5II1A

Crystal structure of the fifth bromodomain of human polybromo (pb1) in complex with 1-methylisochromeno[3,4-c]pyrazol-5(3h)-one
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
112
structure length
112
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein polybromo-1
publication title Discovery and Optimization of a Selective Ligand for the Switch/Sucrose Nonfermenting-Related Bromodomains of Polybromo Protein-1 by the Use of Virtual Screening and Hydration Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 36
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ii1A00
5E9MA 4YYKA 5A5QA 5F61A 3U5JA 4LR6A 5II2A 5JWMA 4XUBA 3TLPA 5CS8A 5DKHA 4A9NA 5A82A 1JSPB 5EWHA 5HENA 4YATA 4YBMA 3K2JA 3HMFA 5CRMA 5HFQA 5KTUA 4DONA 5IGLA 5CQ6A 4UIWA 4YH3A 2RI7A 3JVJA 5L99A 5CUBA 3MB3A 3U5PA 4LYIA 2DATA 1WUMA 1ZS5A 4Q0OA 5ENIA 5FE2A 4A9HA 3U5OA 4XY8A 3QZVA 2DVRA 5CUDA 4UIVA 3NXBA 4LZRA 5CQ5A 3I3JA 5FE0A 5LVQA 5CQ3A 4UIXA 5IBNA 5ENEA 5HJCA 5DX4A 5EPRA 4LYSA 4A9MA 2N9GA 5FFYA 4YY6A 3UW9A 4IR5A 4YH4A 4IOQA 4QSPA 4CUQA 3O36A 2OUOA 5DFDA 5EU1A 5L8UA 5DFBA 4IR4A 4MEOA 2RNXA 4NR9A 4BW3A 4O70A 5E9VA 4YYIA 5H1VA 2DVVA 5D3RA 4CUTA 1WUGA 4Z1QA 5I29A 5DYUA 5H1TA 5F62A 5I80A 4QUUA 3O33A 3O35A 4UYFA 4QBMA 4YY4A 4UYFB 4PY6A 4TU4A 3LXJA 5I88A 3LQIA 3MB4A 4NUDA 3P5OA 5HEMA 2YQDA 5F2PA 4CFKA 5FE3A 5I7YA 3HMHA 5ENJA 4IR3A 4NQNA 2L85A 4E96A 4O72A 5EICA 4QSRA 2GRCA 5HCLA 2L84A 4NYXA 5CUAA 5A5SA 5D3JA 4UITA 4QY4A 5EWDA 5CZGA 4QC1A 3QZTA 5A5OA 4NRAA 4PS5A 3JVLA 5AMFA 4NS5A 4CUUA 4HBWA 3IU5A 4CFLA 5C4QA 5FE6A 4Z1SA 5CU8A 2F6NA 5D7XA 3UV2A 4XUAA 3U5KA 4HXLA 4LC2A 5EWCA 3MXFA 4NR8A 4AKNA 4PTBA 2H60A 4CUPA 2I7KA 4O7FA 3O37A 5D25A 4O77A 4TU6A 4XYAA 5J0DA 2RO1A 4KV1A 4F3IA 4J3IA 3SVGA 4BW1A 4HXKA 5D3HA 4J1PA 2RS9B 5CQ7A 5I7XA 5DFCA 5DLZA 3SVFA 5A7CA 2RNYA 3LQHA 5DBMA 5A5PA 5EV9A 3S91A 4O7AA 2YEKA 5D24A 5EPBA 5E9IA 4PKLA 5CPEA 5D3LA 5FE1A 5FE9A 4IR6A 5F1HA 4HBYA 4NR4A 5ENHA 2KTBB 5E7DA 5I40A 4HBXA 5DW1A 4O76A 5AD2A 1F68A 5A81A 5D26A 4QYDA 5LKUA 5LJ0A 5CY9A 4QSTA 3HMEA 2YELA 5DLXA 5LKTA 2E7OA 5KHMA 1JM4B 4NUCA 5ETBA 5A85A 4MEPA 5E9LA 4N4FA 5FE5A 4TT2A 4KCXA 4PCIA 4QUTA 4UYGA 4Y03A 5EWVA 5CUEA 2LSPB 4RVRA 5DW2A 4TZ2A 5CQAA 4BJXA 5FH7A 5C87A 5C8GA 5IGNA 3FKMX 5FE8A 3DWYA 4MR3A 5KTWA 4QSQA 3MULA 4Z93A 4NRCA 2YW5A 3ONIA 5D3SA 5CFWA 4CUSA 5DYAA 5ENFA 5CUGA 1X0JA 5DY7A 5ACYA 5LUUA 5E74A 3U5LA 5BT4A 4QB3A 5E9YA 4LYWA 3P1EA 4KV4A 5EPSA 4ZQLA 4MR5A 5HELA 4Q0NA 2R0VA 4ZW1A 4CURA 5DKDA 4HXPA 5A5NA 4YADA 5HM0A 5E9KA 4MENA 4LDFA 5I83A 4YBTA 4N4GA 4TT6A 2YYNA 5F63A 4YYNA 5FFVA 4QC3A 5KTXA 4NR5A 1N72A 4O7CA 2OSSA 5EP7A 5D3NA 4O7BA 4PCEA 4NYWA 2DWWA 5ENCA 5E73A 5L98A 4HXNA 5A5RA 5LKZA 5I86A 4HXMA 3UVWA 5K29A 4O75A 3QZSA 5HRVA 3RCWA 3JVMA 5L96A 2YEMA 2DKWA 5EA1A 4QSUA 3U5NA 5FFWA 3Q2FA 4GPJA 5EISA 5IGKA 5JI8A 2OO1A 2WP1A 5C89A 2E7NA 3O34A 5IG6A 4NR6A 5AD3A 3G0JA 4TT4A 4UIUA 3GG3A 5CUCA 4NQMA 5FG4A 4LZSA 2R0SA 4Z6HA 5KU3A 5DYXA 4N3WA 4XY9A 5HQ7A 4BW4A 5BT5A 5EVAA 5LVRA 4A9KA 3LQJA 4QZSA 5IGMA 5G4SA 5L97A 5ENBA 4QSVA 4MEQA 5ETDA 5FE4A 2RNWA 4ALHA 4LZ2A 4QR3A 5D0CA 5LJ2A 2MJVB 4LRGA 4CLBA 4NXJA 4YYGA 4C67A 5I89A 5TCMA 5DKCA 5HQ6A 4YYJA 4OUFA 4YABA 4HBVA 5CGPA 2DVQA 3UV4A 5FB1A 4UIZA 3JVKA 4O7EA 3S92A 5E3GA 5TB6A 2YDWA 4X2IA 3UVXA 2L5EA 1EQFA 5E3DA 4YAXA 4Z6IA 4CL9A 3U5MA 5H1UA 5L8TA 4O74A 4OGIA 4ALGA 4N4IA 4NR7A 4OGJA 3P1CA 5HRXA 5FBXA 4BW2A 2WP2A 2RFJA 4HXOA 4MR4A 5EM3A 4QSSA 4TYLA 5F1LA 5F25A 4IORA 5FG5A 5II1A 5FB0A 3UVYA 4YK0A 2F6JA 3LJWA 4TS8A 5F36A 4J0SA 4TQNA 5I1QA 4A9IA 3DAIA 4QEVA 4HXRA 5ENGA 5H85A 3UVDA 4QEWA 5D3PA 2E3KA 3AADA 5FH8A 2D82A 4WIVA 5CQTA 4QSWA 3P1FA 5IIDA 2R10A 2FSAA 3MQMA 3D7CA 1E6IA 4O71A 3ZYUA 5FE7A 5EI4A 4QR5A 5C7NA 5E0RA 3SVHA 5A83A 4QEUA 4TTEA 5EGUA 4UIYA 5AMEA 2R0YA 3UV5A 5EK9A 5F5ZA 3G0LA 4C66A 5F60A 4A9LA 5HRWA 5EWWA 4A9FA 5CTLA 4NYVA 5CQ8A 4O78A 4YYDA 5FG6A 4A9EA 5CRZA 5COIA 2D9EA 3MUKA 5HLSA 5HFRA 5HQ5A 4YYMA 4UYEA 2G4AA 4QNSA 5C85A 4YBSA 4UYHA 2NXBA 4J0RA 5DYCA 4YYHA 5EQ1A 4BHWA 2I8NA 4A9JA 4IOOA 2DVSA 4UYDA 4NRBA 4FLPA 5BT3A 4ZC9A 4N4HA 5CQ4A 3AQAA 5LJ1A 3IU6A 5G4RA 4MR6A 4YC9A 4A9OA 5CP5A 5FDZA 5F3AA 4QSXA 4NUEA 5D3TA 4WHUA 4HXSA 5FH6A 3Q2EA 5LKXA 3P1DA 5KO4A 4QYLA 4QR4A 4TZ8A 4WHWA
chains in the Genus database with same CATH superfamily
5E9MA 4YYKA 5A5QA 5F61A 3U5JA 4LR6A 5II2A 5JWMA 4XUBA 3TLPA 5CS8A 5DKHA 4A9NA 5A82A 1JSPB 5EWHA 5HENA 4YATA 4YBMA 3K2JA 3HMFA 5CRMA 5HFQA 5KTUA 4DONA 4AI6A 5IGLA 5CQ6A 4UIWA 4YH3A 2RI7A 3JVJA 3ERRA 5L99A 5CUBA 3MB3A 2EJNA 3U5PA 4LYIA 2DATA 1WUMA 1ZS5A 4Q0OA 5ENIA 5FE2A 4A9HA 3U5OA 4XY8A 1ZKRA 3QZVA 2DVRA 5CUDA 4UIVA 3NXBA 4LZRA 5CQ5A 3I3JA 5FE0A 5LVQA 5CQ3A 4UIXA 5IBNA 5ENEA 5HJCA 5DX4A 5EPRA 4LYSA 4A9MA 2N9GA 5FFYA 4YY6A 3UW9A 4IR5A 4YH4A 4IOQA 4QSPA 4CUQA 3O36A 2OUOA 5DFDA 5EU1A 5L8UA 5DFBA 4IR4A 4MEOA 2RNXA 4NR9A 4BW3A 4O70A 5E9VA 4YYIA 5H1VA 2DVVA 5D3RA 4CUTA 1WUGA 4Z1QA 5I29A 3D1BA 5DYUA 5H1TA 5F62A 5I80A 4QUUA 3O33A 3O35A 4UYFA 4QBMA 4YY4A 4UYFB 4AKIA 4PY6A 4TU4A 3LXJA 5I88A 3LQIA 3MB4A 4NUDA 3P5OA 5HEMA 2YQDA 5F2PA 4CFKA 5FE3A 5I7YA 3HMHA 5ENJA 4IR3A 4NQNA 2L85A 4E96A 4O72A 5EICA 4QSRA 2GRCA 5HCLA 2L84A 4NYXA 5CUAA 5A5SA 5D3JA 4UITA 4QY4A 5EWDA 5CZGA 4QC1A 3QZTA 5A5OA 4NRAA 4PS5A 3JVLA 5AMFA 4NS5A 4CUUA 4HBWA 3IU5A 4CFLA 5C4QA 5FE6A 4Z1SA 5CU8A 2F6NA 5D7XA 3UV2A 4XUAA 3U5KA 4HXLA 4LC2A 5EWCA 3MXFA 4NR8A 4AKNA 4PTBA 2H60A 4CUPA 2I7KA 4O7FA 4AKGA 3O37A 5D25A 4O77A 4TU6A 4XYAA 5J0DA 2RO1A 4KV1A 4F3IA 4J3IA 3SVGA 4BW1A 4HXKA 5D3HA 4J1PA 2RS9B 5CQ7A 5I7XA 5DFCA 5DLZA 3SVFA 5A7CA 2RNYA 3LQHA 5DBMA 5A5PA 5EV9A 3S91A 4O7AA 2YEKA 5D24A 5EPBA 5E9IA 4PKLA 5CPEA 5D3LA 5FE1A 5FE9A 4IR6A 5F1HA 4HBYA 4NR4A 5ENHA 2KTBB 5E7DA 5I40A 4HBXA 5DW1A 4O76A 5AD2A 1F68A 5A81A 5D26A 4QYDA 5LKUA 5LJ0A 5CY9A 4QSTA 3HMEA 2YELA 5DLXA 5LKTA 2E7OA 5KHMA 1JM4B 4NUCA 5ETBA 5A85A 4MEPA 5E9LA 4N4FA 5FE5A 4TT2A 4KCXA 4PCIA 4QUTA 4UYGA 4Y03A 5EWVA 5CUEA 2LSPB 4RVRA 5DW2A 4TZ2A 5CQAA 4BJXA 5FH7A 5C87A 5C8GA 5IGNA 3FKMX 5FE8A 3DWYA 4MR3A 3D1DA 5KTWA 4QSQA 3MULA 4Z93A 4NRCA 2YW5A 3ONIA 5D3SA 5CFWA 4CUSA 5DYAA 5ENFA 5CUGA 1X0JA 5DY7A 5ACYA 3VKGA 5LUUA 5E74A 3U5LA 5BT4A 4QB3A 1PUOA 5E9YA 4LYWA 3P1EA 4KV4A 5EPSA 4ZQLA 4MR5A 5HELA 4Q0NA 2R0VA 4ZW1A 4CURA 5DKDA 4HXPA 5A5NA 4YADA 5HM0A 5E9KA 4MENA 4LDFA 5I83A 4YBTA 4N4GA 4TT6A 2YYNA 5F63A 4YYNA 5FFVA 4QC3A 5KTXA 4NR5A 1N72A 4O7CA 2OSSA 5EP7A 5D3NA 4O7BA 4PCEA 4NYWA 2DWWA 5ENCA 5E73A 5L98A 4HXNA 5A5RA 5LKZA 5I86A 4HXMA 3UVWA 5K29A 4O75A 3QZSA 5HRVA 3RCWA 3JVMA 5L96A 2YEMA 2DKWA 5EA1A 4QSUA 3U5NA 5FFWA 3Q2FA 4GPJA 5EISA 5IGKA 5JI8A 2OO1A 2WP1A 5C89A 2E7NA 3O34A 5IG6A 4NR6A 5AD3A 3G0JA 4TT4A 4UIUA 3GG3A 5CUCA 4NQMA 5FG4A 4LZSA 2R0SA 4Z6HA 5KU3A 5DYXA 4N3WA 4XY9A 5HQ7A 4BW4A 5BT5A 5EVAA 5LVRA 4A9KA 3LQJA 4QZSA 5IGMA 5G4SA 5L97A 5ENBA 4QSVA 4MEQA 5ETDA 5FE4A 2RNWA 4ALHA 4LZ2A 4QR3A 5D0CA 5LJ2A 2MJVB 4LRGA 4CLBA 4NXJA 4YYGA 4C67A 5I89A 5TCMA 5DKCA 5HQ6A 4YYJA 4OUFA 4YABA 4HBVA 5CGPA 2DVQA 3UV4A 5FB1A 4UIZA 3JVKA 4O7EA 3S92A 5E3GA 5TB6A 2YDWA 4X2IA 3UVXA 2L5EA 1EQFA 5E3DA 4YAXA 4Z6IA 4CL9A 3VKHA 3U5MA 5H1UA 5L8TA 4O74A 4OGIA 4ALGA 4N4IA 4NR7A 4OGJA 3P1CA 5HRXA 5FBXA 4BW2A 2WP2A 2RFJA 4HXOA 4MR4A 5EM3A 4QSSA 4TYLA 5F1LA 5F25A 4IORA 5FG5A 5II1A 5FB0A 3UVYA 4YK0A 2F6JA 3LJWA 4TS8A 5F36A 4J0SA 4TQNA 5I1QA 4AKHA 4A9IA 3DAIA 4QEVA 4HXRA 5ENGA 5H85A 3UVDA 4QEWA 5D3PA 2E3KA 3AADA 5FH8A 2D82A 4WIVA 5CQTA 4QSWA 3P1FA 5IIDA 2R10A 2FSAA 3MQMA 3D7CA 1E6IA 4O71A 3ZYUA 5FE7A 5EI4A 4QR5A 5C7NA 5E0RA 3SVHA 5A83A 4QEUA 4TTEA 5EGUA 4UIYA 5AMEA 2R0YA 3UV5A 5EK9A 5F5ZA 3G0LA 4C66A 5F60A 4A9LA 5HRWA 5EWWA 4A9FA 5CTLA 4NYVA 5CQ8A 4O78A 4YYDA 5FG6A 4A9EA 5CRZA 5COIA 2D9EA 3MUKA 5HLSA 5HFRA 5HQ5A 4YYMA 4UYEA 2G4AA 4QNSA 5C85A 4YBSA 4UYHA 2NXBA 4J0RA 5DYCA 4YYHA 5EQ1A 4BHWA 2I8NA 4A9JA 4IOOA 2DVSA 4UYDA 4NRBA 4FLPA 5BT3A 4ZC9A 4N4HA 5CQ4A 3AQAA 5LJ1A 3IU6A 5G4RA 4MR6A 4YC9A 4A9OA 5CP5A 5FDZA 5F3AA 4QSXA 4NUEA 5D3TA 4WHUA 4HXSA 5FH6A 3Q2EA 5LKXA 3P1DA 5KO4A 4QYLA 4QR4A 4TZ8A 4WHWA
chains in the Genus database with same CATH topology
5E9MA 4YYKA 5A5QA 5F61A 3U5JA 4LR6A 5II2A 5JWMA 4XUBA 3TLPA 5CS8A 5DKHA 4A9NA 5A82A 1JSPB 5EWHA 5HENA 4YATA 4YBMA 3K2JA 3HMFA 5CRMA 5HFQA 5KTUA 4DONA 5IGLA 5CQ6A 4UIWA 4YH3A 2RI7A 3JVJA 5L99A 5CUBA 3MB3A 3U5PA 4LYIA 2DATA 1WUMA 1ZS5A 4Q0OA 5ENIA 5FE2A 4A9HA 3U5OA 4XY8A 3QZVA 2DVRA 5CUDA 4UIVA 3NXBA 4LZRA 5CQ5A 3I3JA 5FE0A 5LVQA 5CQ3A 4UIXA 5IBNA 5ENEA 5HJCA 5DX4A 5EPRA 4LYSA 4A9MA 2N9GA 5FFYA 4YY6A 3UW9A 4IR5A 4YH4A 4IOQA 4QSPA 4CUQA 3O36A 2OUOA 5DFDA 5EU1A 5L8UA 5DFBA 4IR4A 4MEOA 2RNXA 4NR9A 4BW3A 4O70A 5E9VA 4YYIA 5H1VA 2DVVA 5D3RA 4CUTA 1WUGA 4Z1QA 5I29A 5DYUA 5H1TA 5F62A 5I80A 4QUUA 3O33A 3O35A 4UYFA 4QBMA 4YY4A 4UYFB 4PY6A 4TU4A 3LXJA 5I88A 3LQIA 3MB4A 4NUDA 3P5OA 5HEMA 2YQDA 5F2PA 4CFKA 5FE3A 5I7YA 3HMHA 5ENJA 4IR3A 4NQNA 2L85A 4E96A 4O72A 5EICA 4QSRA 2GRCA 5HCLA 2L84A 4NYXA 5CUAA 5A5SA 5D3JA 4UITA 4QY4A 5EWDA 5CZGA 4QC1A 3QZTA 5A5OA 4NRAA 4PS5A 3JVLA 5AMFA 4NS5A 4CUUA 4HBWA 3IU5A 4CFLA 5C4QA 5FE6A 4Z1SA 5CU8A 2F6NA 5D7XA 3UV2A 4XUAA 3U5KA 4HXLA 4LC2A 5EWCA 3MXFA 4NR8A 4AKNA 4PTBA 2H60A 4CUPA 2I7KA 4O7FA 3O37A 5D25A 4O77A 4TU6A 4XYAA 5J0DA 2RO1A 4KV1A 4F3IA 4J3IA 3SVGA 4BW1A 4HXKA 5D3HA 4J1PA 2RS9B 5CQ7A 5I7XA 5DFCA 5DLZA 3SVFA 5A7CA 2RNYA 3LQHA 5DBMA 5A5PA 5EV9A 3S91A 4O7AA 2YEKA 5D24A 5EPBA 5E9IA 4PKLA 5CPEA 5D3LA 5FE1A 5FE9A 4IR6A 5F1HA 4HBYA 4NR4A 5ENHA 2KTBB 5E7DA 5I40A 4HBXA 5DW1A 4O76A 5AD2A 1F68A 5A81A 5D26A 4QYDA 5LKUA 5LJ0A 5CY9A 4QSTA 3HMEA 2YELA 5DLXA 5LKTA 2E7OA 5KHMA 1JM4B 4NUCA 5ETBA 5A85A 4MEPA 5E9LA 4N4FA 5FE5A 4TT2A 4KCXA 4PCIA 4QUTA 4UYGA 4Y03A 5EWVA 5CUEA 2LSPB 4RVRA 5DW2A 4TZ2A 5CQAA 4BJXA 5FH7A 5C87A 5C8GA 5IGNA 3FKMX 5FE8A 3DWYA 4MR3A 5KTWA 4QSQA 3MULA 4Z93A 4NRCA 2YW5A 3ONIA 5D3SA 5CFWA 4CUSA 5DYAA 5ENFA 5CUGA 1X0JA 5DY7A 5ACYA 5LUUA 5E74A 3U5LA 5BT4A 4QB3A 5E9YA 4LYWA 3P1EA 4KV4A 5EPSA 4ZQLA 4MR5A 5HELA 4Q0NA 2R0VA 4ZW1A 4CURA 5DKDA 4HXPA 5A5NA 4YADA 5HM0A 5E9KA 4MENA 4LDFA 5I83A 4YBTA 4N4GA 4TT6A 2YYNA 5F63A 4YYNA 5FFVA 4QC3A 5KTXA 4NR5A 1N72A 4O7CA 2OSSA 5EP7A 5D3NA 4O7BA 4PCEA 4NYWA 2DWWA 5ENCA 5E73A 5L98A 4HXNA 5A5RA 5LKZA 5I86A 4HXMA 3UVWA 5K29A 4O75A 3QZSA 5HRVA 3RCWA 3JVMA 5L96A 2YEMA 2DKWA 5EA1A 4QSUA 3U5NA 5FFWA 3Q2FA 4GPJA 5EISA 5IGKA 5JI8A 2OO1A 2WP1A 5C89A 2E7NA 3O34A 5IG6A 4NR6A 5AD3A 3G0JA 4TT4A 4UIUA 3GG3A 5CUCA 4NQMA 5FG4A 4LZSA 2R0SA 4Z6HA 5KU3A 5DYXA 4N3WA 4XY9A 5HQ7A 4BW4A 5BT5A 5EVAA 5LVRA 4A9KA 3LQJA 4QZSA 5IGMA 5G4SA 5L97A 5ENBA 4QSVA 4MEQA 5ETDA 5FE4A 2RNWA 4ALHA 4LZ2A 4QR3A 5D0CA 5LJ2A 2MJVB 4LRGA 4CLBA 4NXJA 4YYGA 4C67A 5I89A 5TCMA 5DKCA 5HQ6A 4YYJA 4OUFA 4YABA 4HBVA 5CGPA 2DVQA 3UV4A 5FB1A 4UIZA 3JVKA 4O7EA 3S92A 5E3GA 5TB6A 2YDWA 4X2IA 3UVXA 2L5EA 1EQFA 5E3DA 4YAXA 4Z6IA 4CL9A 3U5MA 5H1UA 5L8TA 4O74A 4OGIA 4ALGA 4N4IA 4NR7A 4OGJA 3P1CA 5HRXA 5FBXA 4BW2A 2WP2A 2RFJA 4HXOA 4MR4A 5EM3A 4QSSA 4TYLA 5F1LA 5F25A 4IORA 5FG5A 5II1A 5FB0A 3UVYA 4YK0A 2F6JA 3LJWA 4TS8A 5F36A 4J0SA 4TQNA 5I1QA 4A9IA 3DAIA 4QEVA 4HXRA 5ENGA 5H85A 3UVDA 4QEWA 5D3PA 2E3KA 3AADA 5FH8A 2D82A 4WIVA 5CQTA 4QSWA 3P1FA 5IIDA 2R10A 2FSAA 3MQMA 3D7CA 1E6IA 4O71A 3ZYUA 5FE7A 5EI4A 4QR5A 5C7NA 5E0RA 3SVHA 5A83A 4QEUA 4TTEA 5EGUA 4UIYA 5AMEA 2R0YA 3UV5A 5EK9A 5F5ZA 3G0LA 4C66A 5F60A 4A9LA 5HRWA 5EWWA 4A9FA 5CTLA 4NYVA 5CQ8A 4O78A 4YYDA 5FG6A 4A9EA 5CRZA 5COIA 2D9EA 3MUKA 5HLSA 5HFRA 5HQ5A 4YYMA 4UYEA 2G4AA 4QNSA 5C85A 4YBSA 4UYHA 2NXBA 4J0RA 5DYCA 4YYHA 5EQ1A 4BHWA 2I8NA 4A9JA 4IOOA 2DVSA 4UYDA 4NRBA 4FLPA 5BT3A 4ZC9A 4N4HA 5CQ4A 3AQAA 5LJ1A 3IU6A 5G4RA 4MR6A 4YC9A 4A9OA 5CP5A 5FDZA 5F3AA 4QSXA 4NUEA 5D3TA 4WHUA 4HXSA 5FH6A 3Q2EA 5LKXA 3P1DA 5KO4A 4QYLA 4QR4A 4TZ8A 4WHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E9M A;  4YYK A;  5A5Q A;  5F61 A;  3U5J A;  4LR6 A;  5II2 A;  5JWM A;  4XUB A;  3TLP A;  5CS8 A;  5DKH A;  4A9N A;  5A82 A;  1JSP B;  5EWH A;  5HEN A;  4YAT A;  4YBM A;  3K2J A;  3HMF A;  5CRM A;  5HFQ A;  5KTU A;  4DON A;  5IGL A;  5CQ6 A;  4UIW A;  4YH3 A;  2RI7 A;  3JVJ A;  5L99 A;  5CUB A;  3MB3 A;  3U5P A;  4LYI A;  2DAT A;  1WUM A;  1ZS5 A;  4Q0O A;  5ENI A;  5FE2 A;  4A9H A;  3U5O A;  4XY8 A;  3QZV A;  2DVR A;  5CUD A;  4UIV A;  3NXB A;  4LZR A;  5CQ5 A;  3I3J A;  5FE0 A;  5LVQ A;  5CQ3 A;  4UIX A;  5IBN A;  5ENE A;  5HJC A;  5DX4 A;  5EPR A;  4LYS A;  4A9M A;  2N9G A;  5FFY A;  4YY6 A;  3UW9 A;  4IR5 A;  4YH4 A;  4IOQ A;  4QSP A;  4CUQ A;  3O36 A;  2OUO A;  5DFD A;  5EU1 A;  5L8U A;  5DFB A;  4IR4 A;  4MEO A;  2RNX A;  4NR9 A;  4BW3 A;  4O70 A;  5E9V A;  4YYI A;  5H1V A;  2DVV A;  5D3R A;  4CUT A;  1WUG A;  4Z1Q A;  5I29 A;  5DYU A;  5H1T A;  5F62 A;  5I80 A;  4QUU A;  3O33 A;  3O35 A;  4UYF A;  4QBM A;  4YY4 A;  4UYF B;  4PY6 A;  4TU4 A;  3LXJ A;  5I88 A;  3LQI A;  3MB4 A;  4NUD A;  3P5O A;  5HEM A;  2YQD A;  5F2P A;  4CFK A;  5FE3 A;  5I7Y A;  3HMH A;  5ENJ A;  4IR3 A;  4NQN A;  2L85 A;  4E96 A;  4O72 A;  5EIC A;  4QSR A;  2GRC A;  5HCL A;  2L84 A;  4NYX A;  5CUA A;  5A5S A;  5D3J A;  4UIT A;  4QY4 A;  5EWD A;  5CZG A;  4QC1 A;  3QZT A;  5A5O A;  4NRA A;  4PS5 A;  3JVL A;  5AMF A;  4NS5 A;  4CUU A;  4HBW A;  3IU5 A;  4CFL A;  5C4Q A;  5FE6 A;  4Z1S A;  5CU8 A;  2F6N A;  5D7X A;  3UV2 A;  4XUA A;  3U5K A;  4HXL A;  4LC2 A;  5EWC A;  3MXF A;  4NR8 A;  4AKN A;  4PTB A;  2H60 A;  4CUP A;  2I7K A;  4O7F A;  3O37 A;  5D25 A;  4O77 A;  4TU6 A;  4XYA A;  5J0D A;  2RO1 A;  4KV1 A;  4F3I A;  4J3I A;  3SVG A;  4BW1 A;  4HXK A;  5D3H A;  4J1P A;  2RS9 B;  5CQ7 A;  5I7X A;  5DFC A;  5DLZ A;  3SVF A;  5A7C A;  2RNY A;  3LQH A;  5DBM A;  5A5P A;  5EV9 A;  3S91 A;  4O7A A;  2YEK A;  5D24 A;  5EPB A;  5E9I A;  4PKL A;  5CPE A;  5D3L A;  5FE1 A;  5FE9 A;  4IR6 A;  5F1H A;  4HBY A;  4NR4 A;  5ENH A;  2KTB B;  5E7D A;  5I40 A;  4HBX A;  5DW1 A;  4O76 A;  5AD2 A;  1F68 A;  5A81 A;  5D26 A;  4QYD A;  5LKU A;  5LJ0 A;  5CY9 A;  4QST A;  3HME A;  2YEL A;  5DLX A;  5LKT A;  2E7O A;  5KHM A;  1JM4 B;  4NUC A;  5ETB A;  5A85 A;  4MEP A;  5E9L A;  4N4F A;  5FE5 A;  4TT2 A;  4KCX A;  4PCI A;  4QUT A;  4UYG A;  4Y03 A;  5EWV A;  5CUE A;  2LSP B;  4RVR A;  5DW2 A;  4TZ2 A;  5CQA A;  4BJX A;  5FH7 A;  5C87 A;  5C8G A;  5IGN A;  3FKM X;  5FE8 A;  3DWY A;  4MR3 A;  5KTW A;  4QSQ A;  3MUL A;  4Z93 A;  4NRC A;  2YW5 A;  3ONI A;  5D3S A;  5CFW A;  4CUS A;  5DYA A;  5ENF A;  5CUG A;  1X0J A;  5DY7 A;  5ACY A;  5LUU A;  5E74 A;  3U5L A;  5BT4 A;  4QB3 A;  5E9Y A;  4LYW A;  3P1E A;  4KV4 A;  5EPS A;  4ZQL A;  4MR5 A;  5HEL A;  4Q0N A;  2R0V A;  4ZW1 A;  4CUR A;  5DKD A;  4HXP A;  5A5N A;  4YAD A;  5HM0 A;  5E9K A;  4MEN A;  4LDF A;  5I83 A;  4YBT A;  4N4G A;  4TT6 A;  2YYN A;  5F63 A;  4YYN A;  5FFV A;  4QC3 A;  5KTX A;  4NR5 A;  1N72 A;  4O7C A;  2OSS A;  5EP7 A;  5D3N A;  4O7B A;  4PCE A;  4NYW A;  2DWW A;  5ENC A;  5E73 A;  5L98 A;  4HXN A;  5A5R A;  5LKZ A;  5I86 A;  4HXM A;  3UVW A;  5K29 A;  4O75 A;  3QZS A;  5HRV A;  3RCW A;  3JVM A;  5L96 A;  2YEM A;  2DKW A;  5EA1 A;  4QSU A;  3U5N A;  5FFW A;  3Q2F A;  4GPJ A;  5EIS A;  5IGK A;  5JI8 A;  2OO1 A;  2WP1 A;  5C89 A;  2E7N A;  3O34 A;  5IG6 A;  4NR6 A;  5AD3 A;  3G0J A;  4TT4 A;  4UIU A;  3GG3 A;  5CUC A;  4NQM A;  5FG4 A;  4LZS A;  2R0S A;  4Z6H A;  5KU3 A;  5DYX A;  4N3W A;  4XY9 A;  5HQ7 A;  4BW4 A;  5BT5 A;  5EVA A;  5LVR A;  4A9K A;  3LQJ A;  4QZS A;  5IGM A;  5G4S A;  5L97 A;  5ENB A;  4QSV A;  4MEQ A;  5ETD A;  5FE4 A;  2RNW A;  4ALH A;  4LZ2 A;  4QR3 A;  5D0C A;  5LJ2 A;  2MJV B;  4LRG A;  4CLB A;  4NXJ A;  4YYG A;  4C67 A;  5I89 A;  5TCM A;  5DKC A;  5HQ6 A;  4YYJ A;  4OUF A;  4YAB A;  4HBV A;  5CGP A;  2DVQ A;  3UV4 A;  5FB1 A;  4UIZ A;  3JVK A;  4O7E A;  3S92 A;  5E3G A;  5TB6 A;  2YDW A;  4X2I A;  3UVX A;  2L5E A;  1EQF A;  5E3D A;  4YAX A;  4Z6I A;  4CL9 A;  3U5M A;  5H1U A;  5L8T A;  4O74 A;  4OGI A;  4ALG A;  4N4I A;  4NR7 A;  4OGJ A;  3P1C A;  5HRX A;  5FBX A;  4BW2 A;  2WP2 A;  2RFJ A;  4HXO A;  4MR4 A;  5EM3 A;  4QSS A;  4TYL A;  5F1L A;  5F25 A;  4IOR A;  5FG5 A;  5II1 A;  5FB0 A;  3UVY A;  4YK0 A;  2F6J A;  3LJW A;  4TS8 A;  5F36 A;  4J0S A;  4TQN A;  5I1Q A;  4A9I A;  3DAI A;  4QEV A;  4HXR A;  5ENG A;  5H85 A;  3UVD A;  4QEW A;  5D3P A;  2E3K A;  3AAD A;  5FH8 A;  2D82 A;  4WIV A;  5CQT A;  4QSW A;  3P1F A;  5IID A;  2R10 A;  2FSA A;  3MQM A;  3D7C A;  1E6I A;  4O71 A;  3ZYU A;  5FE7 A;  5EI4 A;  4QR5 A;  5C7N A;  5E0R A;  3SVH A;  5A83 A;  4QEU A;  4TTE A;  5EGU A;  4UIY A;  5AME A;  2R0Y A;  3UV5 A;  5EK9 A;  5F5Z A;  3G0L A;  4C66 A;  5F60 A;  4A9L A;  5HRW A;  5EWW A;  4A9F A;  5CTL A;  4NYV A;  5CQ8 A;  4O78 A;  4YYD A;  5FG6 A;  4A9E A;  5CRZ A;  5COI A;  2D9E A;  3MUK A;  5HLS A;  5HFR A;  5HQ5 A;  4YYM A;  4UYE A;  2G4A A;  4QNS A;  5C85 A;  4YBS A;  4UYH A;  2NXB A;  4J0R A;  5DYC A;  4YYH A;  5EQ1 A;  4BHW A;  2I8N A;  4A9J A;  4IOO A;  2DVS A;  4UYD A;  4NRB A;  4FLP A;  5BT3 A;  4ZC9 A;  4N4H A;  5CQ4 A;  3AQA A;  5LJ1 A;  3IU6 A;  5G4R A;  4MR6 A;  4YC9 A;  4A9O A;  5CP5 A;  5FDZ A;  5F3A A;  4QSX A;  4NUE A;  5D3T A;  4WHU A;  4HXS A;  5FH6 A;  3Q2E A;  5LKX A;  3P1D A;  5KO4 A;  4QYL A;  4QR4 A;  4TZ8 A;  4WHW A; 
#chains in the Genus database with same CATH topology
 5E9M A;  4YYK A;  5A5Q A;  5F61 A;  3U5J A;  4LR6 A;  5II2 A;  5JWM A;  4XUB A;  3TLP A;  5CS8 A;  5DKH A;  4A9N A;  5A82 A;  1JSP B;  5EWH A;  5HEN A;  4YAT A;  4YBM A;  3K2J A;  3HMF A;  5CRM A;  5HFQ A;  5KTU A;  4DON A;  4AI6 A;  5IGL A;  5CQ6 A;  4UIW A;  4YH3 A;  2RI7 A;  3JVJ A;  3ERR A;  5L99 A;  5CUB A;  3MB3 A;  2EJN A;  3U5P A;  4LYI A;  2DAT A;  1WUM A;  1ZS5 A;  4Q0O A;  5ENI A;  5FE2 A;  4A9H A;  3U5O A;  4XY8 A;  1ZKR A;  3QZV A;  2DVR A;  5CUD A;  4UIV A;  3NXB A;  4LZR A;  5CQ5 A;  3I3J A;  5FE0 A;  5LVQ A;  5CQ3 A;  4UIX A;  5IBN A;  5ENE A;  5HJC A;  5DX4 A;  5EPR A;  4LYS A;  4A9M A;  2N9G A;  5FFY A;  4YY6 A;  3UW9 A;  4IR5 A;  4YH4 A;  4IOQ A;  4QSP A;  4CUQ A;  3O36 A;  2OUO A;  5DFD A;  5EU1 A;  5L8U A;  5DFB A;  4IR4 A;  4MEO A;  2RNX A;  4NR9 A;  4BW3 A;  4O70 A;  5E9V A;  4YYI A;  5H1V A;  2DVV A;  5D3R A;  4CUT A;  1WUG A;  4Z1Q A;  5I29 A;  3D1B A;  5DYU A;  5H1T A;  5F62 A;  5I80 A;  4QUU A;  3O33 A;  3O35 A;  4UYF A;  4QBM A;  4YY4 A;  4UYF B;  4AKI A;  4PY6 A;  4TU4 A;  3LXJ A;  5I88 A;  3LQI A;  3MB4 A;  4NUD A;  3P5O A;  5HEM A;  2YQD A;  5F2P A;  4CFK A;  5FE3 A;  5I7Y A;  3HMH A;  5ENJ A;  4IR3 A;  4NQN A;  2L85 A;  4E96 A;  4O72 A;  5EIC A;  4QSR A;  2GRC A;  5HCL A;  2L84 A;  4NYX A;  5CUA A;  5A5S A;  5D3J A;  4UIT A;  4QY4 A;  5EWD A;  5CZG A;  4QC1 A;  3QZT A;  5A5O A;  4NRA A;  4PS5 A;  3JVL A;  5AMF A;  4NS5 A;  4CUU A;  4HBW A;  3IU5 A;  4CFL A;  5C4Q A;  5FE6 A;  4Z1S A;  5CU8 A;  2F6N A;  5D7X A;  3UV2 A;  4XUA A;  3U5K A;  4HXL A;  4LC2 A;  5EWC A;  3MXF A;  4NR8 A;  4AKN A;  4PTB A;  2H60 A;  4CUP A;  2I7K A;  4O7F A;  4AKG A;  3O37 A;  5D25 A;  4O77 A;  4TU6 A;  4XYA A;  5J0D A;  2RO1 A;  4KV1 A;  4F3I A;  4J3I A;  3SVG A;  4BW1 A;  4HXK A;  5D3H A;  4J1P A;  2RS9 B;  5CQ7 A;  5I7X A;  5DFC A;  5DLZ A;  3SVF A;  5A7C A;  2RNY A;  3LQH A;  5DBM A;  5A5P A;  5EV9 A;  3S91 A;  4O7A A;  2YEK A;  5D24 A;  5EPB A;  5E9I A;  4PKL A;  5CPE A;  5D3L A;  5FE1 A;  5FE9 A;  4IR6 A;  5F1H A;  4HBY A;  4NR4 A;  5ENH A;  2KTB B;  5E7D A;  5I40 A;  4HBX A;  5DW1 A;  4O76 A;  5AD2 A;  1F68 A;  5A81 A;  5D26 A;  4QYD A;  5LKU A;  5LJ0 A;  5CY9 A;  4QST A;  3HME A;  2YEL A;  5DLX A;  5LKT A;  2E7O A;  5KHM A;  1JM4 B;  4NUC A;  5ETB A;  5A85 A;  4MEP A;  5E9L A;  4N4F A;  5FE5 A;  4TT2 A;  4KCX A;  4PCI A;  4QUT A;  4UYG A;  4Y03 A;  5EWV A;  5CUE A;  2LSP B;  4RVR A;  5DW2 A;  4TZ2 A;  5CQA A;  4BJX A;  5FH7 A;  5C87 A;  5C8G A;  5IGN A;  3FKM X;  5FE8 A;  3DWY A;  4MR3 A;  3D1D A;  5KTW A;  4QSQ A;  3MUL A;  4Z93 A;  4NRC A;  2YW5 A;  3ONI A;  5D3S A;  5CFW A;  4CUS A;  5DYA A;  5ENF A;  5CUG A;  1X0J A;  5DY7 A;  5ACY A;  3VKG A;  5LUU A;  5E74 A;  3U5L A;  5BT4 A;  4QB3 A;  1PUO A;  5E9Y A;  4LYW A;  3P1E A;  4KV4 A;  5EPS A;  4ZQL A;  4MR5 A;  5HEL A;  4Q0N A;  2R0V A;  4ZW1 A;  4CUR A;  5DKD A;  4HXP A;  5A5N A;  4YAD A;  5HM0 A;  5E9K A;  4MEN A;  4LDF A;  5I83 A;  4YBT A;  4N4G A;  4TT6 A;  2YYN A;  5F63 A;  4YYN A;  5FFV A;  4QC3 A;  5KTX A;  4NR5 A;  1N72 A;  4O7C A;  2OSS A;  5EP7 A;  5D3N A;  4O7B A;  4PCE A;  4NYW A;  2DWW A;  5ENC A;  5E73 A;  5L98 A;  4HXN A;  5A5R A;  5LKZ A;  5I86 A;  4HXM A;  3UVW A;  5K29 A;  4O75 A;  3QZS A;  5HRV A;  3RCW A;  3JVM A;  5L96 A;  2YEM A;  2DKW A;  5EA1 A;  4QSU A;  3U5N A;  5FFW A;  3Q2F A;  4GPJ A;  5EIS A;  5IGK A;  5JI8 A;  2OO1 A;  2WP1 A;  5C89 A;  2E7N A;  3O34 A;  5IG6 A;  4NR6 A;  5AD3 A;  3G0J A;  4TT4 A;  4UIU A;  3GG3 A;  5CUC A;  4NQM A;  5FG4 A;  4LZS A;  2R0S A;  4Z6H A;  5KU3 A;  5DYX A;  4N3W A;  4XY9 A;  5HQ7 A;  4BW4 A;  5BT5 A;  5EVA A;  5LVR A;  4A9K A;  3LQJ A;  4QZS A;  5IGM A;  5G4S A;  5L97 A;  5ENB A;  4QSV A;  4MEQ A;  5ETD A;  5FE4 A;  2RNW A;  4ALH A;  4LZ2 A;  4QR3 A;  5D0C A;  5LJ2 A;  2MJV B;  4LRG A;  4CLB A;  4NXJ A;  4YYG A;  4C67 A;  5I89 A;  5TCM A;  5DKC A;  5HQ6 A;  4YYJ A;  4OUF A;  4YAB A;  4HBV A;  5CGP A;  2DVQ A;  3UV4 A;  5FB1 A;  4UIZ A;  3JVK A;  4O7E A;  3S92 A;  5E3G A;  5TB6 A;  2YDW A;  4X2I A;  3UVX A;  2L5E A;  1EQF A;  5E3D A;  4YAX A;  4Z6I A;  4CL9 A;  3VKH A;  3U5M A;  5H1U A;  5L8T A;  4O74 A;  4OGI A;  4ALG A;  4N4I A;  4NR7 A;  4OGJ A;  3P1C A;  5HRX A;  5FBX A;  4BW2 A;  2WP2 A;  2RFJ A;  4HXO A;  4MR4 A;  5EM3 A;  4QSS A;  4TYL A;  5F1L A;  5F25 A;  4IOR A;  5FG5 A;  5II1 A;  5FB0 A;  3UVY A;  4YK0 A;  2F6J A;  3LJW A;  4TS8 A;  5F36 A;  4J0S A;  4TQN A;  5I1Q A;  4AKH A;  4A9I A;  3DAI A;  4QEV A;  4HXR A;  5ENG A;  5H85 A;  3UVD A;  4QEW A;  5D3P A;  2E3K A;  3AAD A;  5FH8 A;  2D82 A;  4WIV A;  5CQT A;  4QSW A;  3P1F A;  5IID A;  2R10 A;  2FSA A;  3MQM A;  3D7C A;  1E6I A;  4O71 A;  3ZYU A;  5FE7 A;  5EI4 A;  4QR5 A;  5C7N A;  5E0R A;  3SVH A;  5A83 A;  4QEU A;  4TTE A;  5EGU A;  4UIY A;  5AME A;  2R0Y A;  3UV5 A;  5EK9 A;  5F5Z A;  3G0L A;  4C66 A;  5F60 A;  4A9L A;  5HRW A;  5EWW A;  4A9F A;  5CTL A;  4NYV A;  5CQ8 A;  4O78 A;  4YYD A;  5FG6 A;  4A9E A;  5CRZ A;  5COI A;  2D9E A;  3MUK A;  5HLS A;  5HFR A;  5HQ5 A;  4YYM A;  4UYE A;  2G4A A;  4QNS A;  5C85 A;  4YBS A;  4UYH A;  2NXB A;  4J0R A;  5DYC A;  4YYH A;  5EQ1 A;  4BHW A;  2I8N A;  4A9J A;  4IOO A;  2DVS A;  4UYD A;  4NRB A;  4FLP A;  5BT3 A;  4ZC9 A;  4N4H A;  5CQ4 A;  3AQA A;  5LJ1 A;  3IU6 A;  5G4R A;  4MR6 A;  4YC9 A;  4A9O A;  5CP5 A;  5FDZ A;  5F3A A;  4QSX A;  4NUE A;  5D3T A;  4WHU A;  4HXS A;  5FH6 A;  3Q2E A;  5LKX A;  3P1D A;  5KO4 A;  4QYL A;  4QR4 A;  4TZ8 A;  4WHW A; 
#chains in the Genus database with same CATH homology
 5E9M A;  4YYK A;  5A5Q A;  5F61 A;  3U5J A;  4LR6 A;  5II2 A;  5JWM A;  4XUB A;  3TLP A;  5CS8 A;  5DKH A;  4A9N A;  5A82 A;  1JSP B;  5EWH A;  5HEN A;  4YAT A;  4YBM A;  3K2J A;  3HMF A;  5CRM A;  5HFQ A;  5KTU A;  4DON A;  5IGL A;  5CQ6 A;  4UIW A;  4YH3 A;  2RI7 A;  3JVJ A;  5L99 A;  5CUB A;  3MB3 A;  3U5P A;  4LYI A;  2DAT A;  1WUM A;  1ZS5 A;  4Q0O A;  5ENI A;  5FE2 A;  4A9H A;  3U5O A;  4XY8 A;  3QZV A;  2DVR A;  5CUD A;  4UIV A;  3NXB A;  4LZR A;  5CQ5 A;  3I3J A;  5FE0 A;  5LVQ A;  5CQ3 A;  4UIX A;  5IBN A;  5ENE A;  5HJC A;  5DX4 A;  5EPR A;  4LYS A;  4A9M A;  2N9G A;  5FFY A;  4YY6 A;  3UW9 A;  4IR5 A;  4YH4 A;  4IOQ A;  4QSP A;  4CUQ A;  3O36 A;  2OUO A;  5DFD A;  5EU1 A;  5L8U A;  5DFB A;  4IR4 A;  4MEO A;  2RNX A;  4NR9 A;  4BW3 A;  4O70 A;  5E9V A;  4YYI A;  5H1V A;  2DVV A;  5D3R A;  4CUT A;  1WUG A;  4Z1Q A;  5I29 A;  5DYU A;  5H1T A;  5F62 A;  5I80 A;  4QUU A;  3O33 A;  3O35 A;  4UYF A;  4QBM A;  4YY4 A;  4UYF B;  4PY6 A;  4TU4 A;  3LXJ A;  5I88 A;  3LQI A;  3MB4 A;  4NUD A;  3P5O A;  5HEM A;  2YQD A;  5F2P A;  4CFK A;  5FE3 A;  5I7Y A;  3HMH A;  5ENJ A;  4IR3 A;  4NQN A;  2L85 A;  4E96 A;  4O72 A;  5EIC A;  4QSR A;  2GRC A;  5HCL A;  2L84 A;  4NYX A;  5CUA A;  5A5S A;  5D3J A;  4UIT A;  4QY4 A;  5EWD A;  5CZG A;  4QC1 A;  3QZT A;  5A5O A;  4NRA A;  4PS5 A;  3JVL A;  5AMF A;  4NS5 A;  4CUU A;  4HBW A;  3IU5 A;  4CFL A;  5C4Q A;  5FE6 A;  4Z1S A;  5CU8 A;  2F6N A;  5D7X A;  3UV2 A;  4XUA A;  3U5K A;  4HXL A;  4LC2 A;  5EWC A;  3MXF A;  4NR8 A;  4AKN A;  4PTB A;  2H60 A;  4CUP A;  2I7K A;  4O7F A;  3O37 A;  5D25 A;  4O77 A;  4TU6 A;  4XYA A;  5J0D A;  2RO1 A;  4KV1 A;  4F3I A;  4J3I A;  3SVG A;  4BW1 A;  4HXK A;  5D3H A;  4J1P A;  2RS9 B;  5CQ7 A;  5I7X A;  5DFC A;  5DLZ A;  3SVF A;  5A7C A;  2RNY A;  3LQH A;  5DBM A;  5A5P A;  5EV9 A;  3S91 A;  4O7A A;  2YEK A;  5D24 A;  5EPB A;  5E9I A;  4PKL A;  5CPE A;  5D3L A;  5FE1 A;  5FE9 A;  4IR6 A;  5F1H A;  4HBY A;  4NR4 A;  5ENH A;  2KTB B;  5E7D A;  5I40 A;  4HBX A;  5DW1 A;  4O76 A;  5AD2 A;  1F68 A;  5A81 A;  5D26 A;  4QYD A;  5LKU A;  5LJ0 A;  5CY9 A;  4QST A;  3HME A;  2YEL A;  5DLX A;  5LKT A;  2E7O A;  5KHM A;  1JM4 B;  4NUC A;  5ETB A;  5A85 A;  4MEP A;  5E9L A;  4N4F A;  5FE5 A;  4TT2 A;  4KCX A;  4PCI A;  4QUT A;  4UYG A;  4Y03 A;  5EWV A;  5CUE A;  2LSP B;  4RVR A;  5DW2 A;  4TZ2 A;  5CQA A;  4BJX A;  5FH7 A;  5C87 A;  5C8G A;  5IGN A;  3FKM X;  5FE8 A;  3DWY A;  4MR3 A;  5KTW A;  4QSQ A;  3MUL A;  4Z93 A;  4NRC A;  2YW5 A;  3ONI A;  5D3S A;  5CFW A;  4CUS A;  5DYA A;  5ENF A;  5CUG A;  1X0J A;  5DY7 A;  5ACY A;  5LUU A;  5E74 A;  3U5L A;  5BT4 A;  4QB3 A;  5E9Y A;  4LYW A;  3P1E A;  4KV4 A;  5EPS A;  4ZQL A;  4MR5 A;  5HEL A;  4Q0N A;  2R0V A;  4ZW1 A;  4CUR A;  5DKD A;  4HXP A;  5A5N A;  4YAD A;  5HM0 A;  5E9K A;  4MEN A;  4LDF A;  5I83 A;  4YBT A;  4N4G A;  4TT6 A;  2YYN A;  5F63 A;  4YYN A;  5FFV A;  4QC3 A;  5KTX A;  4NR5 A;  1N72 A;  4O7C A;  2OSS A;  5EP7 A;  5D3N A;  4O7B A;  4PCE A;  4NYW A;  2DWW A;  5ENC A;  5E73 A;  5L98 A;  4HXN A;  5A5R A;  5LKZ A;  5I86 A;  4HXM A;  3UVW A;  5K29 A;  4O75 A;  3QZS A;  5HRV A;  3RCW A;  3JVM A;  5L96 A;  2YEM A;  2DKW A;  5EA1 A;  4QSU A;  3U5N A;  5FFW A;  3Q2F A;  4GPJ A;  5EIS A;  5IGK A;  5JI8 A;  2OO1 A;  2WP1 A;  5C89 A;  2E7N A;  3O34 A;  5IG6 A;  4NR6 A;  5AD3 A;  3G0J A;  4TT4 A;  4UIU A;  3GG3 A;  5CUC A;  4NQM A;  5FG4 A;  4LZS A;  2R0S A;  4Z6H A;  5KU3 A;  5DYX A;  4N3W A;  4XY9 A;  5HQ7 A;  4BW4 A;  5BT5 A;  5EVA A;  5LVR A;  4A9K A;  3LQJ A;  4QZS A;  5IGM A;  5G4S A;  5L97 A;  5ENB A;  4QSV A;  4MEQ A;  5ETD A;  5FE4 A;  2RNW A;  4ALH A;  4LZ2 A;  4QR3 A;  5D0C A;  5LJ2 A;  2MJV B;  4LRG A;  4CLB A;  4NXJ A;  4YYG A;  4C67 A;  5I89 A;  5TCM A;  5DKC A;  5HQ6 A;  4YYJ A;  4OUF A;  4YAB A;  4HBV A;  5CGP A;  2DVQ A;  3UV4 A;  5FB1 A;  4UIZ A;  3JVK A;  4O7E A;  3S92 A;  5E3G A;  5TB6 A;  2YDW A;  4X2I A;  3UVX A;  2L5E A;  1EQF A;  5E3D A;  4YAX A;  4Z6I A;  4CL9 A;  3U5M A;  5H1U A;  5L8T A;  4O74 A;  4OGI A;  4ALG A;  4N4I A;  4NR7 A;  4OGJ A;  3P1C A;  5HRX A;  5FBX A;  4BW2 A;  2WP2 A;  2RFJ A;  4HXO A;  4MR4 A;  5EM3 A;  4QSS A;  4TYL A;  5F1L A;  5F25 A;  4IOR A;  5FG5 A;  5II1 A;  5FB0 A;  3UVY A;  4YK0 A;  2F6J A;  3LJW A;  4TS8 A;  5F36 A;  4J0S A;  4TQN A;  5I1Q A;  4A9I A;  3DAI A;  4QEV A;  4HXR A;  5ENG A;  5H85 A;  3UVD A;  4QEW A;  5D3P A;  2E3K A;  3AAD A;  5FH8 A;  2D82 A;  4WIV A;  5CQT A;  4QSW A;  3P1F A;  5IID A;  2R10 A;  2FSA A;  3MQM A;  3D7C A;  1E6I A;  4O71 A;  3ZYU A;  5FE7 A;  5EI4 A;  4QR5 A;  5C7N A;  5E0R A;  3SVH A;  5A83 A;  4QEU A;  4TTE A;  5EGU A;  4UIY A;  5AME A;  2R0Y A;  3UV5 A;  5EK9 A;  5F5Z A;  3G0L A;  4C66 A;  5F60 A;  4A9L A;  5HRW A;  5EWW A;  4A9F A;  5CTL A;  4NYV A;  5CQ8 A;  4O78 A;  4YYD A;  5FG6 A;  4A9E A;  5CRZ A;  5COI A;  2D9E A;  3MUK A;  5HLS A;  5HFR A;  5HQ5 A;  4YYM A;  4UYE A;  2G4A A;  4QNS A;  5C85 A;  4YBS A;  4UYH A;  2NXB A;  4J0R A;  5DYC A;  4YYH A;  5EQ1 A;  4BHW A;  2I8N A;  4A9J A;  4IOO A;  2DVS A;  4UYD A;  4NRB A;  4FLP A;  5BT3 A;  4ZC9 A;  4N4H A;  5CQ4 A;  3AQA A;  5LJ1 A;  3IU6 A;  5G4R A;  4MR6 A;  4YC9 A;  4A9O A;  5CP5 A;  5FDZ A;  5F3A A;  4QSX A;  4NUE A;  5D3T A;  4WHU A;  4HXS A;  5FH6 A;  3Q2E A;  5LKX A;  3P1D A;  5KO4 A;  4QYL A;  4QR4 A;  4TZ8 A;  4WHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...