  5HJC A;  3O33 A;  4O7C A;  3SVF A;  4IOR A; 
#chains in the Genus database with same CATH topology
 2RO1 A;  5HQ5 A;  4QNS A;  2DVQ A;  2GRC A;  4QUU A;  2RNY A;  4UYD A;  4UYH A;  5IG6 A;  4HXR A;  4QST A;  4LYW A;  4UIV A;  5EQ1 A;  5F61 A;  5CQ7 A;  5D3T A;  4Z1Q A;  5DW1 A;  3UVY A;  3GG3 A;  4LZ2 A;  4A9J A;  5KTW A;  5CS8 A;  4J3I A;  4QR3 A;  3UV5 A;  4UYE A;  4IR6 A;  5HLS A;  3VKG A;  5CUE A;  5I83 A;  4QYD A;  5A5S A;  5IID A;  5EA1 A;  5FG6 A;  5E7D A;  4C66 A;  4WHW A;  4N4H A;  4CUP A;  4O77 A;  5FH8 A;  4A9F A;  3QZV A;  4A9L A;  2RI7 A;  4NS5 A;  3LXJ A;  4N4I A;  1JSP B;  2N9G A;  2YYN A;  4QSX A;  5II2 A;  4TYL A;  4NYX A;  3UVX A;  5C8G A;  4YBT A;  2E7O A;  4PY6 A;  5EU1 A;  4A9K A;  4AKN A;  5ENH A;  4MEQ A;  5I89 A;  4QZS A;  5DYX A;  4KV4 A;  4CLB A;  2YDW A;  5IGN A;  4TS8 A;  2D9E A;  5EM3 A;  4LZS A;  4O7E A;  5E74 A;  5I7X A;  5CTL A;  5IGM A;  4XUB A;  3O35 A;  5LJ1 A;  5DW2 A;  4CFK A;  5L8T A;  5I1Q A;  5HRX A;  5CQ4 A;  4IR4 A;  5DLX A;  3P1C A;  5CUD A;  4PCE A;  2YEL A;  5D3H A;  3MUK A;  5ENG A;  5EWW A;  4QSW A;  5HFQ A;  4IR5 A;  4O7A A;  4YYG A;  5F36 A;  4UIZ A;  3K2J A;  4LYS A;  1X0J A;  2I7K A;  4Z1S A;  1PUO A;  5H1T A;  4KCX A;  3UW9 A;  5CFW A;  5FE1 A;  4NRC A;  5FE6 A;  4WIV A;  4MR6 A;  5FE8 A;  3HME A;  3S92 A;  5AD2 A;  5F1H A;  2OUO A;  4QB3 A;  2KTB B;  3HMF A;  5CQ3 A;  5E9M A;  4F3I A;  5LKX A;  4HXL A;  4QUT A;  4YY6 A;  5TB6 A;  5LVQ A;  5DBM A;  5E9K A;  5A5R A;  4O76 A;  4YYH A;  5EV9 A;  4N4G A;  3O34 A;  4XY9 A;  5KTX A;  5CUC A;  2DVS A;  2EJN A;  4OGJ A;  4CUR A;  5EWC A;  2YW5 A;  4O7F A;  3U5O A;  4Q0O A;  5A5P A;  3UVD A;  5I88 A;  4YYM A;  5H1V A;  4TU4 A;  5COI A;  5D7X A;  5ENB A;  5J0D A;  5A7C A;  1E6I A;  4IR3 A;  5DKC A;  3S91 A;  2RNX A;  4BW3 A;  3U5P A;  5IGL A;  5E3D A;  2G4A A;  5EVA A;  5FDZ A;  4NQM A;  5HEL A;  5CUA A;  5ENF A;  4PS5 A;  5HQ7 A;  3SVH A;  4QY4 A;  5K29 A;  3MB4 A;  5A85 A;  5FFY A;  5CY9 A;  5G4S A;  4O7B A;  5E3G A;  4UIU A;  4O71 A;  5F1L A;  4NR6 A;  4HBV A;  4ZC9 A;  5E9Y A;  3I3J A;  4MEN A;  4XY8 A;  3P1D A;  5H85 A;  1WUM A;  4FLP A;  4QC1 A;  5E0R A;  2WP1 A;  4O78 A;  1ZS5 A;  5LUU A;  4NQN A;  3JVM A;  4ALG A;  2OO1 A;  4YYI A;  5DYA A;  4QC3 A;  2RFJ A;  2YEK A;  4WHU A;  4MEO A;  5EPR A;  5HEM A;  2DVR A;  4BW4 A;  3RCW A;  2NXB A;  4J1P A;  4Z6I A;  5I80 A;  2R0V A;  3JVK A;  5A5N A;  3ONI A;  5HRV A;  4DON A;  5HCL A;  5DYC A;  5CPE A;  4UIY A;  2L5E A;  5ENJ A;  5I86 A;  1EQF A;  2MJV B;  2RNW A;  2R0S A;  5L96 A;  5FE5 A;  5C85 A;  5D24 A;  4J0S A;  4TU6 A;  5ACY A;  4LYI A;  4UIT A;  4HXK A;  3U5N A;  5FE2 A;  4XYA A;  4QEV A;  5A83 A;  5DLZ A;  5FH7 A;  4UIX A;  5HEN A;  5CZG A;  4QR4 A;  4TT2 A;  4CUQ A;  3AQA A;  3IU5 A;  3O37 A;  5E73 A;  4CFL A;  4A9M A;  5DFB A;  5FB1 A;  4ZW1 A;  3U5L A;  3D1B A;  4RVR A;  4NR9 A;  4YYD A;  4QEU A;  5EWD A;  2R0Y A;  2YQD A;  5F60 A;  4MR5 A;  5I40 A;  5C7N A;  4Z6H A;  4QSV A;  5CU8 A;  4NUD A;  5EIC A;  4J0R A;  4A9I A;  4HXN A;  5LJ0 A;  5D25 A;  4NR4 A;  5D3P A;  4Y03 A;  5A5Q A;  2DAT A;  4TZ2 A;  4A9H A;  5BT4 A;  5CGP A;  5F25 A;  3DWY A;  5C87 A;  3Q2F A;  5LKT A;  3JVJ A;  1ZKR A;  4O74 A;  4HBW A;  5DYU A;  3UV4 A;  4LZR A;  2DVV A;  2L84 A;  5A82 A;  5FBX A;  5HFR A;  4CL9 A;  5DX4 A;  4YYJ A;  5E9I A;  4HXP A;  3LQJ A;  4HXM A;  5FE9 A;  4ZQL A;  4IOO A;  3MB3 A;  4NYW A;  3G0L A;  2L85 A;  5CUG A;  2DKW A;  5KTU A;  3UV2 A;  5FE7 A;  4BJX A;  4UYF B;  2E7N A;  4UYF A;  4YC9 A;  3MUL A;  4YH3 A;  2I8N A;  5HRW A;  4UIW A;  4NUE A;  4IOQ A;  4NYV A;  3U5K A;  4YAB A;  5ETB A;  4YK0 A;  5LJ2 A;  5CQ6 A;  3AAD A;  5EWH A;  5FH6 A;  2F6N A;  4C67 A;  4KV1 A;  2E3K A;  5EPB A;  4O72 A;  5BT5 A;  4QSU A;  5FE3 A;  4LC2 A;  4NRB A;  1JM4 B;  4TT4 A;  4LR6 A;  5E9L A;  5F62 A;  5CUB A;  5IGK A;  4NXJ A;  4OGI A;  5ENE A;  4Q0N A;  4N3W A;  4YYK A;  5D3S A;  4NRA A;  5L8U A;  5I29 A;  5FE4 A;  3U5J A;  4YAX A;  2YEM A;  4YBS A;  4QSP A;  3P1F A;  5D3J A;  5JWM A;  3LJW A;  4OUF A;  3MXF A;  5FG4 A;  4NUC A;  4A9E A;  4TQN A;  4CUT A;  3ERR A;  5H1U A;  3QZT A;  5II1 A;  3Q2E A;  4NR8 A;  5EIS A;  3D1D A;  4O75 A;  5JI8 A;  4Z93 A;  3FKM X;  4O70 A;  4NR5 A;  3U5M A;  2WP2 A;  5TCM A;  5FFW A;  5FE0 A;  4QSS A;  3UVW A;  2OSS A;  1WUG A;  5EP7 A;  5ETD A;  4QBM A;  5F2P A;  4AKI A;  4E96 A;  4N4F A;  5CQ8 A;  5EWV A;  5F3A A;  4A9N A;  5L99 A;  4MR4 A;  4BW1 A;  4YH4 A;  5CRM A;  5G4R A;  2FSA A;  5DFC A;  3LQI A;  5L97 A;  4MR3 A;  5HM0 A;  2F6J A;  5FG5 A;  3SVG A;  4LRG A;  5CQA A;  4HXS A;  4AKG A;  5FFV A;  4YAT A;  2RS9 B;  4CUU A;  4QR5 A;  4TT6 A;  5KU3 A;  5F63 A;  3NXB A;  5ENI A;  3QZS A;  5E9V A;  5EI4 A;  5F5Z A;  5IBN A;  4AI6 A;  5DKD A;  4YBM A;  4LDF A;  5EK9 A;  5LKZ A;  4MEP A;  4QSR A;  2H60 A;  4GPJ A;  4NR7 A;  2DWW A;  4ALH A;  5LKU A;  3TLP A;  5DFD A;  4QEW A;  4X2I A;  3P1E A;  5C4Q A;  4PKL A;  5D3N A;  3D7C A;  4YAD A;  5AME A;  5AD3 A;  3IU6 A;  5LVR A;  2LSP B;  3LQH A;  2R10 A;  5AMF A;  5CQT A;  4HBX A;  5CP5 A;  5C89 A;  4PTB A;  5CQ5 A;  4BHW A;  4HXO A;  5FB0 A;  4PCI A;  4YYN A;  5D3R A;  5ENC A;  4AKH A;  5DY7 A;  3MQM A;  3ZYU A;  5HQ6 A;  3P5O A;  5KO4 A;  3JVL A;  5D3L A;  3DAI A;  5I7Y A;  4XUA A;  5D0C A;  4HBY A;  5DKH A;  4QSQ A;  4TZ8 A;  5KHM A;  4CUS A;  2D82 A;  5EGU A;  3VKH A;  4UYG A;  4BW2 A;  5A5O A;  4A9O A;  4QYL A;  1N72 A;  5EPS A;  5D26 A;  4YY4 A;  1F68 A;  3O36 A;  4TTE A;  5BT3 A;  5A81 A;  5CRZ A;  3HMH A;  5L98 A;  3G0J A;  5HJC A;  3O33 A;  4O7C A;  3SVF A;  4IOR A; 
#chains in the Genus database with same CATH homology
 2RO1 A;  5HQ5 A;  4QNS A;  2DVQ A;  2GRC A;  4QUU A;  2RNY A;  4UYD A;  4UYH A;  5IG6 A;  4HXR A;  4QST A;  4LYW A;  4UIV A;  5EQ1 A;  5F61 A;  5CQ7 A;  5D3T A;  4Z1Q A;  5DW1 A;  3UVY A;  3GG3 A;  4LZ2 A;  4A9J A;  5KTW A;  5CS8 A;  4J3I A;  4QR3 A;  3UV5 A;  4UYE A;  4IR6 A;  5HLS A;  5CUE A;  5I83 A;  4QYD A;  5A5S A;  5IID A;  5EA1 A;  5FG6 A;  5E7D A;  4C66 A;  4WHW A;  4N4H A;  4CUP A;  4O77 A;  5FH8 A;  4A9F A;  3QZV A;  4A9L A;  2RI7 A;  4NS5 A;  3LXJ A;  4N4I A;  1JSP B;  2N9G A;  2YYN A;  4QSX A;  5II2 A;  4TYL A;  4NYX A;  3UVX A;  5C8G A;  4YBT A;  2E7O A;  4PY6 A;  5EU1 A;  4A9K A;  4AKN A;  5ENH A;  4MEQ A;  5I89 A;  4QZS A;  5DYX A;  4KV4 A;  4CLB A;  2YDW A;  5IGN A;  4TS8 A;  2D9E A;  5EM3 A;  4LZS A;  4O7E A;  5E74 A;  5I7X A;  5CTL A;  5IGM A;  4XUB A;  3O35 A;  5LJ1 A;  5DW2 A;  4CFK A;  5L8T A;  5I1Q A;  5HRX A;  5CQ4 A;  4IR4 A;  5DLX A;  3P1C A;  5CUD A;  4PCE A;  2YEL A;  5D3H A;  3MUK A;  5ENG A;  5EWW A;  4QSW A;  5HFQ A;  4IR5 A;  4O7A A;  4YYG A;  5F36 A;  4UIZ A;  3K2J A;  4LYS A;  1X0J A;  2I7K A;  4Z1S A;  5H1T A;  4KCX A;  3UW9 A;  5CFW A;  5FE1 A;  4NRC A;  5FE6 A;  4WIV A;  4MR6 A;  5FE8 A;  3HME A;  3S92 A;  5AD2 A;  5F1H A;  2OUO A;  4QB3 A;  2KTB B;  3HMF A;  5CQ3 A;  5E9M A;  4F3I A;  5LKX A;  4HXL A;  4QUT A;  4YY6 A;  5TB6 A;  5LVQ A;  5DBM A;  5E9K A;  5A5R A;  4O76 A;  4YYH A;  5EV9 A;  4N4G A;  3O34 A;  4XY9 A;  5KTX A;  5CUC A;  2DVS A;  4CUR A;  4OGJ A;  5EWC A;  2YW5 A;  4O7F A;  3U5O A;  4Q0O A;  5A5P A;  3UVD A;  5I88 A;  4YYM A;  5H1V A;  4TU4 A;  5COI A;  5D7X A;  5ENB A;  5J0D A;  5A7C A;  1E6I A;  4IR3 A;  5DKC A;  3S91 A;  2RNX A;  4BW3 A;  3U5P A;  5IGL A;  5E3D A;  2G4A A;  5EVA A;  5FDZ A;  4NQM A;  5HEL A;  5CUA A;  5ENF A;  4PS5 A;  5HQ7 A;  3SVH A;  4QY4 A;  5K29 A;  3MB4 A;  5A85 A;  5FFY A;  5CY9 A;  5G4S A;  4O7B A;  5E3G A;  4UIU A;  4O71 A;  5F1L A;  4NR6 A;  4HBV A;  4ZC9 A;  5E9Y A;  3I3J A;  4MEN A;  4XY8 A;  3P1D A;  5H85 A;  1WUM A;  4FLP A;  4QC1 A;  5E0R A;  2WP1 A;  4O78 A;  1ZS5 A;  5LUU A;  4NQN A;  3JVM A;  4ALG A;  2OO1 A;  4YYI A;  5DYA A;  4QC3 A;  2RFJ A;  2YEK A;  4WHU A;  4MEO A;  5EPR A;  5HEM A;  2DVR A;  4BW4 A;  3RCW A;  2NXB A;  4J1P A;  4Z6I A;  5I80 A;  2R0V A;  3JVK A;  5A5N A;  3ONI A;  5HRV A;  4DON A;  5HCL A;  5DYC A;  5CPE A;  4UIY A;  2L5E A;  5ENJ A;  5I86 A;  1EQF A;  2MJV B;  2RNW A;  2R0S A;  5L96 A;  5FE5 A;  5C85 A;  5D24 A;  4J0S A;  4TU6 A;  5ACY A;  4LYI A;  4UIT A;  4HXK A;  3U5N A;  5FE2 A;  4XYA A;  4QEV A;  5A83 A;  5DLZ A;  5FH7 A;  4UIX A;  5HEN A;  5CZG A;  4QR4 A;  4TT2 A;  4CUQ A;  3AQA A;  3IU5 A;  3O37 A;  5E73 A;  4CFL A;  4A9M A;  5DFB A;  5FB1 A;  4ZW1 A;  3U5L A;  4RVR A;  4NR9 A;  4YYD A;  4QEU A;  5EWD A;  2R0Y A;  2YQD A;  5F60 A;  4MR5 A;  5I40 A;  5C7N A;  4Z6H A;  4QSV A;  5CU8 A;  4NUD A;  5EIC A;  4J0R A;  4A9I A;  4HXN A;  5LJ0 A;  5D25 A;  4NR4 A;  5D3P A;  4Y03 A;  5A5Q A;  2DAT A;  4TZ2 A;  4A9H A;  5BT4 A;  5CGP A;  5F25 A;  3DWY A;  5C87 A;  3Q2F A;  5LKT A;  3JVJ A;  3UV4 A;  4O74 A;  4HBW A;  5DYU A;  4LZR A;  2DVV A;  2L84 A;  5A82 A;  5FBX A;  5HFR A;  4CL9 A;  5DX4 A;  4YYJ A;  5E9I A;  4HXP A;  3LQJ A;  4HXM A;  5FE9 A;  4ZQL A;  4IOO A;  3MB3 A;  4NYW A;  3G0L A;  2L85 A;  5CUG A;  2DKW A;  5KTU A;  3UV2 A;  5FE7 A;  4BJX A;  4UYF B;  2E7N A;  4UYF A;  4YC9 A;  3MUL A;  4YH3 A;  2I8N A;  5HRW A;  4UIW A;  4NUE A;  4IOQ A;  4NYV A;  3U5K A;  4YAB A;  5ETB A;  4YK0 A;  5LJ2 A;  5CQ6 A;  3AAD A;  5EWH A;  5FH6 A;  2F6N A;  4C67 A;  4KV1 A;  2E3K A;  5EPB A;  4O72 A;  5BT5 A;  4QSU A;  5FE3 A;  4LC2 A;  4NRB A;  1JM4 B;  4TT4 A;  4LR6 A;  5E9L A;  5F62 A;  5CUB A;  5IGK A;  4NXJ A;  4OGI A;  5ENE A;  4Q0N A;  4N3W A;  4YYK A;  5D3S A;  4NRA A;  5L8U A;  5I29 A;  5FE4 A;  3U5J A;  2YEM A;  4YAX A;  4YBS A;  4QSP A;  3P1F A;  5D3J A;  5JWM A;  3LJW A;  4OUF A;  3MXF A;  5FG4 A;  4NUC A;  4A9E A;  4TQN A;  4CUT A;  5H1U A;  3QZT A;  5II1 A;  3Q2E A;  4NR8 A;  5EIS A;  4O75 A;  5JI8 A;  4Z93 A;  3FKM X;  4O70 A;  4NR5 A;  3U5M A;  2WP2 A;  5TCM A;  5FFW A;  5FE0 A;  4QSS A;  3UVW A;  2OSS A;  1WUG A;  5EP7 A;  5ETD A;  4QBM A;  5F2P A;  4E96 A;  4N4F A;  5CQ8 A;  5EWV A;  5F3A A;  4A9N A;  5L99 A;  4MR4 A;  4BW1 A;  4YH4 A;  5CRM A;  5G4R A;  2FSA A;  5DFC A;  3LQI A;  5L97 A;  4MR3 A;  5HM0 A;  2F6J A;  5FG5 A;  3SVG A;  4LRG A;  5CQA A;  4HXS A;  5FFV A;  4YAT A;  2RS9 B;  4CUU A;  4QR5 A;  4TT6 A;  5KU3 A;  5F63 A;  3NXB A;  5ENI A;  3QZS A;  5E9V A;  5EI4 A;  5F5Z A;  5IBN A;  5DKD A;  4YBM A;  4LDF A;  5EK9 A;  5LKZ A;  4MEP A;  4QSR A;  2H60 A;  4GPJ A;  4NR7 A;  2DWW A;  4ALH A;  5LKU A;  3TLP A;  5DFD A;  4QEW A;  4X2I A;  3P1E A;  5C4Q A;  4PKL A;  5D3N A;  3D7C A;  4YAD A;  5AME A;  5AD3 A;  3IU6 A;  5LVR A;  2LSP B;  3LQH A;  2R10 A;  5AMF A;  5CQT A;  4HBX A;  5CP5 A;  5C89 A;  4PTB A;  5CQ5 A;  4BHW A;  4HXO A;  5FB0 A;  4PCI A;  4YYN A;  5D3R A;  5ENC A;  5DY7 A;  3MQM A;  3ZYU A;  5HQ6 A;  3P5O A;  5KO4 A;  3JVL A;  5D3L A;  3DAI A;  5I7Y A;  4XUA A;  5D0C A;  4HBY A;  5DKH A;  4QSQ A;  4TZ8 A;  5KHM A;  4CUS A;  2D82 A;  5EGU A;  4UYG A;  4BW2 A;  5A5O A;  4A9O A;  4QYL A;  1N72 A;  5EPS A;  5D26 A;  4YY4 A;  1F68 A;  3O36 A;  4TTE A;  5BT3 A;  5A81 A;  5CRZ A;  3HMH A;  5L98 A;  3G0J A;  5HJC A;  3O33 A;  4O7C A;  3SVF A;  4IOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...