5I29A

Taf1(2) bound to a pyrrolopyridone compound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
139
structure length
139
Chain Sequence
DDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/inhibitor
molecule keywords Transcription initiation factor TFIID subunit 1
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 139
sequence length 139
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i29A00
5D24A 5F60A 4QC3A 3O34A 5A83A 4NUEA 3ONIA 4LYWA 2N9GA 5G4RA 5JI8A 5CUEA 5FE3A 4NQNA 5D3NA 5EQ1A 5F36A 5I40A 5LVRA 4IR4A 5HFQA 5E73A 4QB3A 5FE9A 4ALGA 3IU6A 3I3JA 2KTBB 4N4GA 5IGMA 3P1FA 5BT3A 5IGNA 5HQ7A 5E0RA 5JWMA 4UITA 2YW5A 4TT6A 4A9LA 3K2JA 2E3KA 2H60A 4NXJA 4BJXA 4KV1A 5ENBA 3SVFA 4HBYA 5BT5A 4MR6A 5CGPA 5DYCA 5C4QA 3ZYUA 5KTWA 2R10A 4HXMA 4O7BA 5A5QA 5I83A 2YEKA 3UVYA 5HQ5A 5CU8A 5F5ZA 3LJWA 4TT4A 4YYHA 4N4FA 4BHWA 4AKNA 4YATA 4LYSA 4LYIA 4QSUA 4A9FA 5LJ0A 3GG3A 2LSPB 1JM4B 4BW4A 4X2IA 2RFJA 5HELA 4MENA 5EK9A 4TZ2A 5LJ1A 2RNYA 5FE2A 2R0SA 5FE7A 2WP2A 4ALHA 2R0VA 4NYVA 4MEQA 5EICA 5EU1A 4UYGA 4NR4A 5FE6A 5KO4A 5D3SA 4QEVA 4XUBA 5DKDA 4GPJA 5DKCA 4A9NA 5D3PA 5D26A 4RVRA 5E9KA 2DVRA 4PTBA 1ZS5A 5FBXA 3U5JA 5CQTA 5FDZA 2F6NA 5FE1A 1N72A 3AQAA 5CTLA 5CQAA 4QZSA 5L8UA 4O7AA 5AMFA 4YBTA 4CURA 4PS5A 4NS5A 1E6IA 4UIXA 4LZRA 4TQNA 2YDWA 4QSXA 5CUCA 5CRZA 4YK0A 4CL9A 5C7NA 3LQJA 4UIWA 1X0JA 5E3DA 4O75A 4QSWA 5HQ6A 5HRWA 5L8TA 5D7XA 3UV2A 2YYNA 5CZGA 2GRCA 4NR8A 4YYNA 3U5LA 4LRGA 5HJCA 4CLBA 5CQ7A 1JSPB 4IR6A 5DW2A 5II2A 1WUMA 4N4HA 5L96A 5E3GA 2I7KA 4HXNA 5FH7A 5LKXA 3MULA 5I1QA 4PY6A 5C89A 5H1UA 3Q2FA 4YYDA 5FG5A 4LZSA 4A9OA 5A5PA 5D25A 5FE8A 5I7XA 5I7YA 4OGIA 5H85A 5K29A 3O36A 4IOQA 4UYFB 3QZSA 5HM0A 5CRMA 5ENGA 3S92A 3P1CA 4ZQLA 5ENFA 2FSAA 5EPRA 4N3WA 5EWCA 2D82A 5EPSA 3UV4A 4BW2A 4Y03A 4YYMA 4OGJA 5CUBA 3G0JA 5FE4A 2DVSA 5FFWA 4YABA 4HBVA 4O70A 3MUKA 3QZVA 2DWWA 4MR5A 4YADA 5LUUA 4BW1A 3UVDA 4QBMA 4XUAA 1EQFA 4NR6A 3O35A 5KTUA 5A7CA 3P5OA 4NRAA 4YYGA 5FE0A 5DYUA 4A9MA 2YELA 4O7EA 2E7OA 5IIDA 5CPEA 3Q2EA 3MQMA 3SVGA 2RI7A 5IG6A 4ZC9A 3U5MA 5F25A 5KHMA 3UVXA 4IORA 4YY6A 5ETDA 5F2PA 2RS9B 3QZTA 4NUCA 4QSSA 4PCEA 5EWDA 4IR5A 4UIYA 5I88A 4TU4A 5II1A 3JVKA 5FFYA 5FG4A 3UV5A 3DWYA 4IOOA 4OUFA 5E9YA 3MB4A 2DVVA 4QUTA 4CUTA 1WUGA 5CUDA 5A82A 4ZW1A 4QEUA 4XYAA 2DKWA 5HENA 4QYLA 4MR3A 4UIVA 4J3IA 4QSVA 4NRBA 5C85A 4N4IA 5CQ8A 5IGLA 5A5SA 4QSTA 5H1VA 4HXOA 4J0RA 4QYDA 5CQ4A 4Z1QA 4MEOA 5TCMA 5FG6A 5F3AA 2RO1A 4QSPA 5DFBA 4UIUA 2D9EA 5F1HA 4O7CA 5D3JA 5F1LA 4QSRA 5ENEA 5C87A 3U5NA 4O71A 5EA1A 5E9LA 5HCLA 5HFRA 3NXBA 5ENCA 5A5NA 3LQHA 5L97A 5EWHA 5ENHA 5E9MA 5D3HA 2NXBA 4TS8A 4PKLA 2WP1A 4LC2A 5CQ3A 4J0SA 5LKZA 5BT4A 5C8GA 2L5EA 5D3RA 4LDFA 5AMEA 5KU3A 5E9VA 5HRXA 5H1TA 5G4SA 4YYKA 4WHUA 4CUPA 5I80A 4UYFA 4IR3A 4KCXA 4MR4A 4O77A 5FB0A 3JVMA 4YC9A 2E7NA 3DAIA 5IBNA 5LJ2A 5CUAA 5I89A 2G4AA 4NRCA 5EVAA 4UYEA 5DY7A 5CQ5A 4CUQA 3SVHA 5LKUA 5FH8A 4YBMA 5DBMA 3O33A 4PCIA 4UYDA 4YYIA 4Z93A 4TZ8A 4YH3A 5F61A 3JVLA 4YYJA 5EPBA 5EWWA 4Z6IA 2YQDA 4J1PA 4YY4A 4XY8A 4CUUA 4HXPA 4O78A 4BW3A 2L85A 4MEPA 4TU6A 3HMFA 3D7CA 5ACYA 3IU5A 4DONA 3MB3A 5FE5A 5DW1A 5A81A 5HRVA 2OO1A 4A9KA 5D3TA 5DLXA 5COIA 2MJVB 5EI4A 5L98A 5CP5A 4KV4A 4UIZA 5CQ6A 4HXSA 2RNXA 4HXLA 4QUUA 5AD3A 5ENJA 3RCWA 3P1DA 3U5OA 4C67A 4YH4A 5DFDA 4QC1A 5F63A 5DYAA 4NYWA 4A9HA 5CUGA 1F68A 5CS8A 5CY9A 4HBWA 4HXRA 4NUDA 4O72A 5IGKA 4Q0OA 4XY9A 3MXFA 5KTXA 4TYLA 5J0DA 5DFCA 4YBSA 3LXJA 4O7FA 5E9IA 5FH6A 4Z6HA 3S91A 2OSSA 4UYHA 4QR4A 4QR3A 5CFWA 5EISA 5DYXA 4E96A 5A5OA 3HMEA 5DLZA 4A9EA 4O76A 2OUOA 5EWVA 5AD2A 3U5KA 5E74A 5HEMA 4A9IA 5ETBA 4QY4A 4WHWA 5F62A 4HBXA 3G0LA 5L99A 5HLSA 4LR6A 2R0YA 5ENIA 5EV9A 4F3IA 3AADA 5I29A 5D0CA 3UW9A 4QNSA 3FKMX 4TTEA 3LQIA 4QSQA 5EP7A 5FB1A 2RNWA 4LZ2A 4CFLA 4NYXA 5EM3A 4WIVA 5LKTA 5A5RA 2I8NA 3TLPA 2YEMA 4NR5A 3O37A 4NR9A 5DKHA 5A85A 2F6JA 3UVWA 4CUSA 4C66A 2L84A 3P1EA 4FLPA 4TT2A 5TB6A 5E7DA 5D3LA 3HMHA 4YAXA 4O74A 2DATA 4QEWA 4A9JA 4Q0NA 4HXKA 5LVQA 3JVJA 5EGUA 4NR7A 3U5PA 5DX4A 5FFVA 5I86A 4Z1SA 4NQMA 2DVQA 4CFKA 4QR5A
chains in the Genus database with same CATH superfamily
5D24A 5F60A 4QC3A 3O34A 5A83A 4NUEA 3ONIA 4LYWA 2N9GA 5G4RA 5JI8A 5CUEA 5FE3A 4NQNA 5D3NA 5EQ1A 5F36A 5I40A 5LVRA 4IR4A 5HFQA 5E73A 4QB3A 5FE9A 4ALGA 3IU6A 3I3JA 2KTBB 4N4GA 5IGMA 3P1FA 3ERRA 5BT3A 5IGNA 5HQ7A 5E0RA 5JWMA 4UITA 2YW5A 4TT6A 4A9LA 3K2JA 2E3KA 2H60A 4NXJA 4BJXA 4KV1A 5ENBA 3SVFA 4HBYA 5BT5A 4MR6A 5CGPA 5DYCA 5C4QA 3ZYUA 5KTWA 2R10A 4HXMA 4O7BA 5A5QA 5I83A 2YEKA 3UVYA 5HQ5A 5CU8A 5F5ZA 3LJWA 4TT4A 4YYHA 4N4FA 4BHWA 4AKNA 4YATA 4LYSA 4LYIA 4QSUA 4A9FA 5LJ0A 3GG3A 2LSPB 1JM4B 4BW4A 4X2IA 2RFJA 5HELA 4MENA 5EK9A 4TZ2A 5LJ1A 2RNYA 5FE2A 2R0SA 5FE7A 2WP2A 4ALHA 2R0VA 4NYVA 4MEQA 5EICA 5EU1A 4UYGA 4NR4A 5FE6A 5KO4A 5D3SA 4QEVA 4XUBA 5DKDA 4GPJA 5DKCA 4A9NA 5D3PA 5D26A 4RVRA 5E9KA 2DVRA 4PTBA 1ZS5A 5FBXA 3U5JA 5CQTA 5FDZA 2F6NA 5FE1A 1N72A 3AQAA 5CTLA 5CQAA 4QZSA 5L8UA 4O7AA 5AMFA 4YBTA 4CURA 4PS5A 4NS5A 1E6IA 4UIXA 4LZRA 4TQNA 2YDWA 4QSXA 5CUCA 3VKGA 5CRZA 4YK0A 4CL9A 5C7NA 3VKHA 3LQJA 4UIWA 1X0JA 5E3DA 4O75A 4QSWA 5HQ6A 5HRWA 5L8TA 5D7XA 3UV2A 2YYNA 5CZGA 2GRCA 4NR8A 4YYNA 1ZKRA 3U5LA 4LRGA 5HJCA 4CLBA 5CQ7A 1JSPB 4IR6A 5DW2A 5II2A 4AKIA 1WUMA 4N4HA 5L96A 5E3GA 2I7KA 4HXNA 5FH7A 5LKXA 3MULA 5I1QA 4PY6A 5C89A 5H1UA 3Q2FA 4YYDA 5FG5A 4LZSA 4A9OA 5A5PA 5D25A 5FE8A 5I7XA 5I7YA 4OGIA 5H85A 5K29A 3O36A 4IOQA 4UYFB 3QZSA 5HM0A 5CRMA 5ENGA 3S92A 3P1CA 4ZQLA 5ENFA 2FSAA 5EPRA 4N3WA 5EWCA 2D82A 5EPSA 3UV4A 4BW2A 4Y03A 4YYMA 4OGJA 5CUBA 3G0JA 5FE4A 2DVSA 5FFWA 4YABA 4HBVA 4O70A 3MUKA 3QZVA 2DWWA 4MR5A 4YADA 5LUUA 4BW1A 3UVDA 4QBMA 4XUAA 1EQFA 4NR6A 3O35A 5KTUA 5A7CA 3P5OA 4NRAA 3D1DA 4AKGA 4YYGA 5FE0A 5DYUA 4A9MA 2YELA 4O7EA 2E7OA 5IIDA 5CPEA 3Q2EA 3MQMA 3SVGA 2RI7A 5IG6A 4ZC9A 3U5MA 5F25A 5KHMA 3UVXA 4IORA 4YY6A 5ETDA 5F2PA 2RS9B 3QZTA 4NUCA 4QSSA 4PCEA 5EWDA 4IR5A 4UIYA 5I88A 4TU4A 5II1A 3JVKA 5FFYA 5FG4A 3UV5A 3DWYA 4IOOA 4OUFA 5E9YA 3MB4A 2DVVA 4QUTA 4CUTA 1WUGA 5CUDA 5A82A 4ZW1A 4QEUA 4XYAA 2DKWA 5HENA 4QYLA 4MR3A 4UIVA 4J3IA 4QSVA 4NRBA 5C85A 4N4IA 5CQ8A 5IGLA 5A5SA 4QSTA 5H1VA 4HXOA 4J0RA 4QYDA 5CQ4A 4Z1QA 4MEOA 5TCMA 5FG6A 5F3AA 2RO1A 4QSPA 5DFBA 4UIUA 2D9EA 5F1HA 4O7CA 5D3JA 5F1LA 4QSRA 5ENEA 5C87A 3U5NA 4O71A 5EA1A 5E9LA 5HCLA 5HFRA 3NXBA 5ENCA 5A5NA 3LQHA 5L97A 5EWHA 5ENHA 5E9MA 5D3HA 2NXBA 2EJNA 4TS8A 4PKLA 2WP1A 4LC2A 5CQ3A 4J0SA 5LKZA 5BT4A 5C8GA 2L5EA 5D3RA 4LDFA 5AMEA 5KU3A 5E9VA 5HRXA 5H1TA 5G4SA 4YYKA 4WHUA 4CUPA 5I80A 4UYFA 4IR3A 4KCXA 4MR4A 4O77A 5FB0A 3JVMA 4YC9A 2E7NA 3DAIA 5IBNA 5LJ2A 5CUAA 5I89A 2G4AA 4NRCA 5EVAA 4UYEA 5DY7A 5CQ5A 4CUQA 3SVHA 5LKUA 5FH8A 4YBMA 5DBMA 3O33A 4PCIA 4UYDA 4YYIA 4Z93A 4TZ8A 4YH3A 5F61A 3JVLA 4YYJA 5EPBA 5EWWA 4Z6IA 2YQDA 4J1PA 4YY4A 4XY8A 4CUUA 4HXPA 4O78A 4BW3A 3D1BA 2L85A 4MEPA 4TU6A 3HMFA 3D7CA 5ACYA 3IU5A 4DONA 3MB3A 5FE5A 5DW1A 5A81A 5HRVA 2OO1A 4A9KA 5D3TA 5DLXA 5COIA 2MJVB 5EI4A 5L98A 5CP5A 4KV4A 4UIZA 5CQ6A 4HXSA 2RNXA 4HXLA 4QUUA 5AD3A 5ENJA 3RCWA 3P1DA 3U5OA 4C67A 4YH4A 5DFDA 4QC1A 5F63A 4AI6A 5DYAA 4NYWA 4A9HA 5CUGA 1F68A 5CS8A 5CY9A 4HBWA 4HXRA 4NUDA 4O72A 5IGKA 4Q0OA 4XY9A 3MXFA 5KTXA 4TYLA 5J0DA 5DFCA 4YBSA 3LXJA 4O7FA 5E9IA 5FH6A 4Z6HA 3S91A 2OSSA 4UYHA 4QR4A 4QR3A 5CFWA 5EISA 5DYXA 4E96A 5A5OA 3HMEA 5DLZA 4A9EA 4O76A 2OUOA 5EWVA 5AD2A 3U5KA 5E74A 5HEMA 4A9IA 5ETBA 4QY4A 4WHWA 5F62A 4HBXA 3G0LA 5L99A 5HLSA 4LR6A 2R0YA 5ENIA 5EV9A 4F3IA 3AADA 5I29A 5D0CA 3UW9A 4QNSA 3FKMX 4TTEA 3LQIA 4QSQA 5EP7A 5FB1A 2RNWA 4LZ2A 4CFLA 4NYXA 5EM3A 4WIVA 5LKTA 5A5RA 2I8NA 3TLPA 2YEMA 4NR5A 3O37A 4NR9A 5DKHA 5A85A 2F6JA 3UVWA 4CUSA 4AKHA 4C66A 2L84A 3P1EA 4FLPA 4TT2A 5TB6A 5E7DA 5D3LA 3HMHA 4YAXA 4O74A 2DATA 4QEWA 4A9JA 4Q0NA 4HXKA 5LVQA 3JVJA 5EGUA 4NR7A 3U5PA 5DX4A 5FFVA 5I86A 4Z1SA 1PUOA 4NQMA 2DVQA 4CFKA 4QR5A
chains in the Genus database with same CATH topology
5D24A 5F60A 4QC3A 3O34A 5A83A 4NUEA 3ONIA 4LYWA 2N9GA 5G4RA 5JI8A 5CUEA 5FE3A 4NQNA 5D3NA 5EQ1A 5F36A 5I40A 5LVRA 4IR4A 5HFQA 5E73A 4QB3A 5FE9A 4ALGA 3IU6A 3I3JA 2KTBB 4N4GA 5IGMA 3P1FA 5BT3A 5IGNA 5HQ7A 5E0RA 5JWMA 4UITA 2YW5A 4TT6A 4A9LA 3K2JA 2E3KA 2H60A 4NXJA 4BJXA 4KV1A 5ENBA 3SVFA 4HBYA 5BT5A 4MR6A 5CGPA 5DYCA 5C4QA 3ZYUA 5KTWA 2R10A 4HXMA 4O7BA 5A5QA 5I83A 2YEKA 3UVYA 5HQ5A 5CU8A 5F5ZA 3LJWA 4TT4A 4YYHA 4N4FA 4BHWA 4AKNA 4YATA 4LYSA 4LYIA 4QSUA 4A9FA 5LJ0A 3GG3A 2LSPB 1JM4B 4BW4A 4X2IA 2RFJA 5HELA 4MENA 5EK9A 4TZ2A 5LJ1A 2RNYA 5FE2A 2R0SA 5FE7A 2WP2A 4ALHA 2R0VA 4NYVA 4MEQA 5EICA 5EU1A 4UYGA 4NR4A 5FE6A 5KO4A 5D3SA 4QEVA 4XUBA 5DKDA 4GPJA 5DKCA 4A9NA 5D3PA 5D26A 4RVRA 5E9KA 2DVRA 4PTBA 1ZS5A 5FBXA 3U5JA 5CQTA 5FDZA 2F6NA 5FE1A 1N72A 3AQAA 5CTLA 5CQAA 4QZSA 5L8UA 4O7AA 5AMFA 4YBTA 4CURA 4PS5A 4NS5A 1E6IA 4UIXA 4LZRA 4TQNA 2YDWA 4QSXA 5CUCA 5CRZA 4YK0A 4CL9A 5C7NA 3LQJA 4UIWA 1X0JA 5E3DA 4O75A 4QSWA 5HQ6A 5HRWA 5L8TA 5D7XA 3UV2A 2YYNA 5CZGA 2GRCA 4NR8A 4YYNA 3U5LA 4LRGA 5HJCA 4CLBA 5CQ7A 1JSPB 4IR6A 5DW2A 5II2A 1WUMA 4N4HA 5L96A 5E3GA 2I7KA 4HXNA 5FH7A 5LKXA 3MULA 5I1QA 4PY6A 5C89A 5H1UA 3Q2FA 4YYDA 5FG5A 4LZSA 4A9OA 5A5PA 5D25A 5FE8A 5I7XA 5I7YA 4OGIA 5H85A 5K29A 3O36A 4IOQA 4UYFB 3QZSA 5HM0A 5CRMA 5ENGA 3S92A 3P1CA 4ZQLA 5ENFA 2FSAA 5EPRA 4N3WA 5EWCA 2D82A 5EPSA 3UV4A 4BW2A 4Y03A 4YYMA 4OGJA 5CUBA 3G0JA 5FE4A 2DVSA 5FFWA 4YABA 4HBVA 4O70A 3MUKA 3QZVA 2DWWA 4MR5A 4YADA 5LUUA 4BW1A 3UVDA 4QBMA 4XUAA 1EQFA 4NR6A 3O35A 5KTUA 5A7CA 3P5OA 4NRAA 4YYGA 5FE0A 5DYUA 4A9MA 2YELA 4O7EA 2E7OA 5IIDA 5CPEA 3Q2EA 3MQMA 3SVGA 2RI7A 5IG6A 4ZC9A 3U5MA 5F25A 5KHMA 3UVXA 4IORA 4YY6A 5ETDA 5F2PA 2RS9B 3QZTA 4NUCA 4QSSA 4PCEA 5EWDA 4IR5A 4UIYA 5I88A 4TU4A 5II1A 3JVKA 5FFYA 5FG4A 3UV5A 3DWYA 4IOOA 4OUFA 5E9YA 3MB4A 2DVVA 4QUTA 4CUTA 1WUGA 5CUDA 5A82A 4ZW1A 4QEUA 4XYAA 2DKWA 5HENA 4QYLA 4MR3A 4UIVA 4J3IA 4QSVA 4NRBA 5C85A 4N4IA 5CQ8A 5IGLA 5A5SA 4QSTA 5H1VA 4HXOA 4J0RA 4QYDA 5CQ4A 4Z1QA 4MEOA 5TCMA 5FG6A 5F3AA 2RO1A 4QSPA 5DFBA 4UIUA 2D9EA 5F1HA 4O7CA 5D3JA 5F1LA 4QSRA 5ENEA 5C87A 3U5NA 4O71A 5EA1A 5E9LA 5HCLA 5HFRA 3NXBA 5ENCA 5A5NA 3LQHA 5L97A 5EWHA 5ENHA 5E9MA 5D3HA 2NXBA 4TS8A 4PKLA 2WP1A 4LC2A 5CQ3A 4J0SA 5LKZA 5BT4A 5C8GA 2L5EA 5D3RA 4LDFA 5AMEA 5KU3A 5E9VA 5HRXA 5H1TA 5G4SA 4YYKA 4WHUA 4CUPA 5I80A 4UYFA 4IR3A 4KCXA 4MR4A 4O77A 5FB0A 3JVMA 4YC9A 2E7NA 3DAIA 5IBNA 5LJ2A 5CUAA 5I89A 2G4AA 4NRCA 5EVAA 4UYEA 5DY7A 5CQ5A 4CUQA 3SVHA 5LKUA 5FH8A 4YBMA 5DBMA 3O33A 4PCIA 4UYDA 4YYIA 4Z93A 4TZ8A 4YH3A 5F61A 3JVLA 4YYJA 5EPBA 5EWWA 4Z6IA 2YQDA 4J1PA 4YY4A 4XY8A 4CUUA 4HXPA 4O78A 4BW3A 2L85A 4MEPA 4TU6A 3HMFA 3D7CA 5ACYA 3IU5A 4DONA 3MB3A 5FE5A 5DW1A 5A81A 5HRVA 2OO1A 4A9KA 5D3TA 5DLXA 5COIA 2MJVB 5EI4A 5L98A 5CP5A 4KV4A 4UIZA 5CQ6A 4HXSA 2RNXA 4HXLA 4QUUA 5AD3A 5ENJA 3RCWA 3P1DA 3U5OA 4C67A 4YH4A 5DFDA 4QC1A 5F63A 5DYAA 4NYWA 4A9HA 5CUGA 1F68A 5CS8A 5CY9A 4HBWA 4HXRA 4NUDA 4O72A 5IGKA 4Q0OA 4XY9A 3MXFA 5KTXA 4TYLA 5J0DA 5DFCA 4YBSA 3LXJA 4O7FA 5E9IA 5FH6A 4Z6HA 3S91A 2OSSA 4UYHA 4QR4A 4QR3A 5CFWA 5EISA 5DYXA 4E96A 5A5OA 3HMEA 5DLZA 4A9EA 4O76A 2OUOA 5EWVA 5AD2A 3U5KA 5E74A 5HEMA 4A9IA 5ETBA 4QY4A 4WHWA 5F62A 4HBXA 3G0LA 5L99A 5HLSA 4LR6A 2R0YA 5ENIA 5EV9A 4F3IA 3AADA 5I29A 5D0CA 3UW9A 4QNSA 3FKMX 4TTEA 3LQIA 4QSQA 5EP7A 5FB1A 2RNWA 4LZ2A 4CFLA 4NYXA 5EM3A 4WIVA 5LKTA 5A5RA 2I8NA 3TLPA 2YEMA 4NR5A 3O37A 4NR9A 5DKHA 5A85A 2F6JA 3UVWA 4CUSA 4C66A 2L84A 3P1EA 4FLPA 4TT2A 5TB6A 5E7DA 5D3LA 3HMHA 4YAXA 4O74A 2DATA 4QEWA 4A9JA 4Q0NA 4HXKA 5LVQA 3JVJA 5EGUA 4NR7A 3U5PA 5DX4A 5FFVA 5I86A 4Z1SA 4NQMA 2DVQA 4CFKA 4QR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D24 A;  5F60 A;  4QC3 A;  3O34 A;  5A83 A;  4NUE A;  3ONI A;  4LYW A;  2N9G A;  5G4R A;  5JI8 A;  5CUE A;  5FE3 A;  4NQN A;  5D3N A;  5EQ1 A;  5F36 A;  5I40 A;  5LVR A;  4IR4 A;  5HFQ A;  5E73 A;  4QB3 A;  5FE9 A;  4ALG A;  3IU6 A;  3I3J A;  2KTB B;  4N4G A;  5IGM A;  3P1F A;  5BT3 A;  5IGN A;  5HQ7 A;  5E0R A;  5JWM A;  4UIT A;  2YW5 A;  4TT6 A;  4A9L A;  3K2J A;  2E3K A;  2H60 A;  4NXJ A;  4BJX A;  4KV1 A;  5ENB A;  3SVF A;  4HBY A;  5BT5 A;  4MR6 A;  5CGP A;  5DYC A;  5C4Q A;  3ZYU A;  5KTW A;  2R10 A;  4HXM A;  4O7B A;  5A5Q A;  5I83 A;  2YEK A;  3UVY A;  5HQ5 A;  5CU8 A;  5F5Z A;  3LJW A;  4TT4 A;  4YYH A;  4N4F A;  4BHW A;  4AKN A;  4YAT A;  4LYS A;  4LYI A;  4QSU A;  4A9F A;  5LJ0 A;  3GG3 A;  2LSP B;  1JM4 B;  4BW4 A;  4X2I A;  2RFJ A;  5HEL A;  4MEN A;  5EK9 A;  4TZ2 A;  5LJ1 A;  2RNY A;  5FE2 A;  2R0S A;  5FE7 A;  2WP2 A;  4ALH A;  2R0V A;  4NYV A;  4MEQ A;  5EIC A;  5EU1 A;  4UYG A;  4NR4 A;  5FE6 A;  5KO4 A;  5D3S A;  4QEV A;  4XUB A;  5DKD A;  4GPJ A;  5DKC A;  4A9N A;  5D3P A;  5D26 A;  4RVR A;  5E9K A;  2DVR A;  4PTB A;  1ZS5 A;  5FBX A;  3U5J A;  5CQT A;  5FDZ A;  2F6N A;  5FE1 A;  1N72 A;  3AQA A;  5CTL A;  5CQA A;  4QZS A;  5L8U A;  4O7A A;  5AMF A;  4YBT A;  4CUR A;  4PS5 A;  4NS5 A;  1E6I A;  4UIX A;  4LZR A;  4TQN A;  2YDW A;  4QSX A;  5CUC A;  5CRZ A;  4YK0 A;  4CL9 A;  5C7N A;  3LQJ A;  4UIW A;  1X0J A;  5E3D A;  4O75 A;  4QSW A;  5HQ6 A;  5HRW A;  5L8T A;  5D7X A;  3UV2 A;  2YYN A;  5CZG A;  2GRC A;  4NR8 A;  4YYN A;  3U5L A;  4LRG A;  5HJC A;  4CLB A;  5CQ7 A;  1JSP B;  4IR6 A;  5DW2 A;  5II2 A;  1WUM A;  4N4H A;  5L96 A;  5E3G A;  2I7K A;  4HXN A;  5FH7 A;  5LKX A;  3MUL A;  5I1Q A;  4PY6 A;  5C89 A;  5H1U A;  3Q2F A;  4YYD A;  5FG5 A;  4LZS A;  4A9O A;  5A5P A;  5D25 A;  5FE8 A;  5I7X A;  5I7Y A;  4OGI A;  5H85 A;  5K29 A;  3O36 A;  4IOQ A;  4UYF B;  3QZS A;  5HM0 A;  5CRM A;  5ENG A;  3S92 A;  3P1C A;  4ZQL A;  5ENF A;  2FSA A;  5EPR A;  4N3W A;  5EWC A;  2D82 A;  5EPS A;  3UV4 A;  4BW2 A;  4Y03 A;  4YYM A;  4OGJ A;  5CUB A;  3G0J A;  5FE4 A;  2DVS A;  5FFW A;  4YAB A;  4HBV A;  4O70 A;  3MUK A;  3QZV A;  2DWW A;  4MR5 A;  4YAD A;  5LUU A;  4BW1 A;  3UVD A;  4QBM A;  4XUA A;  1EQF A;  4NR6 A;  3O35 A;  5KTU A;  5A7C A;  3P5O A;  4NRA A;  4YYG A;  5FE0 A;  5DYU A;  4A9M A;  2YEL A;  4O7E A;  2E7O A;  5IID A;  5CPE A;  3Q2E A;  3MQM A;  3SVG A;  2RI7 A;  5IG6 A;  4ZC9 A;  3U5M A;  5F25 A;  5KHM A;  3UVX A;  4IOR A;  4YY6 A;  5ETD A;  5F2P A;  2RS9 B;  3QZT A;  4NUC A;  4QSS A;  4PCE A;  5EWD A;  4IR5 A;  4UIY A;  5I88 A;  4TU4 A;  5II1 A;  3JVK A;  5FFY A;  5FG4 A;  3UV5 A;  3DWY A;  4IOO A;  4OUF A;  5E9Y A;  3MB4 A;  2DVV A;  4QUT A;  4CUT A;  1WUG A;  5CUD A;  5A82 A;  4ZW1 A;  4QEU A;  4XYA A;  2DKW A;  5HEN A;  4QYL A;  4MR3 A;  4UIV A;  4J3I A;  4QSV A;  4NRB A;  5C85 A;  4N4I A;  5CQ8 A;  5IGL A;  5A5S A;  4QST A;  5H1V A;  4HXO A;  4J0R A;  4QYD A;  5CQ4 A;  4Z1Q A;  4MEO A;  5TCM A;  5FG6 A;  5F3A A;  2RO1 A;  4QSP A;  5DFB A;  4UIU A;  2D9E A;  5F1H A;  4O7C A;  5D3J A;  5F1L A;  4QSR A;  5ENE A;  5C87 A;  3U5N A;  4O71 A;  5EA1 A;  5E9L A;  5HCL A;  5HFR A;  3NXB A;  5ENC A;  5A5N A;  3LQH A;  5L97 A;  5EWH A;  5ENH A;  5E9M A;  5D3H A;  2NXB A;  4TS8 A;  4PKL A;  2WP1 A;  4LC2 A;  5CQ3 A;  4J0S A;  5LKZ A;  5BT4 A;  5C8G A;  2L5E A;  5D3R A;  4LDF A;  5AME A;  5KU3 A;  5E9V A;  5HRX A;  5H1T A;  5G4S A;  4YYK A;  4WHU A;  4CUP A;  5I80 A;  4UYF A;  4IR3 A;  4KCX A;  4MR4 A;  4O77 A;  5FB0 A;  3JVM A;  4YC9 A;  2E7N A;  3DAI A;  5IBN A;  5LJ2 A;  5CUA A;  5I89 A;  2G4A A;  4NRC A;  5EVA A;  4UYE A;  5DY7 A;  5CQ5 A;  4CUQ A;  3SVH A;  5LKU A;  5FH8 A;  4YBM A;  5DBM A;  3O33 A;  4PCI A;  4UYD A;  4YYI A;  4Z93 A;  4TZ8 A;  4YH3 A;  5F61 A;  3JVL A;  4YYJ A;  5EPB A;  5EWW A;  4Z6I A;  2YQD A;  4J1P A;  4YY4 A;  4XY8 A;  4CUU A;  4HXP A;  4O78 A;  4BW3 A;  2L85 A;  4MEP A;  4TU6 A;  3HMF A;  3D7C A;  5ACY A;  3IU5 A;  4DON A;  3MB3 A;  5FE5 A;  5DW1 A;  5A81 A;  5HRV A;  2OO1 A;  4A9K A;  5D3T A;  5DLX A;  5COI A;  2MJV B;  5EI4 A;  5L98 A;  5CP5 A;  4KV4 A;  4UIZ A;  5CQ6 A;  4HXS A;  2RNX A;  4HXL A;  4QUU A;  5AD3 A;  5ENJ A;  3RCW A;  3P1D A;  3U5O A;  4C67 A;  4YH4 A;  5DFD A;  4QC1 A;  5F63 A;  5DYA A;  4NYW A;  4A9H A;  5CUG A;  1F68 A;  5CS8 A;  5CY9 A;  4HBW A;  4HXR A;  4NUD A;  4O72 A;  5IGK A;  4Q0O A;  4XY9 A;  3MXF A;  5KTX A;  4TYL A;  5J0D A;  5DFC A;  4YBS A;  3LXJ A;  4O7F A;  5E9I A;  5FH6 A;  4Z6H A;  3S91 A;  2OSS A;  4UYH A;  4QR4 A;  4QR3 A;  5CFW A;  5EIS A;  5DYX A;  4E96 A;  5A5O A;  3HME A;  5DLZ A;  4A9E A;  4O76 A;  2OUO A;  5EWV A;  5AD2 A;  3U5K A;  5E74 A;  5HEM A;  4A9I A;  5ETB A;  4QY4 A;  4WHW A;  5F62 A;  4HBX A;  3G0L A;  5L99 A;  5HLS A;  4LR6 A;  2R0Y A;  5ENI A;  5EV9 A;  4F3I A;  3AAD A;  5I29 A;  5D0C A;  3UW9 A;  4QNS A;  3FKM X;  4TTE A;  3LQI A;  4QSQ A;  5EP7 A;  5FB1 A;  2RNW A;  4LZ2 A;  4CFL A;  4NYX A;  5EM3 A;  4WIV A;  5LKT A;  5A5R A;  2I8N A;  3TLP A;  2YEM A;  4NR5 A;  3O37 A;  4NR9 A;  5DKH A;  5A85 A;  2F6J A;  3UVW A;  4CUS A;  4C66 A;  2L84 A;  3P1E A;  4FLP A;  4TT2 A;  5TB6 A;  5E7D A;  5D3L A;  3HMH A;  4YAX A;  4O74 A;  2DAT A;  4QEW A;  4A9J A;  4Q0N A;  4HXK A;  5LVQ A;  3JVJ A;  5EGU A;  4NR7 A;  3U5P A;  5DX4 A;  5FFV A;  5I86 A;  4Z1S A;  4NQM A;  2DVQ A;  4CFK A;  4QR5 A; 
#chains in the Genus database with same CATH topology
 5D24 A;  5F60 A;  4QC3 A;  3O34 A;  5A83 A;  4NUE A;  3ONI A;  4LYW A;  2N9G A;  5G4R A;  5JI8 A;  5CUE A;  5FE3 A;  4NQN A;  5D3N A;  5EQ1 A;  5F36 A;  5I40 A;  5LVR A;  4IR4 A;  5HFQ A;  5E73 A;  4QB3 A;  5FE9 A;  4ALG A;  3IU6 A;  3I3J A;  2KTB B;  4N4G A;  5IGM A;  3P1F A;  3ERR A;  5BT3 A;  5IGN A;  5HQ7 A;  5E0R A;  5JWM A;  4UIT A;  2YW5 A;  4TT6 A;  4A9L A;  3K2J A;  2E3K A;  2H60 A;  4NXJ A;  4BJX A;  4KV1 A;  5ENB A;  3SVF A;  4HBY A;  5BT5 A;  4MR6 A;  5CGP A;  5DYC A;  5C4Q A;  3ZYU A;  5KTW A;  2R10 A;  4HXM A;  4O7B A;  5A5Q A;  5I83 A;  2YEK A;  3UVY A;  5HQ5 A;  5CU8 A;  5F5Z A;  3LJW A;  4TT4 A;  4YYH A;  4N4F A;  4BHW A;  4AKN A;  4YAT A;  4LYS A;  4LYI A;  4QSU A;  4A9F A;  5LJ0 A;  3GG3 A;  2LSP B;  1JM4 B;  4BW4 A;  4X2I A;  2RFJ A;  5HEL A;  4MEN A;  5EK9 A;  4TZ2 A;  5LJ1 A;  2RNY A;  5FE2 A;  2R0S A;  5FE7 A;  2WP2 A;  4ALH A;  2R0V A;  4NYV A;  4MEQ A;  5EIC A;  5EU1 A;  4UYG A;  4NR4 A;  5FE6 A;  5KO4 A;  5D3S A;  4QEV A;  4XUB A;  5DKD A;  4GPJ A;  5DKC A;  4A9N A;  5D3P A;  5D26 A;  4RVR A;  5E9K A;  2DVR A;  4PTB A;  1ZS5 A;  5FBX A;  3U5J A;  5CQT A;  5FDZ A;  2F6N A;  5FE1 A;  1N72 A;  3AQA A;  5CTL A;  5CQA A;  4QZS A;  5L8U A;  4O7A A;  5AMF A;  4YBT A;  4CUR A;  4PS5 A;  4NS5 A;  1E6I A;  4UIX A;  4LZR A;  4TQN A;  2YDW A;  4QSX A;  5CUC A;  3VKG A;  5CRZ A;  4YK0 A;  4CL9 A;  5C7N A;  3VKH A;  3LQJ A;  4UIW A;  1X0J A;  5E3D A;  4O75 A;  4QSW A;  5HQ6 A;  5HRW A;  5L8T A;  5D7X A;  3UV2 A;  2YYN A;  5CZG A;  2GRC A;  4NR8 A;  4YYN A;  1ZKR A;  3U5L A;  4LRG A;  5HJC A;  4CLB A;  5CQ7 A;  1JSP B;  4IR6 A;  5DW2 A;  5II2 A;  4AKI A;  1WUM A;  4N4H A;  5L96 A;  5E3G A;  2I7K A;  4HXN A;  5FH7 A;  5LKX A;  3MUL A;  5I1Q A;  4PY6 A;  5C89 A;  5H1U A;  3Q2F A;  4YYD A;  5FG5 A;  4LZS A;  4A9O A;  5A5P A;  5D25 A;  5FE8 A;  5I7X A;  5I7Y A;  4OGI A;  5H85 A;  5K29 A;  3O36 A;  4IOQ A;  4UYF B;  3QZS A;  5HM0 A;  5CRM A;  5ENG A;  3S92 A;  3P1C A;  4ZQL A;  5ENF A;  2FSA A;  5EPR A;  4N3W A;  5EWC A;  2D82 A;  5EPS A;  3UV4 A;  4BW2 A;  4Y03 A;  4YYM A;  4OGJ A;  5CUB A;  3G0J A;  5FE4 A;  2DVS A;  5FFW A;  4YAB A;  4HBV A;  4O70 A;  3MUK A;  3QZV A;  2DWW A;  4MR5 A;  4YAD A;  5LUU A;  4BW1 A;  3UVD A;  4QBM A;  4XUA A;  1EQF A;  4NR6 A;  3O35 A;  5KTU A;  5A7C A;  3P5O A;  4NRA A;  3D1D A;  4AKG A;  4YYG A;  5FE0 A;  5DYU A;  4A9M A;  2YEL A;  4O7E A;  2E7O A;  5IID A;  5CPE A;  3Q2E A;  3MQM A;  3SVG A;  2RI7 A;  5IG6 A;  4ZC9 A;  3U5M A;  5F25 A;  5KHM A;  3UVX A;  4IOR A;  4YY6 A;  5ETD A;  5F2P A;  2RS9 B;  3QZT A;  4NUC A;  4QSS A;  4PCE A;  5EWD A;  4IR5 A;  4UIY A;  5I88 A;  4TU4 A;  5II1 A;  3JVK A;  5FFY A;  5FG4 A;  3UV5 A;  3DWY A;  4IOO A;  4OUF A;  5E9Y A;  3MB4 A;  2DVV A;  4QUT A;  4CUT A;  1WUG A;  5CUD A;  5A82 A;  4ZW1 A;  4QEU A;  4XYA A;  2DKW A;  5HEN A;  4QYL A;  4MR3 A;  4UIV A;  4J3I A;  4QSV A;  4NRB A;  5C85 A;  4N4I A;  5CQ8 A;  5IGL A;  5A5S A;  4QST A;  5H1V A;  4HXO A;  4J0R A;  4QYD A;  5CQ4 A;  4Z1Q A;  4MEO A;  5TCM A;  5FG6 A;  5F3A A;  2RO1 A;  4QSP A;  5DFB A;  4UIU A;  2D9E A;  5F1H A;  4O7C A;  5D3J A;  5F1L A;  4QSR A;  5ENE A;  5C87 A;  3U5N A;  4O71 A;  5EA1 A;  5E9L A;  5HCL A;  5HFR A;  3NXB A;  5ENC A;  5A5N A;  3LQH A;  5L97 A;  5EWH A;  5ENH A;  5E9M A;  5D3H A;  2NXB A;  2EJN A;  4TS8 A;  4PKL A;  2WP1 A;  4LC2 A;  5CQ3 A;  4J0S A;  5LKZ A;  5BT4 A;  5C8G A;  2L5E A;  5D3R A;  4LDF A;  5AME A;  5KU3 A;  5E9V A;  5HRX A;  5H1T A;  5G4S A;  4YYK A;  4WHU A;  4CUP A;  5I80 A;  4UYF A;  4IR3 A;  4KCX A;  4MR4 A;  4O77 A;  5FB0 A;  3JVM A;  4YC9 A;  2E7N A;  3DAI A;  5IBN A;  5LJ2 A;  5CUA A;  5I89 A;  2G4A A;  4NRC A;  5EVA A;  4UYE A;  5DY7 A;  5CQ5 A;  4CUQ A;  3SVH A;  5LKU A;  5FH8 A;  4YBM A;  5DBM A;  3O33 A;  4PCI A;  4UYD A;  4YYI A;  4Z93 A;  4TZ8 A;  4YH3 A;  5F61 A;  3JVL A;  4YYJ A;  5EPB A;  5EWW A;  4Z6I A;  2YQD A;  4J1P A;  4YY4 A;  4XY8 A;  4CUU A;  4HXP A;  4O78 A;  4BW3 A;  3D1B A;  2L85 A;  4MEP A;  4TU6 A;  3HMF A;  3D7C A;  5ACY A;  3IU5 A;  4DON A;  3MB3 A;  5FE5 A;  5DW1 A;  5A81 A;  5HRV A;  2OO1 A;  4A9K A;  5D3T A;  5DLX A;  5COI A;  2MJV B;  5EI4 A;  5L98 A;  5CP5 A;  4KV4 A;  4UIZ A;  5CQ6 A;  4HXS A;  2RNX A;  4HXL A;  4QUU A;  5AD3 A;  5ENJ A;  3RCW A;  3P1D A;  3U5O A;  4C67 A;  4YH4 A;  5DFD A;  4QC1 A;  5F63 A;  4AI6 A;  5DYA A;  4NYW A;  4A9H A;  5CUG A;  1F68 A;  5CS8 A;  5CY9 A;  4HBW A;  4HXR A;  4NUD A;  4O72 A;  5IGK A;  4Q0O A;  4XY9 A;  3MXF A;  5KTX A;  4TYL A;  5J0D A;  5DFC A;  4YBS A;  3LXJ A;  4O7F A;  5E9I A;  5FH6 A;  4Z6H A;  3S91 A;  2OSS A;  4UYH A;  4QR4 A;  4QR3 A;  5CFW A;  5EIS A;  5DYX A;  4E96 A;  5A5O A;  3HME A;  5DLZ A;  4A9E A;  4O76 A;  2OUO A;  5EWV A;  5AD2 A;  3U5K A;  5E74 A;  5HEM A;  4A9I A;  5ETB A;  4QY4 A;  4WHW A;  5F62 A;  4HBX A;  3G0L A;  5L99 A;  5HLS A;  4LR6 A;  2R0Y A;  5ENI A;  5EV9 A;  4F3I A;  3AAD A;  5I29 A;  5D0C A;  3UW9 A;  4QNS A;  3FKM X;  4TTE A;  3LQI A;  4QSQ A;  5EP7 A;  5FB1 A;  2RNW A;  4LZ2 A;  4CFL A;  4NYX A;  5EM3 A;  4WIV A;  5LKT A;  5A5R A;  2I8N A;  3TLP A;  2YEM A;  4NR5 A;  3O37 A;  4NR9 A;  5DKH A;  5A85 A;  2F6J A;  3UVW A;  4CUS A;  4AKH A;  4C66 A;  2L84 A;  3P1E A;  4FLP A;  4TT2 A;  5TB6 A;  5E7D A;  5D3L A;  3HMH A;  4YAX A;  4O74 A;  2DAT A;  4QEW A;  4A9J A;  4Q0N A;  4HXK A;  5LVQ A;  3JVJ A;  5EGU A;  4NR7 A;  3U5P A;  5DX4 A;  5FFV A;  5I86 A;  4Z1S A;  1PUO A;  4NQM A;  2DVQ A;  4CFK A;  4QR5 A; 
#chains in the Genus database with same CATH homology
 5D24 A;  5F60 A;  4QC3 A;  3O34 A;  5A83 A;  4NUE A;  3ONI A;  4LYW A;  2N9G A;  5G4R A;  5JI8 A;  5CUE A;  5FE3 A;  4NQN A;  5D3N A;  5EQ1 A;  5F36 A;  5I40 A;  5LVR A;  4IR4 A;  5HFQ A;  5E73 A;  4QB3 A;  5FE9 A;  4ALG A;  3IU6 A;  3I3J A;  2KTB B;  4N4G A;  5IGM A;  3P1F A;  5BT3 A;  5IGN A;  5HQ7 A;  5E0R A;  5JWM A;  4UIT A;  2YW5 A;  4TT6 A;  4A9L A;  3K2J A;  2E3K A;  2H60 A;  4NXJ A;  4BJX A;  4KV1 A;  5ENB A;  3SVF A;  4HBY A;  5BT5 A;  4MR6 A;  5CGP A;  5DYC A;  5C4Q A;  3ZYU A;  5KTW A;  2R10 A;  4HXM A;  4O7B A;  5A5Q A;  5I83 A;  2YEK A;  3UVY A;  5HQ5 A;  5CU8 A;  5F5Z A;  3LJW A;  4TT4 A;  4YYH A;  4N4F A;  4BHW A;  4AKN A;  4YAT A;  4LYS A;  4LYI A;  4QSU A;  4A9F A;  5LJ0 A;  3GG3 A;  2LSP B;  1JM4 B;  4BW4 A;  4X2I A;  2RFJ A;  5HEL A;  4MEN A;  5EK9 A;  4TZ2 A;  5LJ1 A;  2RNY A;  5FE2 A;  2R0S A;  5FE7 A;  2WP2 A;  4ALH A;  2R0V A;  4NYV A;  4MEQ A;  5EIC A;  5EU1 A;  4UYG A;  4NR4 A;  5FE6 A;  5KO4 A;  5D3S A;  4QEV A;  4XUB A;  5DKD A;  4GPJ A;  5DKC A;  4A9N A;  5D3P A;  5D26 A;  4RVR A;  5E9K A;  2DVR A;  4PTB A;  1ZS5 A;  5FBX A;  3U5J A;  5CQT A;  5FDZ A;  2F6N A;  5FE1 A;  1N72 A;  3AQA A;  5CTL A;  5CQA A;  4QZS A;  5L8U A;  4O7A A;  5AMF A;  4YBT A;  4CUR A;  4PS5 A;  4NS5 A;  1E6I A;  4UIX A;  4LZR A;  4TQN A;  2YDW A;  4QSX A;  5CUC A;  5CRZ A;  4YK0 A;  4CL9 A;  5C7N A;  3LQJ A;  4UIW A;  1X0J A;  5E3D A;  4O75 A;  4QSW A;  5HQ6 A;  5HRW A;  5L8T A;  5D7X A;  3UV2 A;  2YYN A;  5CZG A;  2GRC A;  4NR8 A;  4YYN A;  3U5L A;  4LRG A;  5HJC A;  4CLB A;  5CQ7 A;  1JSP B;  4IR6 A;  5DW2 A;  5II2 A;  1WUM A;  4N4H A;  5L96 A;  5E3G A;  2I7K A;  4HXN A;  5FH7 A;  5LKX A;  3MUL A;  5I1Q A;  4PY6 A;  5C89 A;  5H1U A;  3Q2F A;  4YYD A;  5FG5 A;  4LZS A;  4A9O A;  5A5P A;  5D25 A;  5FE8 A;  5I7X A;  5I7Y A;  4OGI A;  5H85 A;  5K29 A;  3O36 A;  4IOQ A;  4UYF B;  3QZS A;  5HM0 A;  5CRM A;  5ENG A;  3S92 A;  3P1C A;  4ZQL A;  5ENF A;  2FSA A;  5EPR A;  4N3W A;  5EWC A;  2D82 A;  5EPS A;  3UV4 A;  4BW2 A;  4Y03 A;  4YYM A;  4OGJ A;  5CUB A;  3G0J A;  5FE4 A;  2DVS A;  5FFW A;  4YAB A;  4HBV A;  4O70 A;  3MUK A;  3QZV A;  2DWW A;  4MR5 A;  4YAD A;  5LUU A;  4BW1 A;  3UVD A;  4QBM A;  4XUA A;  1EQF A;  4NR6 A;  3O35 A;  5KTU A;  5A7C A;  3P5O A;  4NRA A;  4YYG A;  5FE0 A;  5DYU A;  4A9M A;  2YEL A;  4O7E A;  2E7O A;  5IID A;  5CPE A;  3Q2E A;  3MQM A;  3SVG A;  2RI7 A;  5IG6 A;  4ZC9 A;  3U5M A;  5F25 A;  5KHM A;  3UVX A;  4IOR A;  4YY6 A;  5ETD A;  5F2P A;  2RS9 B;  3QZT A;  4NUC A;  4QSS A;  4PCE A;  5EWD A;  4IR5 A;  4UIY A;  5I88 A;  4TU4 A;  5II1 A;  3JVK A;  5FFY A;  5FG4 A;  3UV5 A;  3DWY A;  4IOO A;  4OUF A;  5E9Y A;  3MB4 A;  2DVV A;  4QUT A;  4CUT A;  1WUG A;  5CUD A;  5A82 A;  4ZW1 A;  4QEU A;  4XYA A;  2DKW A;  5HEN A;  4QYL A;  4MR3 A;  4UIV A;  4J3I A;  4QSV A;  4NRB A;  5C85 A;  4N4I A;  5CQ8 A;  5IGL A;  5A5S A;  4QST A;  5H1V A;  4HXO A;  4J0R A;  4QYD A;  5CQ4 A;  4Z1Q A;  4MEO A;  5TCM A;  5FG6 A;  5F3A A;  2RO1 A;  4QSP A;  5DFB A;  4UIU A;  2D9E A;  5F1H A;  4O7C A;  5D3J A;  5F1L A;  4QSR A;  5ENE A;  5C87 A;  3U5N A;  4O71 A;  5EA1 A;  5E9L A;  5HCL A;  5HFR A;  3NXB A;  5ENC A;  5A5N A;  3LQH A;  5L97 A;  5EWH A;  5ENH A;  5E9M A;  5D3H A;  2NXB A;  4TS8 A;  4PKL A;  2WP1 A;  4LC2 A;  5CQ3 A;  4J0S A;  5LKZ A;  5BT4 A;  5C8G A;  2L5E A;  5D3R A;  4LDF A;  5AME A;  5KU3 A;  5E9V A;  5HRX A;  5H1T A;  5G4S A;  4YYK A;  4WHU A;  4CUP A;  5I80 A;  4UYF A;  4IR3 A;  4KCX A;  4MR4 A;  4O77 A;  5FB0 A;  3JVM A;  4YC9 A;  2E7N A;  3DAI A;  5IBN A;  5LJ2 A;  5CUA A;  5I89 A;  2G4A A;  4NRC A;  5EVA A;  4UYE A;  5DY7 A;  5CQ5 A;  4CUQ A;  3SVH A;  5LKU A;  5FH8 A;  4YBM A;  5DBM A;  3O33 A;  4PCI A;  4UYD A;  4YYI A;  4Z93 A;  4TZ8 A;  4YH3 A;  5F61 A;  3JVL A;  4YYJ A;  5EPB A;  5EWW A;  4Z6I A;  2YQD A;  4J1P A;  4YY4 A;  4XY8 A;  4CUU A;  4HXP A;  4O78 A;  4BW3 A;  2L85 A;  4MEP A;  4TU6 A;  3HMF A;  3D7C A;  5ACY A;  3IU5 A;  4DON A;  3MB3 A;  5FE5 A;  5DW1 A;  5A81 A;  5HRV A;  2OO1 A;  4A9K A;  5D3T A;  5DLX A;  5COI A;  2MJV B;  5EI4 A;  5L98 A;  5CP5 A;  4KV4 A;  4UIZ A;  5CQ6 A;  4HXS A;  2RNX A;  4HXL A;  4QUU A;  5AD3 A;  5ENJ A;  3RCW A;  3P1D A;  3U5O A;  4C67 A;  4YH4 A;  5DFD A;  4QC1 A;  5F63 A;  5DYA A;  4NYW A;  4A9H A;  5CUG A;  1F68 A;  5CS8 A;  5CY9 A;  4HBW A;  4HXR A;  4NUD A;  4O72 A;  5IGK A;  4Q0O A;  4XY9 A;  3MXF A;  5KTX A;  4TYL A;  5J0D A;  5DFC A;  4YBS A;  3LXJ A;  4O7F A;  5E9I A;  5FH6 A;  4Z6H A;  3S91 A;  2OSS A;  4UYH A;  4QR4 A;  4QR3 A;  5CFW A;  5EIS A;  5DYX A;  4E96 A;  5A5O A;  3HME A;  5DLZ A;  4A9E A;  4O76 A;  2OUO A;  5EWV A;  5AD2 A;  3U5K A;  5E74 A;  5HEM A;  4A9I A;  5ETB A;  4QY4 A;  4WHW A;  5F62 A;  4HBX A;  3G0L A;  5L99 A;  5HLS A;  4LR6 A;  2R0Y A;  5ENI A;  5EV9 A;  4F3I A;  3AAD A;  5I29 A;  5D0C A;  3UW9 A;  4QNS A;  3FKM X;  4TTE A;  3LQI A;  4QSQ A;  5EP7 A;  5FB1 A;  2RNW A;  4LZ2 A;  4CFL A;  4NYX A;  5EM3 A;  4WIV A;  5LKT A;  5A5R A;  2I8N A;  3TLP A;  2YEM A;  4NR5 A;  3O37 A;  4NR9 A;  5DKH A;  5A85 A;  2F6J A;  3UVW A;  4CUS A;  4C66 A;  2L84 A;  3P1E A;  4FLP A;  4TT2 A;  5TB6 A;  5E7D A;  5D3L A;  3HMH A;  4YAX A;  4O74 A;  2DAT A;  4QEW A;  4A9J A;  4Q0N A;  4HXK A;  5LVQ A;  3JVJ A;  5EGU A;  4NR7 A;  3U5P A;  5DX4 A;  5FFV A;  5I86 A;  4Z1S A;  4NQM A;  2DVQ A;  4CFK A;  4QR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...