3MB4A

Crystal structure of the fifth bromodomain of human poly-bromodomain containing protein 1 (pb1) with nmp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
115
structure length
115
Chain Sequence
b'SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein polybromo-1
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3mb4A00
2KTBB 5DYXA 3TLPA 4YBMA 4CUPA 4KV1A 3U5KA 5II1A 5FE5A 5CRMA 5KHMA 5C89A 3IU6A 2R10A 3U5LA 2OO1A 4LZSA 5LJ1A 5E73A 5DX4A 4C67A 5F25A 3MXFA 5FE7A 4O71A 4PTBA 4UIXA 4BHWA 4A9JA 5A5NA 4TT6A 5L99A 5HENA 5IG6A 5C85A 2L85A 5I1QA 5EQ1A 4TS8A 5DLXA 4LC2A 4YYJA 4QSWA 4X2IA 4CFLA 3O35A 1WUGA 5AMFA 3LQJA 5D3JA 4XYAA 5D0CA 5A85A 5JI8A 3UVDA 4QR3A 5CQ6A 2N9GA 3ZYUA 5G4RA 4QUUA 4WIVA 5LKTA 3U5NA 4QNSA 5EPBA 5D3HA 4YYKA 5CU8A 5HFRA 2D82A 3S92A 3P5OA 5I86A 5HRVA 4QSUA 5DBMA 4BW2A 4YK0A 5ACYA 5E9MA 5H85A 3Q2FA 4QEWA 2I7KA 2YELA 2YDWA 3O33A 4OGIA 2YQDA 4QY4A 4HXMA 4NYWA 3P1CA 2F6JA 2OUOA 4UYHA 5KO4A 4TQNA 4A9KA 2OSSA 4NS5A 1EQFA 4YYDA 2R0VA 3SVFA 3HMHA 5DLZA 5FE4A 5HM0A 4LZ2A 5FG5A 3SVHA 2I8NA 5A81A 3UVXA 5D3LA 4YYNA 3G0LA 5C4QA 5I40A 4TU6A 4KCXA 5TB6A 5HRXA 3SVGA 5LJ0A 2L5EA 4O7BA 4XY8A 5LJ2A 4YADA 4CUSA 1JSPB 3UW9A 4PKLA 4WHWA 3O34A 5E9VA 3GG3A 4YABA 4PCEA 5I29A 4A9EA 4QC1A 4MR5A 4YC9A 5CUGA 5HEMA 3UV2A 5FE2A 4Q0NA 4N4IA 5FE1A 3JVMA 5EGUA 5FE3A 5LVRA 5EP7A 4NUDA 5DYAA 4ZW1A 4Z1SA 4QC3A 5CS8A 5E74A 5E3DA 5I83A 3QZSA 5H1UA 4BJXA 5K29A 5TCMA 5CZGA 5FB1A 5AD3A 5DY7A 4BW1A 4UYGA 5BT4A 5IBNA 3MB3A 2RS9B 4XUBA 5CP5A 5C7NA 5EWHA 5A83A 4NUEA 5CUBA 3O37A 4O77A 5E0RA 5JWMA 5LVQA 5IGLA 5EWWA 3LQHA 4YH4A 5BT3A 2H60A 5DKHA 4IOQA 5ENJA 5G4SA 4UYFA 4MEPA 4A9OA 4NR8A 4NR9A 5EISA 3ONIA 2DATA 5DFDA 3JVJA 4NXJA 5F36A 4N3WA 5F5ZA 4UYFB 4N4GA 2DVQA 5FH7A 4O74A 5CFWA 4KV4A 4Z6IA 4MR4A 5F61A 3MB4A 4TT4A 5E9LA 4O78A 3U5MA 4PS5A 5ENIA 2DWWA 4RVRA 4YYIA 2R0SA 5EWVA 3JVLA 2DVSA 5EVAA 4IR4A 5HQ7A 5E3GA 5HELA 4A9NA 5E9KA 5EU1A 3UVWA 5D3NA 5F1LA 5EA1A 4TZ2A 4NRAA 3FKMX 2E7OA 4NRCA 4F3IA 4J0RA 3HMFA 4A9LA 5CUDA 5AD2A 5A5SA 5DFCA 5J0DA 3UVYA 1E6IA 3U5OA 5DW2A 5H1TA 5CY9A 4HXNA 4PY6A 5D25A 5ETDA 4QSTA 4YYHA 4XUAA 5E9IA 4N4HA 5HQ5A 4IR5A 3JVKA 4TT2A 5L8UA 5EI4A 5KTWA 4YBSA 5DYUA 5LUUA 4LYWA 3IU5A 4MENA 4UYDA 4Q0OA 5KU3A 5FE9A 4ALHA 4ZC9A 3LJWA 4LYSA 4TZ8A 5F62A 4NR6A 5ENBA 4NYXA 4QSXA 5F1HA 5D3TA 4NR5A 4GPJA 4UITA 5FFYA 3U5JA 2R0YA 2FSAA 2YEMA 5LKXA 5ENEA 5DW1A 3P1EA 5KTXA 5A7CA 4LR6A 2WP2A 5HFQA 4HBWA 5I80A 4CUUA 5DYCA 4J3IA 2MJVB 5ENCA 3G0JA 5CUEA 4NR7A 4UIVA 4MEOA 5E9YA 4CFKA 4C66A 4HXOA 3MQMA 5A5RA 5CQ8A 5KTUA 3DAIA 4O7AA 4HXPA 4UIWA 5FBXA 4LYIA 4HBYA 2RFJA 4IOOA 3LXJA 5FFVA 5D26A 4A9IA 5D7XA 5FDZA 2GRCA 4BW3A 5FG4A 2L84A 5IGNA 5E7DA 5EM3A 5EPSA 4TU4A 4ALGA 5IGKA 5CTLA 4QZSA 5ETBA 1X0JA 5ENGA 5I7XA 2LSPB 5EWDA 5I89A 3Q2EA 5II2A 5IGMA 5I88A 4NQNA 4TTEA 5A5PA 2RNWA 5A82A 5DFBA 4NUCA 3UV4A 3RCWA 4Y03A 3NXBA 5IIDA 5D3PA 5H1VA 2WP1A 4NR4A 2DVVA 4XY9A 4DONA 4IORA 2RNYA 4AKNA 4TYLA 5EICA 4QSRA 3UV5A 4MR3A 5CQ7A 5EK9A 4CLBA 4QR5A 4J0SA 4YY4A 4YAXA 4N4FA 4QUTA 4Z1QA 4OUFA 4QEVA 4NRBA 5CQ3A 4IR6A 3MUKA 5L96A 4NQMA 1N72A 2NXBA 4O70A 5F60A 3I3JA 3P1DA 5F63A 5F2PA 2YW5A 4O7EA 1WUMA 4Z6HA 4HXKA 4QSVA 5A5OA 4WHUA 2G4AA 4HXSA 5HCLA 2RO1A 4NYVA 4A9HA 5FE6A 5L98A 2RNXA 3QZVA 4YYGA 4MEQA 3D7CA 5CGPA 5CQTA 3S91A 5LKZA 4QR4A 2D9EA 3AADA 5FH8A 4CL9A 4QBMA 4O7CA 5CRZA 4O76A 5I7YA 4FLPA 5CQ4A 2E7NA 1ZS5A 4A9FA 3P1FA 5ENFA 5L97A 4HBVA 5CUCA 4LDFA 5EPRA 1F68A 4MR6A 5F3AA 5DKDA 4Z93A 5FE0A 4YH3A 2E3KA 5HRWA 4UIUA 4PCIA 4YATA 5LKUA 5DKCA 5CQAA 4OGJA 5HQ6A 2YEKA 5CUAA 4QYLA 2RI7A 5FG6A 5COIA 4O7FA 4CUTA 5D3SA 5BT5A 3O36A 2DKWA 5FFWA 5C8GA 4YYMA 3U5PA 5EV9A 3K2JA 3MULA 5HJCA 4QSPA 2F6NA 5CPEA 3HMEA 4UIZA 5FE8A 4CUQA 3DWYA 4LZRA 3LQIA 2DVRA 4LRGA 4E96A 5AMEA 4UIYA 5C87A 3QZTA 4QSQA 5EWCA 2YYNA 3AQAA 4HBXA 4O72A 4BW4A 4UYEA 4ZQLA 1JM4B 4QB3A 4YY6A 5HLSA 5ENHA 4HXLA 4QSSA 5FB0A 5A5QA 4QEUA 4A9MA 4HXRA 5L8TA 4CURA 4J1PA 4O75A 4QYDA 5FH6A 4YBTA 4IR3A 5D3RA 5D24A 5CQ5A
chains in the Genus database with same CATH superfamily
2KTBB 5DYXA 3TLPA 4YBMA 4CUPA 4KV1A 3U5KA 5II1A 5FE5A 5CRMA 5KHMA 5C89A 3IU6A 2R10A 3U5LA 2OO1A 4LZSA 3D1DA 5LJ1A 5E73A 5DX4A 4C67A 5F25A 3MXFA 5FE7A 4O71A 4AI6A 4PTBA 4UIXA 4BHWA 4A9JA 5A5NA 4TT6A 5L99A 5HENA 5IG6A 5C85A 2L85A 5I1QA 5EQ1A 4TS8A 5DLXA 4LC2A 4YYJA 4QSWA 4X2IA 4CFLA 3O35A 1WUGA 5AMFA 3LQJA 5D3JA 4XYAA 5D0CA 5A85A 5JI8A 3UVDA 4QR3A 5CQ6A 2N9GA 3ZYUA 5G4RA 4QUUA 4WIVA 5LKTA 3U5NA 4QNSA 5EPBA 5D3HA 4YYKA 5CU8A 5HFRA 2D82A 3S92A 3P5OA 5I86A 5HRVA 4QSUA 5DBMA 4BW2A 4YK0A 5ACYA 5E9MA 5H85A 3Q2FA 4QEWA 2I7KA 1PUOA 2YDWA 2YELA 3O33A 4OGIA 2YQDA 4QY4A 4HXMA 4NYWA 3P1CA 2F6JA 2OUOA 4UYHA 5KO4A 4TQNA 4A9KA 2OSSA 4NS5A 1EQFA 4YYDA 2R0VA 3SVFA 3HMHA 5DLZA 5FE4A 5HM0A 4LZ2A 5FG5A 3SVHA 2I8NA 5A81A 3UVXA 5D3LA 4YYNA 3G0LA 5C4QA 5I40A 4TU6A 4KCXA 5TB6A 5HRXA 3SVGA 5LJ0A 2L5EA 4O7BA 4XY8A 5LJ2A 4YADA 4CUSA 1JSPB 3UW9A 4PKLA 4WHWA 3O34A 5E9VA 3GG3A 4YABA 4PCEA 5I29A 4A9EA 4QC1A 4MR5A 4YC9A 5CUGA 5HEMA 3UV2A 5FE2A 4Q0NA 4N4IA 5FE1A 3JVMA 5EGUA 5FE3A 5LVRA 5EP7A 4NUDA 5DYAA 4ZW1A 4Z1SA 4QC3A 5CS8A 5E74A 5E3DA 5I83A 3QZSA 5H1UA 4BJXA 5K29A 5TCMA 5CZGA 5FB1A 5AD3A 5DY7A 4BW1A 4UYGA 5BT4A 5IBNA 3MB3A 2RS9B 4XUBA 5CP5A 5C7NA 5EWHA 5A83A 4NUEA 5CUBA 3O37A 4O77A 5E0RA 5JWMA 5LVQA 5IGLA 5EWWA 3LQHA 4YH4A 5BT3A 2H60A 5DKHA 4IOQA 5ENJA 5G4SA 4UYFA 4MEPA 4A9OA 4NR8A 4NR9A 5EISA 3ONIA 2DATA 5DFDA 3JVJA 4NXJA 5F36A 4N3WA 5F5ZA 4UYFB 4N4GA 2DVQA 5FH7A 4O74A 5CFWA 4KV4A 4Z6IA 4MR4A 5F61A 3MB4A 4TT4A 5E9LA 4O78A 4AKIA 3U5MA 4AKGA 4PS5A 5ENIA 2DWWA 4RVRA 4YYIA 2R0SA 5EWVA 3JVLA 2DVSA 5EVAA 4IR4A 5HQ7A 5E3GA 5HELA 4A9NA 5E9KA 5EU1A 3UVWA 5D3NA 5F1LA 5EA1A 4TZ2A 4NRAA 3FKMX 2E7OA 4NRCA 4F3IA 4J0RA 3HMFA 4A9LA 5CUDA 5AD2A 5A5SA 5DFCA 5J0DA 3UVYA 1E6IA 3U5OA 5DW2A 5H1TA 5CY9A 4AKHA 4HXNA 4PY6A 5D25A 5ETDA 4QSTA 4YYHA 4XUAA 5E9IA 4N4HA 3VKHA 5HQ5A 4IR5A 3JVKA 4TT2A 5L8UA 5EI4A 5KTWA 4YBSA 5DYUA 5LUUA 4LYWA 3IU5A 4MENA 4UYDA 4Q0OA 5KU3A 5FE9A 4ALHA 4ZC9A 3LJWA 4LYSA 4TZ8A 5F62A 4NR6A 5ENBA 4NYXA 4QSXA 5F1HA 5D3TA 4NR5A 4GPJA 4UITA 5FFYA 3U5JA 2R0YA 2FSAA 2YEMA 5LKXA 5ENEA 5DW1A 3P1EA 5KTXA 5A7CA 4LR6A 2WP2A 5HFQA 4HBWA 5I80A 4CUUA 5DYCA 4J3IA 2MJVB 5ENCA 3G0JA 5CUEA 4NR7A 4UIVA 4MEOA 5E9YA 4CFKA 4C66A 4HXOA 3MQMA 5A5RA 5CQ8A 5KTUA 3DAIA 3D1BA 4O7AA 2EJNA 4HXPA 4UIWA 5FBXA 4LYIA 4HBYA 2RFJA 4IOOA 3LXJA 5FFVA 5D26A 4A9IA 5D7XA 5FDZA 2GRCA 4BW3A 5FG4A 2L84A 5IGNA 5E7DA 5EM3A 5EPSA 4TU4A 4ALGA 5IGKA 5CTLA 4QZSA 5ETBA 1X0JA 5ENGA 5I7XA 2LSPB 5EWDA 5I89A 3Q2EA 5II2A 5IGMA 5I88A 4NQNA 4TTEA 5A5PA 2RNWA 5A82A 5DFBA 4NUCA 3UV4A 3RCWA 4Y03A 3NXBA 5IIDA 5D3PA 5H1VA 2WP1A 4NR4A 2DVVA 4XY9A 4DONA 4IORA 2RNYA 4AKNA 4TYLA 5EICA 4QSRA 3UV5A 4MR3A 5CQ7A 5EK9A 4CLBA 4QR5A 4J0SA 4YY4A 4YAXA 4N4FA 4QUTA 4Z1QA 4OUFA 4QEVA 4NRBA 5CQ3A 4IR6A 3MUKA 5L96A 4NQMA 1N72A 2NXBA 4O70A 5F60A 3I3JA 3P1DA 5F63A 5F2PA 2YW5A 4O7EA 1WUMA 4Z6HA 1ZKRA 4HXKA 4QSVA 5A5OA 4WHUA 2G4AA 4HXSA 5HCLA 2RO1A 4NYVA 4A9HA 5FE6A 5L98A 2RNXA 3QZVA 4YYGA 4MEQA 3D7CA 5CGPA 5CQTA 3S91A 5LKZA 4QR4A 2D9EA 3AADA 5FH8A 4CL9A 4QBMA 4O7CA 5CRZA 4O76A 5I7YA 4FLPA 5CQ4A 2E7NA 1ZS5A 4A9FA 3P1FA 5ENFA 5L97A 4HBVA 5CUCA 4LDFA 5EPRA 1F68A 4MR6A 5F3AA 5DKDA 4Z93A 5FE0A 4YH3A 2E3KA 3ERRA 5HRWA 4UIUA 4PCIA 4YATA 5LKUA 5DKCA 5CQAA 4OGJA 5HQ6A 2YEKA 5CUAA 4QYLA 2RI7A 5FG6A 5COIA 4O7FA 4CUTA 5D3SA 5BT5A 3O36A 2DKWA 5FFWA 5C8GA 4YYMA 3U5PA 5EV9A 3K2JA 3MULA 5HJCA 4QSPA 2F6NA 5CPEA 3HMEA 4UIZA 5FE8A 4CUQA 3DWYA 4LZRA 3LQIA 2DVRA 4LRGA 4E96A 5AMEA 4UIYA 5C87A 3VKGA 3QZTA 4QSQA 5EWCA 2YYNA 3AQAA 4HBXA 4O72A 4BW4A 4UYEA 4ZQLA 1JM4B 4QB3A 4YY6A 5HLSA 5ENHA 4HXLA 4QSSA 5FB0A 5A5QA 4QEUA 4A9MA 4HXRA 5L8TA 4CURA 4J1PA 4O75A 4QYDA 5FH6A 4YBTA 4IR3A 5D3RA 5D24A 5CQ5A
chains in the Genus database with same CATH topology
2KTBB 5DYXA 3TLPA 4YBMA 4CUPA 4KV1A 3U5KA 5II1A 5FE5A 5CRMA 5KHMA 5C89A 3IU6A 2R10A 3U5LA 2OO1A 4LZSA 5LJ1A 5E73A 5DX4A 4C67A 5F25A 3MXFA 5FE7A 4O71A 4PTBA 4UIXA 4BHWA 4A9JA 5A5NA 4TT6A 5L99A 5HENA 5IG6A 5C85A 2L85A 5I1QA 5EQ1A 4TS8A 5DLXA 4LC2A 4YYJA 4QSWA 4X2IA 4CFLA 3O35A 1WUGA 5AMFA 3LQJA 5D3JA 4XYAA 5D0CA 5A85A 5JI8A 3UVDA 4QR3A 5CQ6A 2N9GA 3ZYUA 5G4RA 4QUUA 4WIVA 5LKTA 3U5NA 4QNSA 5EPBA 5D3HA 4YYKA 5CU8A 5HFRA 2D82A 3S92A 3P5OA 5I86A 5HRVA 4QSUA 5DBMA 4BW2A 4YK0A 5ACYA 5E9MA 5H85A 3Q2FA 4QEWA 2I7KA 2YELA 2YDWA 3O33A 4OGIA 2YQDA 4QY4A 4HXMA 4NYWA 3P1CA 2F6JA 2OUOA 4UYHA 5KO4A 4TQNA 4A9KA 2OSSA 4NS5A 1EQFA 4YYDA 2R0VA 3SVFA 3HMHA 5DLZA 5FE4A 5HM0A 4LZ2A 5FG5A 3SVHA 2I8NA 5A81A 3UVXA 5D3LA 4YYNA 3G0LA 5C4QA 5I40A 4TU6A 4KCXA 5TB6A 5HRXA 3SVGA 5LJ0A 2L5EA 4O7BA 4XY8A 5LJ2A 4YADA 4CUSA 1JSPB 3UW9A 4PKLA 4WHWA 3O34A 5E9VA 3GG3A 4YABA 4PCEA 5I29A 4A9EA 4QC1A 4MR5A 4YC9A 5CUGA 5HEMA 3UV2A 5FE2A 4Q0NA 4N4IA 5FE1A 3JVMA 5EGUA 5FE3A 5LVRA 5EP7A 4NUDA 5DYAA 4ZW1A 4Z1SA 4QC3A 5CS8A 5E74A 5E3DA 5I83A 3QZSA 5H1UA 4BJXA 5K29A 5TCMA 5CZGA 5FB1A 5AD3A 5DY7A 4BW1A 4UYGA 5BT4A 5IBNA 3MB3A 2RS9B 4XUBA 5CP5A 5C7NA 5EWHA 5A83A 4NUEA 5CUBA 3O37A 4O77A 5E0RA 5JWMA 5LVQA 5IGLA 5EWWA 3LQHA 4YH4A 5BT3A 2H60A 5DKHA 4IOQA 5ENJA 5G4SA 4UYFA 4MEPA 4A9OA 4NR8A 4NR9A 5EISA 3ONIA 2DATA 5DFDA 3JVJA 4NXJA 5F36A 4N3WA 5F5ZA 4UYFB 4N4GA 2DVQA 5FH7A 4O74A 5CFWA 4KV4A 4Z6IA 4MR4A 5F61A 3MB4A 4TT4A 5E9LA 4O78A 3U5MA 4PS5A 5ENIA 2DWWA 4RVRA 4YYIA 2R0SA 5EWVA 3JVLA 2DVSA 5EVAA 4IR4A 5HQ7A 5E3GA 5HELA 4A9NA 5E9KA 5EU1A 3UVWA 5D3NA 5F1LA 5EA1A 4TZ2A 4NRAA 3FKMX 2E7OA 4NRCA 4F3IA 4J0RA 3HMFA 4A9LA 5CUDA 5AD2A 5A5SA 5DFCA 5J0DA 3UVYA 1E6IA 3U5OA 5DW2A 5H1TA 5CY9A 4HXNA 4PY6A 5D25A 5ETDA 4QSTA 4YYHA 4XUAA 5E9IA 4N4HA 5HQ5A 4IR5A 3JVKA 4TT2A 5L8UA 5EI4A 5KTWA 4YBSA 5DYUA 5LUUA 4LYWA 3IU5A 4MENA 4UYDA 4Q0OA 5KU3A 5FE9A 4ALHA 4ZC9A 3LJWA 4LYSA 4TZ8A 5F62A 4NR6A 5ENBA 4NYXA 4QSXA 5F1HA 5D3TA 4NR5A 4GPJA 4UITA 5FFYA 3U5JA 2R0YA 2FSAA 2YEMA 5LKXA 5ENEA 5DW1A 3P1EA 5KTXA 5A7CA 4LR6A 2WP2A 5HFQA 4HBWA 5I80A 4CUUA 5DYCA 4J3IA 2MJVB 5ENCA 3G0JA 5CUEA 4NR7A 4UIVA 4MEOA 5E9YA 4CFKA 4C66A 4HXOA 3MQMA 5A5RA 5CQ8A 5KTUA 3DAIA 4O7AA 4HXPA 4UIWA 5FBXA 4LYIA 4HBYA 2RFJA 4IOOA 3LXJA 5FFVA 5D26A 4A9IA 5D7XA 5FDZA 2GRCA 4BW3A 5FG4A 2L84A 5IGNA 5E7DA 5EM3A 5EPSA 4TU4A 4ALGA 5IGKA 5CTLA 4QZSA 5ETBA 1X0JA 5ENGA 5I7XA 2LSPB 5EWDA 5I89A 3Q2EA 5II2A 5IGMA 5I88A 4NQNA 4TTEA 5A5PA 2RNWA 5A82A 5DFBA 4NUCA 3UV4A 3RCWA 4Y03A 3NXBA 5IIDA 5D3PA 5H1VA 2WP1A 4NR4A 2DVVA 4XY9A 4DONA 4IORA 2RNYA 4AKNA 4TYLA 5EICA 4QSRA 3UV5A 4MR3A 5CQ7A 5EK9A 4CLBA 4QR5A 4J0SA 4YY4A 4YAXA 4N4FA 4QUTA 4Z1QA 4OUFA 4QEVA 4NRBA 5CQ3A 4IR6A 3MUKA 5L96A 4NQMA 1N72A 2NXBA 4O70A 5F60A 3I3JA 3P1DA 5F63A 5F2PA 2YW5A 4O7EA 1WUMA 4Z6HA 4HXKA 4QSVA 5A5OA 4WHUA 2G4AA 4HXSA 5HCLA 2RO1A 4NYVA 4A9HA 5FE6A 5L98A 2RNXA 3QZVA 4YYGA 4MEQA 3D7CA 5CGPA 5CQTA 3S91A 5LKZA 4QR4A 2D9EA 3AADA 5FH8A 4CL9A 4QBMA 4O7CA 5CRZA 4O76A 5I7YA 4FLPA 5CQ4A 2E7NA 1ZS5A 4A9FA 3P1FA 5ENFA 5L97A 4HBVA 5CUCA 4LDFA 5EPRA 1F68A 4MR6A 5F3AA 5DKDA 4Z93A 5FE0A 4YH3A 2E3KA 5HRWA 4UIUA 4PCIA 4YATA 5LKUA 5DKCA 5CQAA 4OGJA 5HQ6A 2YEKA 5CUAA 4QYLA 2RI7A 5FG6A 5COIA 4O7FA 4CUTA 5D3SA 5BT5A 3O36A 2DKWA 5FFWA 5C8GA 4YYMA 3U5PA 5EV9A 3K2JA 3MULA 5HJCA 4QSPA 2F6NA 5CPEA 3HMEA 4UIZA 5FE8A 4CUQA 3DWYA 4LZRA 3LQIA 2DVRA 4LRGA 4E96A 5AMEA 4UIYA 5C87A 3QZTA 4QSQA 5EWCA 2YYNA 3AQAA 4HBXA 4O72A 4BW4A 4UYEA 4ZQLA 1JM4B 4QB3A 4YY6A 5HLSA 5ENHA 4HXLA 4QSSA 5FB0A 5A5QA 4QEUA 4A9MA 4HXRA 5L8TA 4CURA 4J1PA 4O75A 4QYDA 5FH6A 4YBTA 4IR3A 5D3RA 5D24A 5CQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KTB B;  5DYX A;  3TLP A;  4YBM A;  4CUP A;  4KV1 A;  3U5K A;  5II1 A;  5FE5 A;  5CRM A;  5KHM A;  5C89 A;  3IU6 A;  2R10 A;  3U5L A;  2OO1 A;  4LZS A;  5LJ1 A;  5E73 A;  5DX4 A;  4C67 A;  5F25 A;  3MXF A;  5FE7 A;  4O71 A;  4PTB A;  4UIX A;  4BHW A;  4A9J A;  5A5N A;  4TT6 A;  5L99 A;  5HEN A;  5IG6 A;  5C85 A;  2L85 A;  5I1Q A;  5EQ1 A;  4TS8 A;  5DLX A;  4LC2 A;  4YYJ A;  4QSW A;  4X2I A;  4CFL A;  3O35 A;  1WUG A;  5AMF A;  3LQJ A;  5D3J A;  4XYA A;  5D0C A;  5A85 A;  5JI8 A;  3UVD A;  4QR3 A;  5CQ6 A;  2N9G A;  3ZYU A;  5G4R A;  4QUU A;  4WIV A;  5LKT A;  3U5N A;  4QNS A;  5EPB A;  5D3H A;  4YYK A;  5CU8 A;  5HFR A;  2D82 A;  3S92 A;  3P5O A;  5I86 A;  5HRV A;  4QSU A;  5DBM A;  4BW2 A;  4YK0 A;  5ACY A;  5E9M A;  5H85 A;  3Q2F A;  4QEW A;  2I7K A;  2YEL A;  2YDW A;  3O33 A;  4OGI A;  2YQD A;  4QY4 A;  4HXM A;  4NYW A;  3P1C A;  2F6J A;  2OUO A;  4UYH A;  5KO4 A;  4TQN A;  4A9K A;  2OSS A;  4NS5 A;  1EQF A;  4YYD A;  2R0V A;  3SVF A;  3HMH A;  5DLZ A;  5FE4 A;  5HM0 A;  4LZ2 A;  5FG5 A;  3SVH A;  2I8N A;  5A81 A;  3UVX A;  5D3L A;  4YYN A;  3G0L A;  5C4Q A;  5I40 A;  4TU6 A;  4KCX A;  5TB6 A;  5HRX A;  3SVG A;  5LJ0 A;  2L5E A;  4O7B A;  4XY8 A;  5LJ2 A;  4YAD A;  4CUS A;  1JSP B;  3UW9 A;  4PKL A;  4WHW A;  3O34 A;  5E9V A;  3GG3 A;  4YAB A;  4PCE A;  5I29 A;  4A9E A;  4QC1 A;  4MR5 A;  4YC9 A;  5CUG A;  5HEM A;  3UV2 A;  5FE2 A;  4Q0N A;  4N4I A;  5FE1 A;  3JVM A;  5EGU A;  5FE3 A;  5LVR A;  5EP7 A;  4NUD A;  5DYA A;  4ZW1 A;  4Z1S A;  4QC3 A;  5CS8 A;  5E74 A;  5E3D A;  5I83 A;  3QZS A;  5H1U A;  4BJX A;  5K29 A;  5TCM A;  5CZG A;  5FB1 A;  5AD3 A;  5DY7 A;  4BW1 A;  4UYG A;  5BT4 A;  5IBN A;  3MB3 A;  2RS9 B;  4XUB A;  5CP5 A;  5C7N A;  5EWH A;  5A83 A;  4NUE A;  5CUB A;  3O37 A;  4O77 A;  5E0R A;  5JWM A;  5LVQ A;  5IGL A;  5EWW A;  3LQH A;  4YH4 A;  5BT3 A;  2H60 A;  5DKH A;  4IOQ A;  5ENJ A;  5G4S A;  4UYF A;  4MEP A;  4A9O A;  4NR8 A;  4NR9 A;  5EIS A;  3ONI A;  2DAT A;  5DFD A;  3JVJ A;  4NXJ A;  5F36 A;  4N3W A;  5F5Z A;  4UYF B;  4N4G A;  2DVQ A;  5FH7 A;  4O74 A;  5CFW A;  4KV4 A;  4Z6I A;  4MR4 A;  5F61 A;  3MB4 A;  4TT4 A;  5E9L A;  4O78 A;  3U5M A;  4PS5 A;  5ENI A;  2DWW A;  4RVR A;  4YYI A;  2R0S A;  5EWV A;  3JVL A;  2DVS A;  5EVA A;  4IR4 A;  5HQ7 A;  5E3G A;  5HEL A;  4A9N A;  5E9K A;  5EU1 A;  3UVW A;  5D3N A;  5F1L A;  5EA1 A;  4TZ2 A;  4NRA A;  3FKM X;  2E7O A;  4NRC A;  4F3I A;  4J0R A;  3HMF A;  4A9L A;  5CUD A;  5AD2 A;  5A5S A;  5DFC A;  5J0D A;  3UVY A;  1E6I A;  3U5O A;  5DW2 A;  5H1T A;  5CY9 A;  4HXN A;  4PY6 A;  5D25 A;  5ETD A;  4QST A;  4YYH A;  4XUA A;  5E9I A;  4N4H A;  5HQ5 A;  4IR5 A;  3JVK A;  4TT2 A;  5L8U A;  5EI4 A;  5KTW A;  4YBS A;  5DYU A;  5LUU A;  4LYW A;  3IU5 A;  4MEN A;  4UYD A;  4Q0O A;  5KU3 A;  5FE9 A;  4ALH A;  4ZC9 A;  3LJW A;  4LYS A;  4TZ8 A;  5F62 A;  4NR6 A;  5ENB A;  4NYX A;  4QSX A;  5F1H A;  5D3T A;  4NR5 A;  4GPJ A;  4UIT A;  5FFY A;  3U5J A;  2R0Y A;  2FSA A;  2YEM A;  5LKX A;  5ENE A;  5DW1 A;  3P1E A;  5KTX A;  5A7C A;  4LR6 A;  2WP2 A;  5HFQ A;  4HBW A;  5I80 A;  4CUU A;  5DYC A;  4J3I A;  2MJV B;  5ENC A;  3G0J A;  5CUE A;  4NR7 A;  4UIV A;  4MEO A;  5E9Y A;  4CFK A;  4C66 A;  4HXO A;  3MQM A;  5A5R A;  5CQ8 A;  5KTU A;  3DAI A;  4O7A A;  4HXP A;  4UIW A;  5FBX A;  4LYI A;  4HBY A;  2RFJ A;  4IOO A;  3LXJ A;  5FFV A;  5D26 A;  4A9I A;  5D7X A;  5FDZ A;  2GRC A;  4BW3 A;  5FG4 A;  2L84 A;  5IGN A;  5E7D A;  5EM3 A;  5EPS A;  4TU4 A;  4ALG A;  5IGK A;  5CTL A;  4QZS A;  5ETB A;  1X0J A;  5ENG A;  5I7X A;  2LSP B;  5EWD A;  5I89 A;  3Q2E A;  5II2 A;  5IGM A;  5I88 A;  4NQN A;  4TTE A;  5A5P A;  2RNW A;  5A82 A;  5DFB A;  4NUC A;  3UV4 A;  3RCW A;  4Y03 A;  3NXB A;  5IID A;  5D3P A;  5H1V A;  2WP1 A;  4NR4 A;  2DVV A;  4XY9 A;  4DON A;  4IOR A;  2RNY A;  4AKN A;  4TYL A;  5EIC A;  4QSR A;  3UV5 A;  4MR3 A;  5CQ7 A;  5EK9 A;  4CLB A;  4QR5 A;  4J0S A;  4YY4 A;  4YAX A;  4N4F A;  4QUT A;  4Z1Q A;  4OUF A;  4QEV A;  4NRB A;  5CQ3 A;  4IR6 A;  3MUK A;  5L96 A;  4NQM A;  1N72 A;  2NXB A;  4O70 A;  5F60 A;  3I3J A;  3P1D A;  5F63 A;  5F2P A;  2YW5 A;  4O7E A;  1WUM A;  4Z6H A;  4HXK A;  4QSV A;  5A5O A;  4WHU A;  2G4A A;  4HXS A;  5HCL A;  2RO1 A;  4NYV A;  4A9H A;  5FE6 A;  5L98 A;  2RNX A;  3QZV A;  4YYG A;  4MEQ A;  3D7C A;  5CGP A;  5CQT A;  3S91 A;  5LKZ A;  4QR4 A;  2D9E A;  3AAD A;  5FH8 A;  4CL9 A;  4QBM A;  4O7C A;  5CRZ A;  4O76 A;  5I7Y A;  4FLP A;  5CQ4 A;  2E7N A;  1ZS5 A;  4A9F A;  3P1F A;  5ENF A;  5L97 A;  4HBV A;  5CUC A;  4LDF A;  5EPR A;  1F68 A;  4MR6 A;  5F3A A;  5DKD A;  4Z93 A;  5FE0 A;  4YH3 A;  2E3K A;  5HRW A;  4UIU A;  4PCI A;  4YAT A;  5LKU A;  5DKC A;  5CQA A;  4OGJ A;  5HQ6 A;  2YEK A;  5CUA A;  4QYL A;  2RI7 A;  5FG6 A;  5COI A;  4O7F A;  4CUT A;  5D3S A;  5BT5 A;  3O36 A;  2DKW A;  5FFW A;  5C8G A;  4YYM A;  3U5P A;  5EV9 A;  3K2J A;  3MUL A;  5HJC A;  4QSP A;  2F6N A;  5CPE A;  3HME A;  4UIZ A;  5FE8 A;  4CUQ A;  3DWY A;  4LZR A;  3LQI A;  2DVR A;  4LRG A;  4E96 A;  5AME A;  4UIY A;  5C87 A;  3QZT A;  4QSQ A;  5EWC A;  2YYN A;  3AQA A;  4HBX A;  4O72 A;  4BW4 A;  4UYE A;  4ZQL A;  1JM4 B;  4QB3 A;  4YY6 A;  5HLS A;  5ENH A;  4HXL A;  4QSS A;  5FB0 A;  5A5Q A;  4QEU A;  4A9M A;  4HXR A;  5L8T A;  4CUR A;  4J1P A;  4O75 A;  4QYD A;  5FH6 A;  4YBT A;  4IR3 A;  5D3R A;  5D24 A;  5CQ5 A; 
#chains in the Genus database with same CATH topology
 2KTB B;  5DYX A;  3TLP A;  4YBM A;  4CUP A;  4KV1 A;  3U5K A;  5II1 A;  5FE5 A;  5CRM A;  5KHM A;  5C89 A;  3IU6 A;  2R10 A;  3U5L A;  2OO1 A;  4LZS A;  3D1D A;  5LJ1 A;  5E73 A;  5DX4 A;  4C67 A;  5F25 A;  3MXF A;  5FE7 A;  4O71 A;  4AI6 A;  4PTB A;  4UIX A;  4BHW A;  4A9J A;  5A5N A;  4TT6 A;  5L99 A;  5HEN A;  5IG6 A;  5C85 A;  2L85 A;  5I1Q A;  5EQ1 A;  4TS8 A;  5DLX A;  4LC2 A;  4YYJ A;  4QSW A;  4X2I A;  4CFL A;  3O35 A;  1WUG A;  5AMF A;  3LQJ A;  5D3J A;  4XYA A;  5D0C A;  5A85 A;  5JI8 A;  3UVD A;  4QR3 A;  5CQ6 A;  2N9G A;  3ZYU A;  5G4R A;  4QUU A;  4WIV A;  5LKT A;  3U5N A;  4QNS A;  5EPB A;  5D3H A;  4YYK A;  5CU8 A;  5HFR A;  2D82 A;  3S92 A;  3P5O A;  5I86 A;  5HRV A;  4QSU A;  5DBM A;  4BW2 A;  4YK0 A;  5ACY A;  5E9M A;  5H85 A;  3Q2F A;  4QEW A;  2I7K A;  1PUO A;  2YDW A;  2YEL A;  3O33 A;  4OGI A;  2YQD A;  4QY4 A;  4HXM A;  4NYW A;  3P1C A;  2F6J A;  2OUO A;  4UYH A;  5KO4 A;  4TQN A;  4A9K A;  2OSS A;  4NS5 A;  1EQF A;  4YYD A;  2R0V A;  3SVF A;  3HMH A;  5DLZ A;  5FE4 A;  5HM0 A;  4LZ2 A;  5FG5 A;  3SVH A;  2I8N A;  5A81 A;  3UVX A;  5D3L A;  4YYN A;  3G0L A;  5C4Q A;  5I40 A;  4TU6 A;  4KCX A;  5TB6 A;  5HRX A;  3SVG A;  5LJ0 A;  2L5E A;  4O7B A;  4XY8 A;  5LJ2 A;  4YAD A;  4CUS A;  1JSP B;  3UW9 A;  4PKL A;  4WHW A;  3O34 A;  5E9V A;  3GG3 A;  4YAB A;  4PCE A;  5I29 A;  4A9E A;  4QC1 A;  4MR5 A;  4YC9 A;  5CUG A;  5HEM A;  3UV2 A;  5FE2 A;  4Q0N A;  4N4I A;  5FE1 A;  3JVM A;  5EGU A;  5FE3 A;  5LVR A;  5EP7 A;  4NUD A;  5DYA A;  4ZW1 A;  4Z1S A;  4QC3 A;  5CS8 A;  5E74 A;  5E3D A;  5I83 A;  3QZS A;  5H1U A;  4BJX A;  5K29 A;  5TCM A;  5CZG A;  5FB1 A;  5AD3 A;  5DY7 A;  4BW1 A;  4UYG A;  5BT4 A;  5IBN A;  3MB3 A;  2RS9 B;  4XUB A;  5CP5 A;  5C7N A;  5EWH A;  5A83 A;  4NUE A;  5CUB A;  3O37 A;  4O77 A;  5E0R A;  5JWM A;  5LVQ A;  5IGL A;  5EWW A;  3LQH A;  4YH4 A;  5BT3 A;  2H60 A;  5DKH A;  4IOQ A;  5ENJ A;  5G4S A;  4UYF A;  4MEP A;  4A9O A;  4NR8 A;  4NR9 A;  5EIS A;  3ONI A;  2DAT A;  5DFD A;  3JVJ A;  4NXJ A;  5F36 A;  4N3W A;  5F5Z A;  4UYF B;  4N4G A;  2DVQ A;  5FH7 A;  4O74 A;  5CFW A;  4KV4 A;  4Z6I A;  4MR4 A;  5F61 A;  3MB4 A;  4TT4 A;  5E9L A;  4O78 A;  4AKI A;  3U5M A;  4AKG A;  4PS5 A;  5ENI A;  2DWW A;  4RVR A;  4YYI A;  2R0S A;  5EWV A;  3JVL A;  2DVS A;  5EVA A;  4IR4 A;  5HQ7 A;  5E3G A;  5HEL A;  4A9N A;  5E9K A;  5EU1 A;  3UVW A;  5D3N A;  5F1L A;  5EA1 A;  4TZ2 A;  4NRA A;  3FKM X;  2E7O A;  4NRC A;  4F3I A;  4J0R A;  3HMF A;  4A9L A;  5CUD A;  5AD2 A;  5A5S A;  5DFC A;  5J0D A;  3UVY A;  1E6I A;  3U5O A;  5DW2 A;  5H1T A;  5CY9 A;  4AKH A;  4HXN A;  4PY6 A;  5D25 A;  5ETD A;  4QST A;  4YYH A;  4XUA A;  5E9I A;  4N4H A;  3VKH A;  5HQ5 A;  4IR5 A;  3JVK A;  4TT2 A;  5L8U A;  5EI4 A;  5KTW A;  4YBS A;  5DYU A;  5LUU A;  4LYW A;  3IU5 A;  4MEN A;  4UYD A;  4Q0O A;  5KU3 A;  5FE9 A;  4ALH A;  4ZC9 A;  3LJW A;  4LYS A;  4TZ8 A;  5F62 A;  4NR6 A;  5ENB A;  4NYX A;  4QSX A;  5F1H A;  5D3T A;  4NR5 A;  4GPJ A;  4UIT A;  5FFY A;  3U5J A;  2R0Y A;  2FSA A;  2YEM A;  5LKX A;  5ENE A;  5DW1 A;  3P1E A;  5KTX A;  5A7C A;  4LR6 A;  2WP2 A;  5HFQ A;  4HBW A;  5I80 A;  4CUU A;  5DYC A;  4J3I A;  2MJV B;  5ENC A;  3G0J A;  5CUE A;  4NR7 A;  4UIV A;  4MEO A;  5E9Y A;  4CFK A;  4C66 A;  4HXO A;  3MQM A;  5A5R A;  5CQ8 A;  5KTU A;  3DAI A;  3D1B A;  4O7A A;  2EJN A;  4HXP A;  4UIW A;  5FBX A;  4LYI A;  4HBY A;  2RFJ A;  4IOO A;  3LXJ A;  5FFV A;  5D26 A;  4A9I A;  5D7X A;  5FDZ A;  2GRC A;  4BW3 A;  5FG4 A;  2L84 A;  5IGN A;  5E7D A;  5EM3 A;  5EPS A;  4TU4 A;  4ALG A;  5IGK A;  5CTL A;  4QZS A;  5ETB A;  1X0J A;  5ENG A;  5I7X A;  2LSP B;  5EWD A;  5I89 A;  3Q2E A;  5II2 A;  5IGM A;  5I88 A;  4NQN A;  4TTE A;  5A5P A;  2RNW A;  5A82 A;  5DFB A;  4NUC A;  3UV4 A;  3RCW A;  4Y03 A;  3NXB A;  5IID A;  5D3P A;  5H1V A;  2WP1 A;  4NR4 A;  2DVV A;  4XY9 A;  4DON A;  4IOR A;  2RNY A;  4AKN A;  4TYL A;  5EIC A;  4QSR A;  3UV5 A;  4MR3 A;  5CQ7 A;  5EK9 A;  4CLB A;  4QR5 A;  4J0S A;  4YY4 A;  4YAX A;  4N4F A;  4QUT A;  4Z1Q A;  4OUF A;  4QEV A;  4NRB A;  5CQ3 A;  4IR6 A;  3MUK A;  5L96 A;  4NQM A;  1N72 A;  2NXB A;  4O70 A;  5F60 A;  3I3J A;  3P1D A;  5F63 A;  5F2P A;  2YW5 A;  4O7E A;  1WUM A;  4Z6H A;  1ZKR A;  4HXK A;  4QSV A;  5A5O A;  4WHU A;  2G4A A;  4HXS A;  5HCL A;  2RO1 A;  4NYV A;  4A9H A;  5FE6 A;  5L98 A;  2RNX A;  3QZV A;  4YYG A;  4MEQ A;  3D7C A;  5CGP A;  5CQT A;  3S91 A;  5LKZ A;  4QR4 A;  2D9E A;  3AAD A;  5FH8 A;  4CL9 A;  4QBM A;  4O7C A;  5CRZ A;  4O76 A;  5I7Y A;  4FLP A;  5CQ4 A;  2E7N A;  1ZS5 A;  4A9F A;  3P1F A;  5ENF A;  5L97 A;  4HBV A;  5CUC A;  4LDF A;  5EPR A;  1F68 A;  4MR6 A;  5F3A A;  5DKD A;  4Z93 A;  5FE0 A;  4YH3 A;  2E3K A;  3ERR A;  5HRW A;  4UIU A;  4PCI A;  4YAT A;  5LKU A;  5DKC A;  5CQA A;  4OGJ A;  5HQ6 A;  2YEK A;  5CUA A;  4QYL A;  2RI7 A;  5FG6 A;  5COI A;  4O7F A;  4CUT A;  5D3S A;  5BT5 A;  3O36 A;  2DKW A;  5FFW A;  5C8G A;  4YYM A;  3U5P A;  5EV9 A;  3K2J A;  3MUL A;  5HJC A;  4QSP A;  2F6N A;  5CPE A;  3HME A;  4UIZ A;  5FE8 A;  4CUQ A;  3DWY A;  4LZR A;  3LQI A;  2DVR A;  4LRG A;  4E96 A;  5AME A;  4UIY A;  5C87 A;  3VKG A;  3QZT A;  4QSQ A;  5EWC A;  2YYN A;  3AQA A;  4HBX A;  4O72 A;  4BW4 A;  4UYE A;  4ZQL A;  1JM4 B;  4QB3 A;  4YY6 A;  5HLS A;  5ENH A;  4HXL A;  4QSS A;  5FB0 A;  5A5Q A;  4QEU A;  4A9M A;  4HXR A;  5L8T A;  4CUR A;  4J1P A;  4O75 A;  4QYD A;  5FH6 A;  4YBT A;  4IR3 A;  5D3R A;  5D24 A;  5CQ5 A; 
#chains in the Genus database with same CATH homology
 2KTB B;  5DYX A;  3TLP A;  4YBM A;  4CUP A;  4KV1 A;  3U5K A;  5II1 A;  5FE5 A;  5CRM A;  5KHM A;  5C89 A;  3IU6 A;  2R10 A;  3U5L A;  2OO1 A;  4LZS A;  5LJ1 A;  5E73 A;  5DX4 A;  4C67 A;  5F25 A;  3MXF A;  5FE7 A;  4O71 A;  4PTB A;  4UIX A;  4BHW A;  4A9J A;  5A5N A;  4TT6 A;  5L99 A;  5HEN A;  5IG6 A;  5C85 A;  2L85 A;  5I1Q A;  5EQ1 A;  4TS8 A;  5DLX A;  4LC2 A;  4YYJ A;  4QSW A;  4X2I A;  4CFL A;  3O35 A;  1WUG A;  5AMF A;  3LQJ A;  5D3J A;  4XYA A;  5D0C A;  5A85 A;  5JI8 A;  3UVD A;  4QR3 A;  5CQ6 A;  2N9G A;  3ZYU A;  5G4R A;  4QUU A;  4WIV A;  5LKT A;  3U5N A;  4QNS A;  5EPB A;  5D3H A;  4YYK A;  5CU8 A;  5HFR A;  2D82 A;  3S92 A;  3P5O A;  5I86 A;  5HRV A;  4QSU A;  5DBM A;  4BW2 A;  4YK0 A;  5ACY A;  5E9M A;  5H85 A;  3Q2F A;  4QEW A;  2I7K A;  2YEL A;  2YDW A;  3O33 A;  4OGI A;  2YQD A;  4QY4 A;  4HXM A;  4NYW A;  3P1C A;  2F6J A;  2OUO A;  4UYH A;  5KO4 A;  4TQN A;  4A9K A;  2OSS A;  4NS5 A;  1EQF A;  4YYD A;  2R0V A;  3SVF A;  3HMH A;  5DLZ A;  5FE4 A;  5HM0 A;  4LZ2 A;  5FG5 A;  3SVH A;  2I8N A;  5A81 A;  3UVX A;  5D3L A;  4YYN A;  3G0L A;  5C4Q A;  5I40 A;  4TU6 A;  4KCX A;  5TB6 A;  5HRX A;  3SVG A;  5LJ0 A;  2L5E A;  4O7B A;  4XY8 A;  5LJ2 A;  4YAD A;  4CUS A;  1JSP B;  3UW9 A;  4PKL A;  4WHW A;  3O34 A;  5E9V A;  3GG3 A;  4YAB A;  4PCE A;  5I29 A;  4A9E A;  4QC1 A;  4MR5 A;  4YC9 A;  5CUG A;  5HEM A;  3UV2 A;  5FE2 A;  4Q0N A;  4N4I A;  5FE1 A;  3JVM A;  5EGU A;  5FE3 A;  5LVR A;  5EP7 A;  4NUD A;  5DYA A;  4ZW1 A;  4Z1S A;  4QC3 A;  5CS8 A;  5E74 A;  5E3D A;  5I83 A;  3QZS A;  5H1U A;  4BJX A;  5K29 A;  5TCM A;  5CZG A;  5FB1 A;  5AD3 A;  5DY7 A;  4BW1 A;  4UYG A;  5BT4 A;  5IBN A;  3MB3 A;  2RS9 B;  4XUB A;  5CP5 A;  5C7N A;  5EWH A;  5A83 A;  4NUE A;  5CUB A;  3O37 A;  4O77 A;  5E0R A;  5JWM A;  5LVQ A;  5IGL A;  5EWW A;  3LQH A;  4YH4 A;  5BT3 A;  2H60 A;  5DKH A;  4IOQ A;  5ENJ A;  5G4S A;  4UYF A;  4MEP A;  4A9O A;  4NR8 A;  4NR9 A;  5EIS A;  3ONI A;  2DAT A;  5DFD A;  3JVJ A;  4NXJ A;  5F36 A;  4N3W A;  5F5Z A;  4UYF B;  4N4G A;  2DVQ A;  5FH7 A;  4O74 A;  5CFW A;  4KV4 A;  4Z6I A;  4MR4 A;  5F61 A;  3MB4 A;  4TT4 A;  5E9L A;  4O78 A;  3U5M A;  4PS5 A;  5ENI A;  2DWW A;  4RVR A;  4YYI A;  2R0S A;  5EWV A;  3JVL A;  2DVS A;  5EVA A;  4IR4 A;  5HQ7 A;  5E3G A;  5HEL A;  4A9N A;  5E9K A;  5EU1 A;  3UVW A;  5D3N A;  5F1L A;  5EA1 A;  4TZ2 A;  4NRA A;  3FKM X;  2E7O A;  4NRC A;  4F3I A;  4J0R A;  3HMF A;  4A9L A;  5CUD A;  5AD2 A;  5A5S A;  5DFC A;  5J0D A;  3UVY A;  1E6I A;  3U5O A;  5DW2 A;  5H1T A;  5CY9 A;  4HXN A;  4PY6 A;  5D25 A;  5ETD A;  4QST A;  4YYH A;  4XUA A;  5E9I A;  4N4H A;  5HQ5 A;  4IR5 A;  3JVK A;  4TT2 A;  5L8U A;  5EI4 A;  5KTW A;  4YBS A;  5DYU A;  5LUU A;  4LYW A;  3IU5 A;  4MEN A;  4UYD A;  4Q0O A;  5KU3 A;  5FE9 A;  4ALH A;  4ZC9 A;  3LJW A;  4LYS A;  4TZ8 A;  5F62 A;  4NR6 A;  5ENB A;  4NYX A;  4QSX A;  5F1H A;  5D3T A;  4NR5 A;  4GPJ A;  4UIT A;  5FFY A;  3U5J A;  2R0Y A;  2FSA A;  2YEM A;  5LKX A;  5ENE A;  5DW1 A;  3P1E A;  5KTX A;  5A7C A;  4LR6 A;  2WP2 A;  5HFQ A;  4HBW A;  5I80 A;  4CUU A;  5DYC A;  4J3I A;  2MJV B;  5ENC A;  3G0J A;  5CUE A;  4NR7 A;  4UIV A;  4MEO A;  5E9Y A;  4CFK A;  4C66 A;  4HXO A;  3MQM A;  5A5R A;  5CQ8 A;  5KTU A;  3DAI A;  4O7A A;  4HXP A;  4UIW A;  5FBX A;  4LYI A;  4HBY A;  2RFJ A;  4IOO A;  3LXJ A;  5FFV A;  5D26 A;  4A9I A;  5D7X A;  5FDZ A;  2GRC A;  4BW3 A;  5FG4 A;  2L84 A;  5IGN A;  5E7D A;  5EM3 A;  5EPS A;  4TU4 A;  4ALG A;  5IGK A;  5CTL A;  4QZS A;  5ETB A;  1X0J A;  5ENG A;  5I7X A;  2LSP B;  5EWD A;  5I89 A;  3Q2E A;  5II2 A;  5IGM A;  5I88 A;  4NQN A;  4TTE A;  5A5P A;  2RNW A;  5A82 A;  5DFB A;  4NUC A;  3UV4 A;  3RCW A;  4Y03 A;  3NXB A;  5IID A;  5D3P A;  5H1V A;  2WP1 A;  4NR4 A;  2DVV A;  4XY9 A;  4DON A;  4IOR A;  2RNY A;  4AKN A;  4TYL A;  5EIC A;  4QSR A;  3UV5 A;  4MR3 A;  5CQ7 A;  5EK9 A;  4CLB A;  4QR5 A;  4J0S A;  4YY4 A;  4YAX A;  4N4F A;  4QUT A;  4Z1Q A;  4OUF A;  4QEV A;  4NRB A;  5CQ3 A;  4IR6 A;  3MUK A;  5L96 A;  4NQM A;  1N72 A;  2NXB A;  4O70 A;  5F60 A;  3I3J A;  3P1D A;  5F63 A;  5F2P A;  2YW5 A;  4O7E A;  1WUM A;  4Z6H A;  4HXK A;  4QSV A;  5A5O A;  4WHU A;  2G4A A;  4HXS A;  5HCL A;  2RO1 A;  4NYV A;  4A9H A;  5FE6 A;  5L98 A;  2RNX A;  3QZV A;  4YYG A;  4MEQ A;  3D7C A;  5CGP A;  5CQT A;  3S91 A;  5LKZ A;  4QR4 A;  2D9E A;  3AAD A;  5FH8 A;  4CL9 A;  4QBM A;  4O7C A;  5CRZ A;  4O76 A;  5I7Y A;  4FLP A;  5CQ4 A;  2E7N A;  1ZS5 A;  4A9F A;  3P1F A;  5ENF A;  5L97 A;  4HBV A;  5CUC A;  4LDF A;  5EPR A;  1F68 A;  4MR6 A;  5F3A A;  5DKD A;  4Z93 A;  5FE0 A;  4YH3 A;  2E3K A;  5HRW A;  4UIU A;  4PCI A;  4YAT A;  5LKU A;  5DKC A;  5CQA A;  4OGJ A;  5HQ6 A;  2YEK A;  5CUA A;  4QYL A;  2RI7 A;  5FG6 A;  5COI A;  4O7F A;  4CUT A;  5D3S A;  5BT5 A;  3O36 A;  2DKW A;  5FFW A;  5C8G A;  4YYM A;  3U5P A;  5EV9 A;  3K2J A;  3MUL A;  5HJC A;  4QSP A;  2F6N A;  5CPE A;  3HME A;  4UIZ A;  5FE8 A;  4CUQ A;  3DWY A;  4LZR A;  3LQI A;  2DVR A;  4LRG A;  4E96 A;  5AME A;  4UIY A;  5C87 A;  3QZT A;  4QSQ A;  5EWC A;  2YYN A;  3AQA A;  4HBX A;  4O72 A;  4BW4 A;  4UYE A;  4ZQL A;  1JM4 B;  4QB3 A;  4YY6 A;  5HLS A;  5ENH A;  4HXL A;  4QSS A;  5FB0 A;  5A5Q A;  4QEU A;  4A9M A;  4HXR A;  5L8T A;  4CUR A;  4J1P A;  4O75 A;  4QYD A;  5FH6 A;  4YBT A;  4IR3 A;  5D3R A;  5D24 A;  5CQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...