5I29A

Taf1(2) bound to a pyrrolopyridone compound
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
139
structure length
139
Chain Sequence
DDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID subunit 1
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
total genus 54
structure length 139
sequence length 139
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i29A00
3U5PA 5HQ7A 5DYXA 5CQ7A 4O71A 4TU4A 5TCMA 2E3KA 5D3HA 4YYKA 5FH6A 5KTXA 4HXSA 3UVYA 4Q0OA 4YK0A 5KO4A 4ALGA 4XUAA 5I86A 5EPBA 3JVMA 3Q2EA 5CZGA 5ENEA 4A9NA 2YYNA 5C4QA 5EGUA 5DYUA 4PKLA 5EWWA 4QSQA 3O35A 2E7OA 5D3SA 3DWYA 5I7XA 2RS9B 4UIVA 1JSPB 5FDZA 5FE7A 4O72A 4MR6A 5FE4A 4CFLA 2L85A 5E9MA 5HQ6A 4UYDA 4QUTA 5F36A 4N4FA 2D9EA 4XUBA 4A9KA 4YAXA 4A9LA 5G4RA 4QEVA 1JM4B 4NR4A 5E3DA 2YQDA 4LYWA 4A9IA 3QZSA 1WUGA 5IBNA 3O37A 5A7CA 2DKWA 4QR5A 5I1QA 5KTWA 2DWWA 5DKDA 3LXJA 4QEUA 5K29A 4YYNA 4UIWA 4YYGA 2I8NA 4Z6IA 3UW9A 4O7CA 3IU5A 5CQ3A 5II2A 3MUKA 4CLBA 4YC9A 1ZS5A 4NRAA 5FFYA 4N4HA 5E9IA 4TS8A 3P1FA 4IR5A 5HM0A 4HBWA 5FG4A 3JVJA 5CUBA 4O78A 3MULA 2YW5A 2E7NA 5F5ZA 5CQAA 5L96A 5LKUA 5D24A 4NR7A 5I7YA 4QB3A 2LSPB 3O33A 5FB0A 3RCWA 4TZ2A 3JVKA 5CQ8A 5ETBA 4MR4A 5CGPA 3LQIA 2RNXA 4TTEA 4NR9A 5EP7A 4ZQLA 5D3LA 1X0JA 5D25A 5HRVA 5F62A 5EPSA 4N4GA 2DVQA 4PCIA 5CFWA 4LZSA 5FH8A 5LJ1A 5F61A 2R0VA 4J0SA 4LYSA 5D3PA 5L8UA 5EK9A 2YELA 4IR3A 3G0JA 3JVLA 5FE6A 3MB4A 5D0CA 5EI4A 4RVRA 5FE5A 5JI8A 2KTBB 5CS8A 3U5MA 4NUEA 4YYMA 5F25A 4HBVA 5EM3A 5JWMA 5ENBA 5L97A 4MEOA 2RNWA 4YATA 2F6JA 2DVRA 4HXKA 5HRWA 5II1A 4Z1SA 5AMEA 5D7XA 4QYDA 4IORA 5DW1A 3P5OA 1EQFA 5DW2A 4YYHA 5FBXA 5A83A 4BW4A 3UVDA 5LKXA 2WP2A 3QZVA 2R0YA 5E0RA 4XY8A 2OSSA 5CU8A 4QSVA 4YBTA 4NYVA 5E9LA 4CUQA 4BW1A 5DYCA 5CY9A 4A9JA 4O75A 5F60A 5I83A 5E73A 4BJXA 5DKHA 5J0DA 5FG6A 1WUMA 4HXMA 5CQ6A 4LDFA 5LJ0A 4NUDA 5L8TA 5F1HA 1N72A 5CTLA 5C85A 5BT5A 4WHUA 2DVSA 5DX4A 5FG5A 4HXPA 5HLSA 5EWCA 5H1TA 3U5JA 5A81A 5TB6A 5DBMA 4IOQA 5A82A 5AD2A 4O70A 4HXLA 4O7BA 4PY6A 4QY4A 5A5RA 5LKZA 5H85A 5D3TA 5ENGA 5E3GA 5IGNA 2L84A 4KV1A 4NR6A 5I29A 5C87A 4QSRA 4QSSA 4QYLA 2WP1A 4J3IA 1F68A 4UIZA 4QBMA 5HFRA 5I40A 3HMEA 5F1LA 5A5SA 4ZW1A 5I89A 5DLXA 5EV9A 5ENHA 5F63A 4PCEA 4NUCA 4YBMA 5CUDA 3FKMX 5CP5A 4CUTA 4YYDA 3GG3A 3K2JA 5D3RA 5HELA 4X2IA 4O7AA 3UV4A 2YDWA 3UVWA 4LR6A 4Z93A 4A9HA 3AQAA 4QZSA 3MXFA 4MR3A 4UYHA 5LKTA 4QR4A 5IGLA 5CUGA 5C7NA 4AKNA 3I3JA 4OUFA 4LC2A 3P1CA 4UYFB 5A85A 3LQHA 4N4IA 5A5OA 4YY4A 4UIYA 4YBSA 5E7DA 4QC3A 5CUEA 5I88A 3Q2FA 2RO1A 2H60A 4C67A 5DLZA 4DONA 2OO1A 5KTUA 4UYEA 3MQMA 4HBXA 3LQJA 4NYXA 4MEPA 4QR3A 4YABA 5H1UA 5BT4A 2D82A 5FFVA 3SVFA 4TT4A 3U5NA 5D26A 4HXRA 3ONIA 2R10A 5HFQA 5A5NA 4A9FA 4QSWA 4CL9A 4A9EA 4LZRA 5H1VA 4CUUA 5DFBA 5ENFA 5EA1A 3D7CA 2RI7A 4TU6A 5CPEA 3SVHA 4ZC9A 4QEWA 5FE1A 3UV2A 4UIXA 5FE8A 5E9VA 5EU1A 5C89A 5IGKA 4N3WA 4UYGA 4YH4A 5EWVA 4QUUA 4MEQA 4Z6HA 5A5QA 5CRZA 4YY6A 2DVVA 3QZTA 4CUPA 3U5LA 3U5OA 5ENCA 5FFWA 4TQNA 4CUSA 4XYAA 4GPJA 5AMFA 5CUCA 5IG6A 5EWHA 4C66A 3DAIA 2OUOA 2YEMA 4LZ2A 5E9KA 4F3IA 5HQ5A 5EISA 5FE3A 5A5PA 2L5EA 4O7EA 5DFDA 3G0LA 4LYIA 5FE9A 4MENA 2YEKA 4O76A 3NXBA 4PS5A 3O36A 4BW2A 4QSPA 3IU6A 5C8GA 4IOOA 4TT2A 5IIDA 2I7KA 4YYJA 4KV4A 2G4AA 4OGIA 5L98A 1E6IA 4Q0NA 4TYLA 4QSUA 5FE0A 4NRCA 3HMHA 4NQMA 4CFKA 5E9YA 4WHWA 5FE2A 4BW3A 4A9MA 5HCLA 4J1PA 5G4SA 5L99A 4YH3A 5IGMA 5D3JA 4FLPA 4TZ8A 4YADA 4Z1QA 5EVAA 3U5KA 2N9GA 2RFJA 4IR4A 3S91A 5CQTA 5CRMA 2NXBA 3MB3A 3P1DA 4KCXA 3S92A 4BHWA 4MR5A 5CQ4A 4YYIA 5DKCA 5I80A 4OGJA 5DYAA 5CQ5A 5BT3A 5KHMA 2MJVB 2DATA 4O7FA 4Y03A 5E74A 4O77A 3HMFA 5LJ2A 5F2PA 3O34A 4ALHA 5EWDA 5EICA 3LJWA 4TT6A 5AD3A 4NR8A 4QNSA 2FSAA 4A9OA 2GRCA 5F3AA 5LVQA 4CURA 4PTBA 3UV5A 3UVXA 5LUUA 4QSXA 3SVGA 4NYWA 3AADA 4NQNA 4NS5A 4LRGA 5COIA 4WIVA 4QSTA 5HRXA 4HXOA 5EQ1A 4QC1A 5EPRA 5LVRA 4HXNA 2R0SA 4UITA 2F6NA 4UIUA 5ACYA 4HBYA 4NRBA 3P1EA 4NR5A 2RNYA 5FB1A 5KU3A 5HJCA 5DY7A 5HENA 5FH7A 4J0RA 5ETDA 4E96A 4IR6A 5ENJA 4NXJA 5ENIA 3TLPA 4XY9A 4O74A 5DFCA 4UYFA 5D3NA 5CUAA 3ZYUA 5HEMA
chains in the Genus database with same CATH superfamily
3U5PA 5HQ7A 5DYXA 5CQ7A 4O71A 4TU4A 5TCMA 2E3KA 5D3HA 4YYKA 5FH6A 5KTXA 4HXSA 3UVYA 4Q0OA 4YK0A 5KO4A 4ALGA 4XUAA 5I86A 5EPBA 3JVMA 3Q2EA 5CZGA 5ENEA 4A9NA 2YYNA 5C4QA 5EGUA 5DYUA 4AKGA 4PKLA 5EWWA 4QSQA 3O35A 2E7OA 5D3SA 3DWYA 5I7XA 2RS9B 4UIVA 1JSPB 5FDZA 5FE7A 4O72A 4MR6A 5FE4A 4CFLA 2L85A 5E9MA 5HQ6A 1PUOA 4UYDA 4QUTA 5F36A 4N4FA 2D9EA 4XUBA 4A9KA 4YAXA 4A9LA 5G4RA 4QEVA 1JM4B 4NR4A 5E3DA 2YQDA 4LYWA 4A9IA 3QZSA 1WUGA 5IBNA 3O37A 5A7CA 2DKWA 4QR5A 5I1QA 5KTWA 2DWWA 5DKDA 3LXJA 4QEUA 5K29A 4YYNA 4UIWA 4YYGA 2I8NA 4Z6IA 3UW9A 4O7CA 3IU5A 5CQ3A 5II2A 3MUKA 4CLBA 4YC9A 1ZS5A 4NRAA 5FFYA 4N4HA 5E9IA 4TS8A 3P1FA 4IR5A 5HM0A 4HBWA 5FG4A 3JVJA 5CUBA 4O78A 3MULA 2YW5A 2E7NA 5F5ZA 5CQAA 5L96A 5LKUA 5D24A 4NR7A 5I7YA 4QB3A 2LSPB 3O33A 5FB0A 3RCWA 4TZ2A 3JVKA 5CQ8A 5ETBA 4MR4A 5CGPA 3D1DA 3LQIA 2RNXA 4TTEA 4NR9A 5EP7A 4AKHA 4ZQLA 5D3LA 1X0JA 5D25A 5HRVA 5F62A 5EPSA 4N4GA 3D1BA 2DVQA 4PCIA 5CFWA 4LZSA 5FH8A 5LJ1A 5F61A 2R0VA 4J0SA 4LYSA 5D3PA 5L8UA 5EK9A 2YELA 4IR3A 3G0JA 3JVLA 5FE6A 3MB4A 5D0CA 5EI4A 1ZKRA 4RVRA 5FE5A 5JI8A 2KTBB 5CS8A 3U5MA 4NUEA 4YYMA 5F25A 4HBVA 5EM3A 5JWMA 5ENBA 5L97A 4MEOA 2RNWA 4YATA 2F6JA 2DVRA 4HXKA 5HRWA 5II1A 4Z1SA 5AMEA 5D7XA 4QYDA 4IORA 5DW1A 3P5OA 1EQFA 5DW2A 4YYHA 5FBXA 5A83A 4BW4A 3UVDA 5LKXA 2WP2A 3QZVA 2R0YA 5E0RA 4XY8A 2OSSA 5CU8A 4QSVA 4YBTA 4NYVA 5E9LA 4CUQA 4BW1A 5DYCA 5CY9A 4A9JA 4O75A 5F60A 5I83A 5E73A 4BJXA 5DKHA 5J0DA 5FG6A 1WUMA 4HXMA 5CQ6A 4LDFA 5LJ0A 4NUDA 5L8TA 5F1HA 1N72A 5CTLA 5C85A 5BT5A 4WHUA 2DVSA 5DX4A 5FG5A 4HXPA 5HLSA 5EWCA 5H1TA 3U5JA 5A81A 5TB6A 5DBMA 4IOQA 5A82A 5AD2A 4O70A 4HXLA 4O7BA 4PY6A 4QY4A 5A5RA 5LKZA 5H85A 5D3TA 5ENGA 5E3GA 2EJNA 5IGNA 2L84A 4KV1A 4NR6A 5I29A 5C87A 4QSRA 4QSSA 4QYLA 2WP1A 4J3IA 1F68A 4UIZA 4QBMA 5HFRA 5I40A 3HMEA 5F1LA 5A5SA 4ZW1A 5I89A 5DLXA 5EV9A 5ENHA 5F63A 4PCEA 4NUCA 4YBMA 5CUDA 3FKMX 5CP5A 4CUTA 4YYDA 3GG3A 3K2JA 5D3RA 5HELA 4X2IA 3VKGA 4O7AA 3UV4A 2YDWA 3UVWA 4LR6A 4Z93A 4A9HA 3AQAA 4QZSA 3MXFA 4MR3A 4UYHA 5LKTA 4QR4A 5IGLA 5CUGA 5C7NA 4AKNA 3I3JA 4OUFA 4LC2A 3P1CA 4UYFB 5A85A 3LQHA 4N4IA 5A5OA 4YY4A 4UIYA 4YBSA 5E7DA 4QC3A 5CUEA 5I88A 3Q2FA 2RO1A 2H60A 4C67A 5DLZA 4DONA 2OO1A 5KTUA 4UYEA 3MQMA 4HBXA 3LQJA 4NYXA 4MEPA 4QR3A 4YABA 5H1UA 5BT4A 2D82A 5FFVA 3SVFA 4TT4A 3U5NA 5D26A 4HXRA 3ONIA 2R10A 5HFQA 5A5NA 4A9FA 4QSWA 4CL9A 4A9EA 4LZRA 5H1VA 4CUUA 5DFBA 5ENFA 5EA1A 3D7CA 2RI7A 4TU6A 5CPEA 3SVHA 4ZC9A 4QEWA 3ERRA 5FE1A 3UV2A 4UIXA 5FE8A 5E9VA 5EU1A 5C89A 5IGKA 4N3WA 4UYGA 4YH4A 5EWVA 4QUUA 4MEQA 4Z6HA 5A5QA 5CRZA 4YY6A 2DVVA 3QZTA 4CUPA 3U5LA 3U5OA 5ENCA 5FFWA 4TQNA 4CUSA 4XYAA 4GPJA 5AMFA 5CUCA 5IG6A 5EWHA 4C66A 3DAIA 2OUOA 2YEMA 4LZ2A 5E9KA 4F3IA 5HQ5A 5EISA 5FE3A 5A5PA 2L5EA 4O7EA 5DFDA 3G0LA 4LYIA 5FE9A 4MENA 2YEKA 4O76A 3NXBA 4PS5A 3O36A 4BW2A 4QSPA 3IU6A 5C8GA 4IOOA 4TT2A 5IIDA 2I7KA 4YYJA 4KV4A 2G4AA 4OGIA 5L98A 4AI6A 1E6IA 4Q0NA 4TYLA 4QSUA 5FE0A 4NRCA 3HMHA 4NQMA 4CFKA 5E9YA 4WHWA 5FE2A 4BW3A 4A9MA 5HCLA 4J1PA 5G4SA 5L99A 4YH3A 5IGMA 5D3JA 4FLPA 4TZ8A 4YADA 4Z1QA 5EVAA 3U5KA 2N9GA 2RFJA 4IR4A 3S91A 5CQTA 5CRMA 2NXBA 3MB3A 3P1DA 4KCXA 3S92A 4BHWA 4MR5A 5CQ4A 4YYIA 5DKCA 5I80A 4OGJA 5DYAA 5CQ5A 5BT3A 5KHMA 2MJVB 2DATA 4O7FA 4Y03A 5E74A 4O77A 3HMFA 5LJ2A 5F2PA 3O34A 4ALHA 5EWDA 5EICA 3LJWA 4TT6A 5AD3A 4NR8A 4QNSA 2FSAA 4A9OA 2GRCA 5F3AA 5LVQA 3VKHA 4CURA 4PTBA 3UV5A 3UVXA 5LUUA 4QSXA 3SVGA 4NYWA 3AADA 4NQNA 4NS5A 4LRGA 5COIA 4WIVA 4QSTA 5HRXA 4HXOA 5EQ1A 4QC1A 5EPRA 5LVRA 4HXNA 2R0SA 4UITA 2F6NA 4UIUA 5ACYA 4HBYA 4NRBA 3P1EA 4NR5A 2RNYA 5FB1A 5KU3A 5HJCA 5DY7A 5HENA 5FH7A 4J0RA 5ETDA 4E96A 4IR6A 5ENJA 4NXJA 5ENIA 3TLPA 4XY9A 4O74A 5DFCA 4UYFA 5D3NA 5CUAA 3ZYUA 4AKIA 5HEMA
chains in the Genus database with same CATH topology
3U5PA 5HQ7A 5DYXA 5CQ7A 4O71A 4TU4A 5TCMA 2E3KA 5D3HA 4YYKA 5FH6A 5KTXA 4HXSA 3UVYA 4Q0OA 4YK0A 5KO4A 4ALGA 4XUAA 5I86A 5EPBA 3JVMA 3Q2EA 5CZGA 5ENEA 4A9NA 2YYNA 5C4QA 5EGUA 5DYUA 4PKLA 5EWWA 4QSQA 3O35A 2E7OA 5D3SA 3DWYA 5I7XA 2RS9B 4UIVA 1JSPB 5FDZA 5FE7A 4O72A 4MR6A 5FE4A 4CFLA 2L85A 5E9MA 5HQ6A 4UYDA 4QUTA 5F36A 4N4FA 2D9EA 4XUBA 4A9KA 4YAXA 4A9LA 5G4RA 4QEVA 1JM4B 4NR4A 5E3DA 2YQDA 4LYWA 4A9IA 3QZSA 1WUGA 5IBNA 3O37A 5A7CA 2DKWA 4QR5A 5I1QA 5KTWA 2DWWA 5DKDA 3LXJA 4QEUA 5K29A 4YYNA 4UIWA 4YYGA 2I8NA 4Z6IA 3UW9A 4O7CA 3IU5A 5CQ3A 5II2A 3MUKA 4CLBA 4YC9A 1ZS5A 4NRAA 5FFYA 4N4HA 5E9IA 4TS8A 3P1FA 4IR5A 5HM0A 4HBWA 5FG4A 3JVJA 5CUBA 4O78A 3MULA 2YW5A 2E7NA 5F5ZA 5CQAA 5L96A 5LKUA 5D24A 4NR7A 5I7YA 4QB3A 2LSPB 3O33A 5FB0A 3RCWA 4TZ2A 3JVKA 5CQ8A 5ETBA 4MR4A 5CGPA 3LQIA 2RNXA 4TTEA 4NR9A 5EP7A 4ZQLA 5D3LA 1X0JA 5D25A 5HRVA 5F62A 5EPSA 4N4GA 2DVQA 4PCIA 5CFWA 4LZSA 5FH8A 5LJ1A 5F61A 2R0VA 4J0SA 4LYSA 5D3PA 5L8UA 5EK9A 2YELA 4IR3A 3G0JA 3JVLA 5FE6A 3MB4A 5D0CA 5EI4A 4RVRA 5FE5A 5JI8A 2KTBB 5CS8A 3U5MA 4NUEA 4YYMA 5F25A 4HBVA 5EM3A 5JWMA 5ENBA 5L97A 4MEOA 2RNWA 4YATA 2F6JA 2DVRA 4HXKA 5HRWA 5II1A 4Z1SA 5AMEA 5D7XA 4QYDA 4IORA 5DW1A 3P5OA 1EQFA 5DW2A 4YYHA 5FBXA 5A83A 4BW4A 3UVDA 5LKXA 2WP2A 3QZVA 2R0YA 5E0RA 4XY8A 2OSSA 5CU8A 4QSVA 4YBTA 4NYVA 5E9LA 4CUQA 4BW1A 5DYCA 5CY9A 4A9JA 4O75A 5F60A 5I83A 5E73A 4BJXA 5DKHA 5J0DA 5FG6A 1WUMA 4HXMA 5CQ6A 4LDFA 5LJ0A 4NUDA 5L8TA 5F1HA 1N72A 5CTLA 5C85A 5BT5A 4WHUA 2DVSA 5DX4A 5FG5A 4HXPA 5HLSA 5EWCA 5H1TA 3U5JA 5A81A 5TB6A 5DBMA 4IOQA 5A82A 5AD2A 4O70A 4HXLA 4O7BA 4PY6A 4QY4A 5A5RA 5LKZA 5H85A 5D3TA 5ENGA 5E3GA 5IGNA 2L84A 4KV1A 4NR6A 5I29A 5C87A 4QSRA 4QSSA 4QYLA 2WP1A 4J3IA 1F68A 4UIZA 4QBMA 5HFRA 5I40A 3HMEA 5F1LA 5A5SA 4ZW1A 5I89A 5DLXA 5EV9A 5ENHA 5F63A 4PCEA 4NUCA 4YBMA 5CUDA 3FKMX 5CP5A 4CUTA 4YYDA 3GG3A 3K2JA 5D3RA 5HELA 4X2IA 4O7AA 3UV4A 2YDWA 3UVWA 4LR6A 4Z93A 4A9HA 3AQAA 4QZSA 3MXFA 4MR3A 4UYHA 5LKTA 4QR4A 5IGLA 5CUGA 5C7NA 4AKNA 3I3JA 4OUFA 4LC2A 3P1CA 4UYFB 5A85A 3LQHA 4N4IA 5A5OA 4YY4A 4UIYA 4YBSA 5E7DA 4QC3A 5CUEA 5I88A 3Q2FA 2RO1A 2H60A 4C67A 5DLZA 4DONA 2OO1A 5KTUA 4UYEA 3MQMA 4HBXA 3LQJA 4NYXA 4MEPA 4QR3A 4YABA 5H1UA 5BT4A 2D82A 5FFVA 3SVFA 4TT4A 3U5NA 5D26A 4HXRA 3ONIA 2R10A 5HFQA 5A5NA 4A9FA 4QSWA 4CL9A 4A9EA 4LZRA 5H1VA 4CUUA 5DFBA 5ENFA 5EA1A 3D7CA 2RI7A 4TU6A 5CPEA 3SVHA 4ZC9A 4QEWA 5FE1A 3UV2A 4UIXA 5FE8A 5E9VA 5EU1A 5C89A 5IGKA 4N3WA 4UYGA 4YH4A 5EWVA 4QUUA 4MEQA 4Z6HA 5A5QA 5CRZA 4YY6A 2DVVA 3QZTA 4CUPA 3U5LA 3U5OA 5ENCA 5FFWA 4TQNA 4CUSA 4XYAA 4GPJA 5AMFA 5CUCA 5IG6A 5EWHA 4C66A 3DAIA 2OUOA 2YEMA 4LZ2A 5E9KA 4F3IA 5HQ5A 5EISA 5FE3A 5A5PA 2L5EA 4O7EA 5DFDA 3G0LA 4LYIA 5FE9A 4MENA 2YEKA 4O76A 3NXBA 4PS5A 3O36A 4BW2A 4QSPA 3IU6A 5C8GA 4IOOA 4TT2A 5IIDA 2I7KA 4YYJA 4KV4A 2G4AA 4OGIA 5L98A 1E6IA 4Q0NA 4TYLA 4QSUA 5FE0A 4NRCA 3HMHA 4NQMA 4CFKA 5E9YA 4WHWA 5FE2A 4BW3A 4A9MA 5HCLA 4J1PA 5G4SA 5L99A 4YH3A 5IGMA 5D3JA 4FLPA 4TZ8A 4YADA 4Z1QA 5EVAA 3U5KA 2N9GA 2RFJA 4IR4A 3S91A 5CQTA 5CRMA 2NXBA 3MB3A 3P1DA 4KCXA 3S92A 4BHWA 4MR5A 5CQ4A 4YYIA 5DKCA 5I80A 4OGJA 5DYAA 5CQ5A 5BT3A 5KHMA 2MJVB 2DATA 4O7FA 4Y03A 5E74A 4O77A 3HMFA 5LJ2A 5F2PA 3O34A 4ALHA 5EWDA 5EICA 3LJWA 4TT6A 5AD3A 4NR8A 4QNSA 2FSAA 4A9OA 2GRCA 5F3AA 5LVQA 4CURA 4PTBA 3UV5A 3UVXA 5LUUA 4QSXA 3SVGA 4NYWA 3AADA 4NQNA 4NS5A 4LRGA 5COIA 4WIVA 4QSTA 5HRXA 4HXOA 5EQ1A 4QC1A 5EPRA 5LVRA 4HXNA 2R0SA 4UITA 2F6NA 4UIUA 5ACYA 4HBYA 4NRBA 3P1EA 4NR5A 2RNYA 5FB1A 5KU3A 5HJCA 5DY7A 5HENA 5FH7A 4J0RA 5ETDA 4E96A 4IR6A 5ENJA 4NXJA 5ENIA 3TLPA 4XY9A 4O74A 5DFCA 4UYFA 5D3NA 5CUAA 3ZYUA 5HEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5P A;  5HQ7 A;  5DYX A;  5CQ7 A;  4O71 A;  4TU4 A;  5TCM A;  2E3K A;  5D3H A;  4YYK A;  5FH6 A;  5KTX A;  4HXS A;  3UVY A;  4Q0O A;  4YK0 A;  5KO4 A;  4ALG A;  4XUA A;  5I86 A;  5EPB A;  3JVM A;  3Q2E A;  5CZG A;  5ENE A;  4A9N A;  2YYN A;  5C4Q A;  5EGU A;  5DYU A;  4PKL A;  5EWW A;  4QSQ A;  3O35 A;  2E7O A;  5D3S A;  3DWY A;  5I7X A;  2RS9 B;  4UIV A;  1JSP B;  5FDZ A;  5FE7 A;  4O72 A;  4MR6 A;  5FE4 A;  4CFL A;  2L85 A;  5E9M A;  5HQ6 A;  4UYD A;  4QUT A;  5F36 A;  4N4F A;  2D9E A;  4XUB A;  4A9K A;  4YAX A;  4A9L A;  5G4R A;  4QEV A;  1JM4 B;  4NR4 A;  5E3D A;  2YQD A;  4LYW A;  4A9I A;  3QZS A;  1WUG A;  5IBN A;  3O37 A;  5A7C A;  2DKW A;  4QR5 A;  5I1Q A;  5KTW A;  2DWW A;  5DKD A;  3LXJ A;  4QEU A;  5K29 A;  4YYN A;  4UIW A;  4YYG A;  2I8N A;  4Z6I A;  3UW9 A;  4O7C A;  3IU5 A;  5CQ3 A;  5II2 A;  3MUK A;  4CLB A;  4YC9 A;  1ZS5 A;  4NRA A;  5FFY A;  4N4H A;  5E9I A;  4TS8 A;  3P1F A;  4IR5 A;  5HM0 A;  4HBW A;  5FG4 A;  3JVJ A;  5CUB A;  4O78 A;  3MUL A;  2YW5 A;  2E7N A;  5F5Z A;  5CQA A;  5L96 A;  5LKU A;  5D24 A;  4NR7 A;  5I7Y A;  4QB3 A;  2LSP B;  3O33 A;  5FB0 A;  3RCW A;  4TZ2 A;  3JVK A;  5CQ8 A;  5ETB A;  4MR4 A;  5CGP A;  3LQI A;  2RNX A;  4TTE A;  4NR9 A;  5EP7 A;  4ZQL A;  5D3L A;  1X0J A;  5D25 A;  5HRV A;  5F62 A;  5EPS A;  4N4G A;  2DVQ A;  4PCI A;  5CFW A;  4LZS A;  5FH8 A;  5LJ1 A;  5F61 A;  2R0V A;  4J0S A;  4LYS A;  5D3P A;  5L8U A;  5EK9 A;  2YEL A;  4IR3 A;  3G0J A;  3JVL A;  5FE6 A;  3MB4 A;  5D0C A;  5EI4 A;  4RVR A;  5FE5 A;  5JI8 A;  2KTB B;  5CS8 A;  3U5M A;  4NUE A;  4YYM A;  5F25 A;  4HBV A;  5EM3 A;  5JWM A;  5ENB A;  5L97 A;  4MEO A;  2RNW A;  4YAT A;  2F6J A;  2DVR A;  4HXK A;  5HRW A;  5II1 A;  4Z1S A;  5AME A;  5D7X A;  4QYD A;  4IOR A;  5DW1 A;  3P5O A;  1EQF A;  5DW2 A;  4YYH A;  5FBX A;  5A83 A;  4BW4 A;  3UVD A;  5LKX A;  2WP2 A;  3QZV A;  2R0Y A;  5E0R A;  4XY8 A;  2OSS A;  5CU8 A;  4QSV A;  4YBT A;  4NYV A;  5E9L A;  4CUQ A;  4BW1 A;  5DYC A;  5CY9 A;  4A9J A;  4O75 A;  5F60 A;  5I83 A;  5E73 A;  4BJX A;  5DKH A;  5J0D A;  5FG6 A;  1WUM A;  4HXM A;  5CQ6 A;  4LDF A;  5LJ0 A;  4NUD A;  5L8T A;  5F1H A;  1N72 A;  5CTL A;  5C85 A;  5BT5 A;  4WHU A;  2DVS A;  5DX4 A;  5FG5 A;  4HXP A;  5HLS A;  5EWC A;  5H1T A;  3U5J A;  5A81 A;  5TB6 A;  5DBM A;  4IOQ A;  5A82 A;  5AD2 A;  4O70 A;  4HXL A;  4O7B A;  4PY6 A;  4QY4 A;  5A5R A;  5LKZ A;  5H85 A;  5D3T A;  5ENG A;  5E3G A;  5IGN A;  2L84 A;  4KV1 A;  4NR6 A;  5I29 A;  5C87 A;  4QSR A;  4QSS A;  4QYL A;  2WP1 A;  4J3I A;  1F68 A;  4UIZ A;  4QBM A;  5HFR A;  5I40 A;  3HME A;  5F1L A;  5A5S A;  4ZW1 A;  5I89 A;  5DLX A;  5EV9 A;  5ENH A;  5F63 A;  4PCE A;  4NUC A;  4YBM A;  5CUD A;  3FKM X;  5CP5 A;  4CUT A;  4YYD A;  3GG3 A;  3K2J A;  5D3R A;  5HEL A;  4X2I A;  4O7A A;  3UV4 A;  2YDW A;  3UVW A;  4LR6 A;  4Z93 A;  4A9H A;  3AQA A;  4QZS A;  3MXF A;  4MR3 A;  4UYH A;  5LKT A;  4QR4 A;  5IGL A;  5CUG A;  5C7N A;  4AKN A;  3I3J A;  4OUF A;  4LC2 A;  3P1C A;  4UYF B;  5A85 A;  3LQH A;  4N4I A;  5A5O A;  4YY4 A;  4UIY A;  4YBS A;  5E7D A;  4QC3 A;  5CUE A;  5I88 A;  3Q2F A;  2RO1 A;  2H60 A;  4C67 A;  5DLZ A;  4DON A;  2OO1 A;  5KTU A;  4UYE A;  3MQM A;  4HBX A;  3LQJ A;  4NYX A;  4MEP A;  4QR3 A;  4YAB A;  5H1U A;  5BT4 A;  2D82 A;  5FFV A;  3SVF A;  4TT4 A;  3U5N A;  5D26 A;  4HXR A;  3ONI A;  2R10 A;  5HFQ A;  5A5N A;  4A9F A;  4QSW A;  4CL9 A;  4A9E A;  4LZR A;  5H1V A;  4CUU A;  5DFB A;  5ENF A;  5EA1 A;  3D7C A;  2RI7 A;  4TU6 A;  5CPE A;  3SVH A;  4ZC9 A;  4QEW A;  5FE1 A;  3UV2 A;  4UIX A;  5FE8 A;  5E9V A;  5EU1 A;  5C89 A;  5IGK A;  4N3W A;  4UYG A;  4YH4 A;  5EWV A;  4QUU A;  4MEQ A;  4Z6H A;  5A5Q A;  5CRZ A;  4YY6 A;  2DVV A;  3QZT A;  4CUP A;  3U5L A;  3U5O A;  5ENC A;  5FFW A;  4TQN A;  4CUS A;  4XYA A;  4GPJ A;  5AMF A;  5CUC A;  5IG6 A;  5EWH A;  4C66 A;  3DAI A;  2OUO A;  2YEM A;  4LZ2 A;  5E9K A;  4F3I A;  5HQ5 A;  5EIS A;  5FE3 A;  5A5P A;  2L5E A;  4O7E A;  5DFD A;  3G0L A;  4LYI A;  5FE9 A;  4MEN A;  2YEK A;  4O76 A;  3NXB A;  4PS5 A;  3O36 A;  4BW2 A;  4QSP A;  3IU6 A;  5C8G A;  4IOO A;  4TT2 A;  5IID A;  2I7K A;  4YYJ A;  4KV4 A;  2G4A A;  4OGI A;  5L98 A;  1E6I A;  4Q0N A;  4TYL A;  4QSU A;  5FE0 A;  4NRC A;  3HMH A;  4NQM A;  4CFK A;  5E9Y A;  4WHW A;  5FE2 A;  4BW3 A;  4A9M A;  5HCL A;  4J1P A;  5G4S A;  5L99 A;  4YH3 A;  5IGM A;  5D3J A;  4FLP A;  4TZ8 A;  4YAD A;  4Z1Q A;  5EVA A;  3U5K A;  2N9G A;  2RFJ A;  4IR4 A;  3S91 A;  5CQT A;  5CRM A;  2NXB A;  3MB3 A;  3P1D A;  4KCX A;  3S92 A;  4BHW A;  4MR5 A;  5CQ4 A;  4YYI A;  5DKC A;  5I80 A;  4OGJ A;  5DYA A;  5CQ5 A;  5BT3 A;  5KHM A;  2MJV B;  2DAT A;  4O7F A;  4Y03 A;  5E74 A;  4O77 A;  3HMF A;  5LJ2 A;  5F2P A;  3O34 A;  4ALH A;  5EWD A;  5EIC A;  3LJW A;  4TT6 A;  5AD3 A;  4NR8 A;  4QNS A;  2FSA A;  4A9O A;  2GRC A;  5F3A A;  5LVQ A;  4CUR A;  4PTB A;  3UV5 A;  3UVX A;  5LUU A;  4QSX A;  3SVG A;  4NYW A;  3AAD A;  4NQN A;  4NS5 A;  4LRG A;  5COI A;  4WIV A;  4QST A;  5HRX A;  4HXO A;  5EQ1 A;  4QC1 A;  5EPR A;  5LVR A;  4HXN A;  2R0S A;  4UIT A;  2F6N A;  4UIU A;  5ACY A;  4HBY A;  4NRB A;  3P1E A;  4NR5 A;  2RNY A;  5FB1 A;  5KU3 A;  5HJC A;  5DY7 A;  5HEN A;  5FH7 A;  4J0R A;  5ETD A;  4E96 A;  4IR6 A;  5ENJ A;  4NXJ A;  5ENI A;  3TLP A;  4XY9 A;  4O74 A;  5DFC A;  4UYF A;  5D3N A;  5CUA A;  3ZYU A;  5HEM A; 
#chains in the Genus database with same CATH topology
 3U5P A;  5HQ7 A;  5DYX A;  5CQ7 A;  4O71 A;  4TU4 A;  5TCM A;  2E3K A;  5D3H A;  4YYK A;  5FH6 A;  5KTX A;  4HXS A;  3UVY A;  4Q0O A;  4YK0 A;  5KO4 A;  4ALG A;  4XUA A;  5I86 A;  5EPB A;  3JVM A;  3Q2E A;  5CZG A;  5ENE A;  4A9N A;  2YYN A;  5C4Q A;  5EGU A;  5DYU A;  4AKG A;  4PKL A;  5EWW A;  4QSQ A;  3O35 A;  2E7O A;  5D3S A;  3DWY A;  5I7X A;  2RS9 B;  4UIV A;  1JSP B;  5FDZ A;  5FE7 A;  4O72 A;  4MR6 A;  5FE4 A;  4CFL A;  2L85 A;  5E9M A;  5HQ6 A;  1PUO A;  4UYD A;  4QUT A;  5F36 A;  4N4F A;  2D9E A;  4XUB A;  4A9K A;  4YAX A;  4A9L A;  5G4R A;  4QEV A;  1JM4 B;  4NR4 A;  5E3D A;  2YQD A;  4LYW A;  4A9I A;  3QZS A;  1WUG A;  5IBN A;  3O37 A;  5A7C A;  2DKW A;  4QR5 A;  5I1Q A;  5KTW A;  2DWW A;  5DKD A;  3LXJ A;  4QEU A;  5K29 A;  4YYN A;  4UIW A;  4YYG A;  2I8N A;  4Z6I A;  3UW9 A;  4O7C A;  3IU5 A;  5CQ3 A;  5II2 A;  3MUK A;  4CLB A;  4YC9 A;  1ZS5 A;  4NRA A;  5FFY A;  4N4H A;  5E9I A;  4TS8 A;  3P1F A;  4IR5 A;  5HM0 A;  4HBW A;  5FG4 A;  3JVJ A;  5CUB A;  4O78 A;  3MUL A;  2YW5 A;  2E7N A;  5F5Z A;  5CQA A;  5L96 A;  5LKU A;  5D24 A;  4NR7 A;  5I7Y A;  4QB3 A;  2LSP B;  3O33 A;  5FB0 A;  3RCW A;  4TZ2 A;  3JVK A;  5CQ8 A;  5ETB A;  4MR4 A;  5CGP A;  3D1D A;  3LQI A;  2RNX A;  4TTE A;  4NR9 A;  5EP7 A;  4AKH A;  4ZQL A;  5D3L A;  1X0J A;  5D25 A;  5HRV A;  5F62 A;  5EPS A;  4N4G A;  3D1B A;  2DVQ A;  4PCI A;  5CFW A;  4LZS A;  5FH8 A;  5LJ1 A;  5F61 A;  2R0V A;  4J0S A;  4LYS A;  5D3P A;  5L8U A;  5EK9 A;  2YEL A;  4IR3 A;  3G0J A;  3JVL A;  5FE6 A;  3MB4 A;  5D0C A;  5EI4 A;  1ZKR A;  4RVR A;  5FE5 A;  5JI8 A;  2KTB B;  5CS8 A;  3U5M A;  4NUE A;  4YYM A;  5F25 A;  4HBV A;  5EM3 A;  5JWM A;  5ENB A;  5L97 A;  4MEO A;  2RNW A;  4YAT A;  2F6J A;  2DVR A;  4HXK A;  5HRW A;  5II1 A;  4Z1S A;  5AME A;  5D7X A;  4QYD A;  4IOR A;  5DW1 A;  3P5O A;  1EQF A;  5DW2 A;  4YYH A;  5FBX A;  5A83 A;  4BW4 A;  3UVD A;  5LKX A;  2WP2 A;  3QZV A;  2R0Y A;  5E0R A;  4XY8 A;  2OSS A;  5CU8 A;  4QSV A;  4YBT A;  4NYV A;  5E9L A;  4CUQ A;  4BW1 A;  5DYC A;  5CY9 A;  4A9J A;  4O75 A;  5F60 A;  5I83 A;  5E73 A;  4BJX A;  5DKH A;  5J0D A;  5FG6 A;  1WUM A;  4HXM A;  5CQ6 A;  4LDF A;  5LJ0 A;  4NUD A;  5L8T A;  5F1H A;  1N72 A;  5CTL A;  5C85 A;  5BT5 A;  4WHU A;  2DVS A;  5DX4 A;  5FG5 A;  4HXP A;  5HLS A;  5EWC A;  5H1T A;  3U5J A;  5A81 A;  5TB6 A;  5DBM A;  4IOQ A;  5A82 A;  5AD2 A;  4O70 A;  4HXL A;  4O7B A;  4PY6 A;  4QY4 A;  5A5R A;  5LKZ A;  5H85 A;  5D3T A;  5ENG A;  5E3G A;  2EJN A;  5IGN A;  2L84 A;  4KV1 A;  4NR6 A;  5I29 A;  5C87 A;  4QSR A;  4QSS A;  4QYL A;  2WP1 A;  4J3I A;  1F68 A;  4UIZ A;  4QBM A;  5HFR A;  5I40 A;  3HME A;  5F1L A;  5A5S A;  4ZW1 A;  5I89 A;  5DLX A;  5EV9 A;  5ENH A;  5F63 A;  4PCE A;  4NUC A;  4YBM A;  5CUD A;  3FKM X;  5CP5 A;  4CUT A;  4YYD A;  3GG3 A;  3K2J A;  5D3R A;  5HEL A;  4X2I A;  3VKG A;  4O7A A;  3UV4 A;  2YDW A;  3UVW A;  4LR6 A;  4Z93 A;  4A9H A;  3AQA A;  4QZS A;  3MXF A;  4MR3 A;  4UYH A;  5LKT A;  4QR4 A;  5IGL A;  5CUG A;  5C7N A;  4AKN A;  3I3J A;  4OUF A;  4LC2 A;  3P1C A;  4UYF B;  5A85 A;  3LQH A;  4N4I A;  5A5O A;  4YY4 A;  4UIY A;  4YBS A;  5E7D A;  4QC3 A;  5CUE A;  5I88 A;  3Q2F A;  2RO1 A;  2H60 A;  4C67 A;  5DLZ A;  4DON A;  2OO1 A;  5KTU A;  4UYE A;  3MQM A;  4HBX A;  3LQJ A;  4NYX A;  4MEP A;  4QR3 A;  4YAB A;  5H1U A;  5BT4 A;  2D82 A;  5FFV A;  3SVF A;  4TT4 A;  3U5N A;  5D26 A;  4HXR A;  3ONI A;  2R10 A;  5HFQ A;  5A5N A;  4A9F A;  4QSW A;  4CL9 A;  4A9E A;  4LZR A;  5H1V A;  4CUU A;  5DFB A;  5ENF A;  5EA1 A;  3D7C A;  2RI7 A;  4TU6 A;  5CPE A;  3SVH A;  4ZC9 A;  4QEW A;  3ERR A;  5FE1 A;  3UV2 A;  4UIX A;  5FE8 A;  5E9V A;  5EU1 A;  5C89 A;  5IGK A;  4N3W A;  4UYG A;  4YH4 A;  5EWV A;  4QUU A;  4MEQ A;  4Z6H A;  5A5Q A;  5CRZ A;  4YY6 A;  2DVV A;  3QZT A;  4CUP A;  3U5L A;  3U5O A;  5ENC A;  5FFW A;  4TQN A;  4CUS A;  4XYA A;  4GPJ A;  5AMF A;  5CUC A;  5IG6 A;  5EWH A;  4C66 A;  3DAI A;  2OUO A;  2YEM A;  4LZ2 A;  5E9K A;  4F3I A;  5HQ5 A;  5EIS A;  5FE3 A;  5A5P A;  2L5E A;  4O7E A;  5DFD A;  3G0L A;  4LYI A;  5FE9 A;  4MEN A;  2YEK A;  4O76 A;  3NXB A;  4PS5 A;  3O36 A;  4BW2 A;  4QSP A;  3IU6 A;  5C8G A;  4IOO A;  4TT2 A;  5IID A;  2I7K A;  4YYJ A;  4KV4 A;  2G4A A;  4OGI A;  5L98 A;  4AI6 A;  1E6I A;  4Q0N A;  4TYL A;  4QSU A;  5FE0 A;  4NRC A;  3HMH A;  4NQM A;  4CFK A;  5E9Y A;  4WHW A;  5FE2 A;  4BW3 A;  4A9M A;  5HCL A;  4J1P A;  5G4S A;  5L99 A;  4YH3 A;  5IGM A;  5D3J A;  4FLP A;  4TZ8 A;  4YAD A;  4Z1Q A;  5EVA A;  3U5K A;  2N9G A;  2RFJ A;  4IR4 A;  3S91 A;  5CQT A;  5CRM A;  2NXB A;  3MB3 A;  3P1D A;  4KCX A;  3S92 A;  4BHW A;  4MR5 A;  5CQ4 A;  4YYI A;  5DKC A;  5I80 A;  4OGJ A;  5DYA A;  5CQ5 A;  5BT3 A;  5KHM A;  2MJV B;  2DAT A;  4O7F A;  4Y03 A;  5E74 A;  4O77 A;  3HMF A;  5LJ2 A;  5F2P A;  3O34 A;  4ALH A;  5EWD A;  5EIC A;  3LJW A;  4TT6 A;  5AD3 A;  4NR8 A;  4QNS A;  2FSA A;  4A9O A;  2GRC A;  5F3A A;  5LVQ A;  3VKH A;  4CUR A;  4PTB A;  3UV5 A;  3UVX A;  5LUU A;  4QSX A;  3SVG A;  4NYW A;  3AAD A;  4NQN A;  4NS5 A;  4LRG A;  5COI A;  4WIV A;  4QST A;  5HRX A;  4HXO A;  5EQ1 A;  4QC1 A;  5EPR A;  5LVR A;  4HXN A;  2R0S A;  4UIT A;  2F6N A;  4UIU A;  5ACY A;  4HBY A;  4NRB A;  3P1E A;  4NR5 A;  2RNY A;  5FB1 A;  5KU3 A;  5HJC A;  5DY7 A;  5HEN A;  5FH7 A;  4J0R A;  5ETD A;  4E96 A;  4IR6 A;  5ENJ A;  4NXJ A;  5ENI A;  3TLP A;  4XY9 A;  4O74 A;  5DFC A;  4UYF A;  5D3N A;  5CUA A;  3ZYU A;  4AKI A;  5HEM A; 
#chains in the Genus database with same CATH homology
 3U5P A;  5HQ7 A;  5DYX A;  5CQ7 A;  4O71 A;  4TU4 A;  5TCM A;  2E3K A;  5D3H A;  4YYK A;  5FH6 A;  5KTX A;  4HXS A;  3UVY A;  4Q0O A;  4YK0 A;  5KO4 A;  4ALG A;  4XUA A;  5I86 A;  5EPB A;  3JVM A;  3Q2E A;  5CZG A;  5ENE A;  4A9N A;  2YYN A;  5C4Q A;  5EGU A;  5DYU A;  4PKL A;  5EWW A;  4QSQ A;  3O35 A;  2E7O A;  5D3S A;  3DWY A;  5I7X A;  2RS9 B;  4UIV A;  1JSP B;  5FDZ A;  5FE7 A;  4O72 A;  4MR6 A;  5FE4 A;  4CFL A;  2L85 A;  5E9M A;  5HQ6 A;  4UYD A;  4QUT A;  5F36 A;  4N4F A;  2D9E A;  4XUB A;  4A9K A;  4YAX A;  4A9L A;  5G4R A;  4QEV A;  1JM4 B;  4NR4 A;  5E3D A;  2YQD A;  4LYW A;  4A9I A;  3QZS A;  1WUG A;  5IBN A;  3O37 A;  5A7C A;  2DKW A;  4QR5 A;  5I1Q A;  5KTW A;  2DWW A;  5DKD A;  3LXJ A;  4QEU A;  5K29 A;  4YYN A;  4UIW A;  4YYG A;  2I8N A;  4Z6I A;  3UW9 A;  4O7C A;  3IU5 A;  5CQ3 A;  5II2 A;  3MUK A;  4CLB A;  4YC9 A;  1ZS5 A;  4NRA A;  5FFY A;  4N4H A;  5E9I A;  4TS8 A;  3P1F A;  4IR5 A;  5HM0 A;  4HBW A;  5FG4 A;  3JVJ A;  5CUB A;  4O78 A;  3MUL A;  2YW5 A;  2E7N A;  5F5Z A;  5CQA A;  5L96 A;  5LKU A;  5D24 A;  4NR7 A;  5I7Y A;  4QB3 A;  2LSP B;  3O33 A;  5FB0 A;  3RCW A;  4TZ2 A;  3JVK A;  5CQ8 A;  5ETB A;  4MR4 A;  5CGP A;  3LQI A;  2RNX A;  4TTE A;  4NR9 A;  5EP7 A;  4ZQL A;  5D3L A;  1X0J A;  5D25 A;  5HRV A;  5F62 A;  5EPS A;  4N4G A;  2DVQ A;  4PCI A;  5CFW A;  4LZS A;  5FH8 A;  5LJ1 A;  5F61 A;  2R0V A;  4J0S A;  4LYS A;  5D3P A;  5L8U A;  5EK9 A;  2YEL A;  4IR3 A;  3G0J A;  3JVL A;  5FE6 A;  3MB4 A;  5D0C A;  5EI4 A;  4RVR A;  5FE5 A;  5JI8 A;  2KTB B;  5CS8 A;  3U5M A;  4NUE A;  4YYM A;  5F25 A;  4HBV A;  5EM3 A;  5JWM A;  5ENB A;  5L97 A;  4MEO A;  2RNW A;  4YAT A;  2F6J A;  2DVR A;  4HXK A;  5HRW A;  5II1 A;  4Z1S A;  5AME A;  5D7X A;  4QYD A;  4IOR A;  5DW1 A;  3P5O A;  1EQF A;  5DW2 A;  4YYH A;  5FBX A;  5A83 A;  4BW4 A;  3UVD A;  5LKX A;  2WP2 A;  3QZV A;  2R0Y A;  5E0R A;  4XY8 A;  2OSS A;  5CU8 A;  4QSV A;  4YBT A;  4NYV A;  5E9L A;  4CUQ A;  4BW1 A;  5DYC A;  5CY9 A;  4A9J A;  4O75 A;  5F60 A;  5I83 A;  5E73 A;  4BJX A;  5DKH A;  5J0D A;  5FG6 A;  1WUM A;  4HXM A;  5CQ6 A;  4LDF A;  5LJ0 A;  4NUD A;  5L8T A;  5F1H A;  1N72 A;  5CTL A;  5C85 A;  5BT5 A;  4WHU A;  2DVS A;  5DX4 A;  5FG5 A;  4HXP A;  5HLS A;  5EWC A;  5H1T A;  3U5J A;  5A81 A;  5TB6 A;  5DBM A;  4IOQ A;  5A82 A;  5AD2 A;  4O70 A;  4HXL A;  4O7B A;  4PY6 A;  4QY4 A;  5A5R A;  5LKZ A;  5H85 A;  5D3T A;  5ENG A;  5E3G A;  5IGN A;  2L84 A;  4KV1 A;  4NR6 A;  5I29 A;  5C87 A;  4QSR A;  4QSS A;  4QYL A;  2WP1 A;  4J3I A;  1F68 A;  4UIZ A;  4QBM A;  5HFR A;  5I40 A;  3HME A;  5F1L A;  5A5S A;  4ZW1 A;  5I89 A;  5DLX A;  5EV9 A;  5ENH A;  5F63 A;  4PCE A;  4NUC A;  4YBM A;  5CUD A;  3FKM X;  5CP5 A;  4CUT A;  4YYD A;  3GG3 A;  3K2J A;  5D3R A;  5HEL A;  4X2I A;  4O7A A;  3UV4 A;  2YDW A;  3UVW A;  4LR6 A;  4Z93 A;  4A9H A;  3AQA A;  4QZS A;  3MXF A;  4MR3 A;  4UYH A;  5LKT A;  4QR4 A;  5IGL A;  5CUG A;  5C7N A;  4AKN A;  3I3J A;  4OUF A;  4LC2 A;  3P1C A;  4UYF B;  5A85 A;  3LQH A;  4N4I A;  5A5O A;  4YY4 A;  4UIY A;  4YBS A;  5E7D A;  4QC3 A;  5CUE A;  5I88 A;  3Q2F A;  2RO1 A;  2H60 A;  4C67 A;  5DLZ A;  4DON A;  2OO1 A;  5KTU A;  4UYE A;  3MQM A;  4HBX A;  3LQJ A;  4NYX A;  4MEP A;  4QR3 A;  4YAB A;  5H1U A;  5BT4 A;  2D82 A;  5FFV A;  3SVF A;  4TT4 A;  3U5N A;  5D26 A;  4HXR A;  3ONI A;  2R10 A;  5HFQ A;  5A5N A;  4A9F A;  4QSW A;  4CL9 A;  4A9E A;  4LZR A;  5H1V A;  4CUU A;  5DFB A;  5ENF A;  5EA1 A;  3D7C A;  2RI7 A;  4TU6 A;  5CPE A;  3SVH A;  4ZC9 A;  4QEW A;  5FE1 A;  3UV2 A;  4UIX A;  5FE8 A;  5E9V A;  5EU1 A;  5C89 A;  5IGK A;  4N3W A;  4UYG A;  4YH4 A;  5EWV A;  4QUU A;  4MEQ A;  4Z6H A;  5A5Q A;  5CRZ A;  4YY6 A;  2DVV A;  3QZT A;  4CUP A;  3U5L A;  3U5O A;  5ENC A;  5FFW A;  4TQN A;  4CUS A;  4XYA A;  4GPJ A;  5AMF A;  5CUC A;  5IG6 A;  5EWH A;  4C66 A;  3DAI A;  2OUO A;  2YEM A;  4LZ2 A;  5E9K A;  4F3I A;  5HQ5 A;  5EIS A;  5FE3 A;  5A5P A;  2L5E A;  4O7E A;  5DFD A;  3G0L A;  4LYI A;  5FE9 A;  4MEN A;  2YEK A;  4O76 A;  3NXB A;  4PS5 A;  3O36 A;  4BW2 A;  4QSP A;  3IU6 A;  5C8G A;  4IOO A;  4TT2 A;  5IID A;  2I7K A;  4YYJ A;  4KV4 A;  2G4A A;  4OGI A;  5L98 A;  1E6I A;  4Q0N A;  4TYL A;  4QSU A;  5FE0 A;  4NRC A;  3HMH A;  4NQM A;  4CFK A;  5E9Y A;  4WHW A;  5FE2 A;  4BW3 A;  4A9M A;  5HCL A;  4J1P A;  5G4S A;  5L99 A;  4YH3 A;  5IGM A;  5D3J A;  4FLP A;  4TZ8 A;  4YAD A;  4Z1Q A;  5EVA A;  3U5K A;  2N9G A;  2RFJ A;  4IR4 A;  3S91 A;  5CQT A;  5CRM A;  2NXB A;  3MB3 A;  3P1D A;  4KCX A;  3S92 A;  4BHW A;  4MR5 A;  5CQ4 A;  4YYI A;  5DKC A;  5I80 A;  4OGJ A;  5DYA A;  5CQ5 A;  5BT3 A;  5KHM A;  2MJV B;  2DAT A;  4O7F A;  4Y03 A;  5E74 A;  4O77 A;  3HMF A;  5LJ2 A;  5F2P A;  3O34 A;  4ALH A;  5EWD A;  5EIC A;  3LJW A;  4TT6 A;  5AD3 A;  4NR8 A;  4QNS A;  2FSA A;  4A9O A;  2GRC A;  5F3A A;  5LVQ A;  4CUR A;  4PTB A;  3UV5 A;  3UVX A;  5LUU A;  4QSX A;  3SVG A;  4NYW A;  3AAD A;  4NQN A;  4NS5 A;  4LRG A;  5COI A;  4WIV A;  4QST A;  5HRX A;  4HXO A;  5EQ1 A;  4QC1 A;  5EPR A;  5LVR A;  4HXN A;  2R0S A;  4UIT A;  2F6N A;  4UIU A;  5ACY A;  4HBY A;  4NRB A;  3P1E A;  4NR5 A;  2RNY A;  5FB1 A;  5KU3 A;  5HJC A;  5DY7 A;  5HEN A;  5FH7 A;  4J0R A;  5ETD A;  4E96 A;  4IR6 A;  5ENJ A;  4NXJ A;  5ENI A;  3TLP A;  4XY9 A;  4O74 A;  5DFC A;  4UYF A;  5D3N A;  5CUA A;  3ZYU A;  5HEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...