5EPRA

Crystal structure of the human brpf1 bromodomain in complex with seed11
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5eprA00
5EWCA 5I7XA 4O74A 5E9LA 4LZ2A 3IU6A 4UIXA 3UV2A 5DBMA 4IR3A 4O7BA 4O72A 5FFYA 4XY9A 5D25A 4MR6A 4F3IA 4LRGA 4N4IA 5CFWA 3D7CA 2MJVB 4TS8A 5LKZA 5F5ZA 2WP2A 4NXJA 5E9YA 5FH6A 4WHWA 4NR8A 4AKNA 5D3JA 5CUAA 4CUPA 4CUQA 4PKLA 5BT3A 4UIYA 5DYAA 5E9KA 5F25A 4XYAA 5CUEA 5DFCA 5KU3A 4QSTA 5G4RA 5TCMA 5A5SA 4YYMA 5FBXA 5L8UA 2OO1A 5LJ1A 5EICA 4A9LA 5FFVA 3JVLA 5EQ1A 3P5OA 5E9VA 5AD3A 3P1EA 2RO1A 5EPRA 5KTUA 5E7DA 5HJCA 4NYVA 4TZ2A 5CUGA 4YH4A 5A5PA 4CFKA 4QNSA 4QYLA 4LC2A 4IR4A 4YYGA 2F6NA 4J0SA 4CUUA 4YBSA 3Q2EA 3ZYUA 4HBYA 3LQIA 5F2PA 3U5JA 5FH7A 2RNYA 5EVAA 3LJWA 5I29A 4HBVA 4QSQA 4O7CA 3MB3A 4TYLA 5ENIA 4Z93A 4Q0OA 4IR5A 3QZTA 5CGPA 5DYXA 4RVRA 4HXMA 5E74A 2YQDA 3MB4A 4YC9A 5CRZA 5AD2A 4N4HA 5II2A 3HMEA 4A9OA 4TU6A 4J0RA 4LZSA 4QR4A 4BW2A 2E7OA 5A82A 4MEPA 3O34A 5FE7A 5ENGA 5HEMA 4KV1A 4MEOA 4KV4A 2E7NA 4CL9A 5L99A 3I3JA 5HFQA 4NRBA 5F3AA 2YEMA 5DKDA 5C7NA 2D82A 5HQ5A 5D3TA 5ACYA 4BJXA 5CUBA 4HXLA 5HCLA 5HQ6A 2WP1A 4Z1SA 5EPSA 4HXKA 5DLZA 5CQ4A 4HXNA 5D3SA 5COIA 4QR3A 4N4FA 5ENJA 4O78A 4UITA 4LYSA 5I80A 5FFWA 4QSWA 2YEKA 4NUDA 1JM4B 4YH3A 4A9IA 2R0YA 3NXBA 2H60A 4Z6IA 3SVHA 5FE3A 4NR7A 4QUTA 2R10A 5HM0A 4UYDA 2E3KA 4WIVA 5EWWA 4BHWA 5D3NA 4YATA 2NXBA 4KCXA 4O77A 4QBMA 3QZSA 5FDZA 4DONA 4E96A 3G0JA 5E3DA 5ETBA 3MULA 4UYFB 5D3RA 5A5RA 5C4QA 5F1HA 2YDWA 5CQTA 5C85A 5A7CA 4O75A 5EV9A 5EWVA 5I40A 3GG3A 5CUCA 4QR5A 5CPEA 4A9KA 4Y03A 4CLBA 5DYCA 5C87A 2L84A 5F36A 4FLPA 4O70A 1WUMA 2LSPB 4J1PA 5I89A 5DW1A 3JVJA 5F63A 2YW5A 3LQJA 5K29A 3U5NA 4XUAA 4TT4A 4N3WA 4HXSA 3O35A 4NQMA 4UIWA 5EISA 3O36A 4NQNA 4YYNA 5IGMA 3K2JA 4WHUA 5EPBA 4A9MA 4UIVA 4TZ8A 5I88A 2RFJA 3U5OA 5FG4A 5IGKA 4LDFA 4NR9A 3Q2FA 5CU8A 4YYHA 5TB6A 4QSXA 5EGUA 4QC3A 2I7KA 5ENEA 5IG6A 2RS9B 5KHMA 5KTXA 1X0JA 4YYDA 5IIDA 3MXFA 4UYFA 3S91A 4OGJA 5I7YA 2DVVA 4BW1A 3G0LA 5CUDA 5EI4A 5H1VA 5FE4A 3TLPA 3S92A 4A9FA 4Z1QA 4QYDA 5CZGA 2FSAA 5L98A 5JWMA 5L96A 3ONIA 4IR6A 4BW3A 4YYJA 5AMFA 3SVGA 2D9EA 5J0DA 5EA1A 4UIZA 1JSPB 5H1TA 4NYXA 5F1LA 4CURA 4HXPA 5HLSA 5EU1A 4N4GA 5FE8A 5FB0A 2YELA 4MENA 5DFBA 5D24A 5E73A 4LR6A 5FE6A 4MEQA 4O7EA 5CY9A 5D0CA 4YK0A 5G4SA 4A9EA 4QSUA 5CQ8A 4HXRA 5D26A 4ZC9A 4YBTA 5F60A 5D3HA 4LYWA 5FE9A 4UYHA 2DATA 2I8NA 2L85A 4QEUA 4QSSA 4YADA 4HBXA 5I1QA 4QEVA 5EK9A 5D3LA 4QC1A 4HXOA 4OGIA 5LJ2A 5DFDA 4O76A 5L8TA 5LKXA 4LZRA 5DKHA 3AADA 2RNXA 5L97A 5LKUA 4QEWA 5DYUA 4IOOA 2RNWA 3P1FA 5CRMA 2RI7A 4BW4A 5HELA 4PS5A 5DLXA 4A9HA 1E6IA 4CUSA 3UW9A 4PCEA 5H85A 5DY7A 5LUUA 4NUEA 4PTBA 3MQMA 3MUKA 5EWHA 3UVWA 5E3GA 5D3PA 3DWYA 5FE1A 3U5KA 5I86A 3UVYA 3O37A 4TT6A 5C8GA 4O7AA 4CFLA 5CQ7A 4QY4A 2DVSA 5FG5A 4QB3A 5HRXA 5FB1A 4UYEA 4HBWA 4ALGA 3UV5A 4NR5A 3P1CA 4MR5A 3RCWA 3JVMA 4MR4A 4QSVA 3JVKA 4CUTA 4YABA 4ZW1A 2F6JA 5E0RA 3AQAA 5FH8A 3DAIA 4NRAA 5CQ3A 5IBNA 4UYGA 4IORA 4TQNA 5HRWA 3U5LA 2N9GA 2DVRA 4QZSA 5FE2A 3LXJA 3FKMX 5ETDA 4IOQA 4PY6A 4TT2A 4J3IA 3U5PA 3HMHA 5ENCA 2L5EA 5DKCA 5A81A 4YAXA 4ALHA 2OUOA 5CQ5A 5FE0A 5CTLA 4TU4A 5KO4A 5FG6A 2G4AA 3HMFA 4OUFA 4QSPA 5E9IA 4YY4A 3SVFA 5CQ6A 5H1UA 5EP7A 5FE5A 5C89A 2YYNA 5KTWA 4Q0NA 4YBMA 5LVQA 4PCIA 4NR6A 5A83A 4UIUA 2DWWA 5CP5A 5BT5A 5JI8A 4QUUA 5ENBA 3UV4A 4GPJA 4A9NA 4YYIA 2KTBB 5A5OA 5LJ0A 5LVRA 3U5MA 5LKTA 5F61A 5DX4A 2OSSA 4X2IA 5AMEA 5HFRA 1EQFA 4C66A 4XY8A 3UVDA 1F68A 5II1A 5BT4A 5I83A 4NS5A 5CS8A 5CQAA 4NRCA 5DW2A 5IGLA 4O71A 4YY6A 3QZVA 3UVXA 5A5QA 5EM3A 4XUBA 1N72A 3IU5A 5E9MA 4NYWA 5A85A 3LQHA 4NUCA 4C67A 2GRCA 5D7XA 4MR3A 4QSRA 5IGNA 3P1DA 2R0VA 4ZQLA 5A5NA 5HQ7A 4YYKA 4NR4A 4TTEA 5ENFA 5F62A 2DVQA 4O7FA 4A9JA 5ENHA 5HENA 2R0SA 4LYIA 5HRVA 2DKWA 1ZS5A 1WUGA 4Z6HA 5EWDA 3O33A
chains in the Genus database with same CATH superfamily
5EWCA 5I7XA 4O74A 5E9LA 4LZ2A 3IU6A 4UIXA 3UV2A 5DBMA 4IR3A 4O7BA 4O72A 5FFYA 4XY9A 5D25A 4MR6A 4F3IA 4LRGA 4N4IA 5CFWA 3D7CA 2MJVB 4TS8A 5LKZA 5F5ZA 3D1BA 2WP2A 4NXJA 5E9YA 5FH6A 4WHWA 4NR8A 4AKNA 5D3JA 5CUAA 4CUPA 1PUOA 4CUQA 4PKLA 5BT3A 4UIYA 5DYAA 5E9KA 5F25A 4XYAA 5CUEA 5DFCA 5KU3A 4QSTA 5G4RA 5TCMA 5A5SA 4YYMA 5FBXA 5L8UA 2OO1A 5LJ1A 5EICA 4A9LA 5FFVA 3JVLA 5EQ1A 3P5OA 5E9VA 5AD3A 3P1EA 2RO1A 5EPRA 5KTUA 5E7DA 5HJCA 4NYVA 4TZ2A 5CUGA 4YH4A 2EJNA 5A5PA 4CFKA 4QNSA 4QYLA 4LC2A 4IR4A 4YYGA 2F6NA 4J0SA 4CUUA 4YBSA 3Q2EA 3ZYUA 4HBYA 3LQIA 5F2PA 3U5JA 5FH7A 2RNYA 5EVAA 3LJWA 5I29A 4HBVA 4QSQA 4O7CA 3MB3A 4TYLA 5ENIA 4Z93A 4Q0OA 4IR5A 3QZTA 5CGPA 5DYXA 4RVRA 4HXMA 5E74A 2YQDA 3MB4A 4YC9A 5CRZA 5AD2A 4N4HA 5II2A 3HMEA 4A9OA 4TU6A 4J0RA 4LZSA 4QR4A 4BW2A 2E7OA 5A82A 4MEPA 3O34A 5FE7A 5ENGA 5HEMA 4KV1A 4MEOA 4KV4A 2E7NA 4CL9A 5L99A 4AKGA 3I3JA 5HFQA 4NRBA 5F3AA 2YEMA 5DKDA 5C7NA 2D82A 5HQ5A 5D3TA 5ACYA 4BJXA 5CUBA 4HXLA 5HCLA 3VKGA 5HQ6A 2WP1A 4Z1SA 5EPSA 4HXKA 5DLZA 5CQ4A 4HXNA 5D3SA 5COIA 4QR3A 4N4FA 5ENJA 4O78A 4UITA 4LYSA 5I80A 5FFWA 4QSWA 2YEKA 4NUDA 1JM4B 4YH3A 4A9IA 2R0YA 3NXBA 2H60A 4Z6IA 4AKHA 3SVHA 5FE3A 4NR7A 4QUTA 2R10A 5HM0A 4UYDA 2E3KA 4WIVA 5EWWA 4BHWA 5D3NA 4YATA 2NXBA 4KCXA 4O77A 4QBMA 3QZSA 5FDZA 4DONA 4E96A 3G0JA 5E3DA 5ETBA 3MULA 4UYFB 5D3RA 5A5RA 5C4QA 5F1HA 2YDWA 5CQTA 5C85A 5A7CA 4O75A 5EV9A 5EWVA 5I40A 3GG3A 5CUCA 4QR5A 5CPEA 4A9KA 4Y03A 4CLBA 5DYCA 5C87A 2L84A 5F36A 4FLPA 4O70A 1WUMA 2LSPB 4J1PA 5I89A 5DW1A 3JVJA 5F63A 2YW5A 3LQJA 5K29A 3U5NA 4XUAA 4TT4A 4N3WA 4HXSA 3O35A 4NQMA 4UIWA 5EISA 3O36A 4NQNA 4YYNA 5IGMA 3K2JA 4WHUA 5EPBA 4A9MA 4UIVA 4TZ8A 5I88A 2RFJA 3U5OA 5FG4A 5IGKA 4LDFA 4NR9A 3Q2FA 5CU8A 4YYHA 5TB6A 4QSXA 5EGUA 4QC3A 2I7KA 5ENEA 5IG6A 2RS9B 5KHMA 5KTXA 1X0JA 4YYDA 5IIDA 3MXFA 4UYFA 3S91A 4OGJA 5I7YA 2DVVA 4BW1A 3G0LA 5CUDA 5EI4A 5H1VA 5FE4A 3TLPA 3S92A 4A9FA 4Z1QA 4QYDA 5CZGA 2FSAA 5L98A 5JWMA 5L96A 3ONIA 4IR6A 4BW3A 4YYJA 5AMFA 3SVGA 2D9EA 5J0DA 5EA1A 4UIZA 1JSPB 5H1TA 4NYXA 5F1LA 4CURA 4HXPA 3ERRA 5HLSA 5EU1A 4N4GA 5FE8A 5FB0A 2YELA 4MENA 5DFBA 5D24A 5E73A 4LR6A 5FE6A 4MEQA 4O7EA 5CY9A 5D0CA 4YK0A 5G4SA 4A9EA 4QSUA 5CQ8A 4HXRA 5D26A 4ZC9A 4YBTA 5F60A 5D3HA 4LYWA 5FE9A 4UYHA 2DATA 2I8NA 2L85A 4QEUA 1ZKRA 4QSSA 4YADA 4HBXA 5I1QA 4QEVA 5EK9A 5D3LA 4QC1A 4HXOA 4OGIA 5LJ2A 5DFDA 4O76A 3VKHA 5L8TA 5LKXA 4LZRA 5DKHA 3AADA 2RNXA 5L97A 5LKUA 4QEWA 5DYUA 4IOOA 2RNWA 3P1FA 5CRMA 2RI7A 4BW4A 5HELA 4PS5A 5DLXA 4A9HA 1E6IA 4CUSA 3UW9A 4PCEA 5H85A 5DY7A 5LUUA 4NUEA 4PTBA 3MQMA 3MUKA 5EWHA 3UVWA 5E3GA 5D3PA 3DWYA 5FE1A 3U5KA 5I86A 3UVYA 3O37A 4TT6A 5C8GA 4O7AA 4CFLA 5CQ7A 4QY4A 2DVSA 5FG5A 4QB3A 5HRXA 5FB1A 4UYEA 4HBWA 4AKIA 4ALGA 3UV5A 4NR5A 3P1CA 4MR5A 3RCWA 3JVMA 4MR4A 4QSVA 3JVKA 4CUTA 4YABA 4ZW1A 2F6JA 5E0RA 3AQAA 5FH8A 3DAIA 4NRAA 5CQ3A 5IBNA 4UYGA 4IORA 4TQNA 5HRWA 3U5LA 2N9GA 2DVRA 4QZSA 5FE2A 3LXJA 3FKMX 5ETDA 4IOQA 4PY6A 4TT2A 4J3IA 3U5PA 3HMHA 5ENCA 2L5EA 5DKCA 5A81A 4YAXA 4ALHA 2OUOA 5CQ5A 5FE0A 5CTLA 4TU4A 5KO4A 5FG6A 2G4AA 3HMFA 4OUFA 4QSPA 5E9IA 4YY4A 3SVFA 5CQ6A 5H1UA 5EP7A 5FE5A 5C89A 2YYNA 5KTWA 4Q0NA 4YBMA 5LVQA 4PCIA 4NR6A 5A83A 4UIUA 2DWWA 5CP5A 5BT5A 5JI8A 4QUUA 5ENBA 3UV4A 4GPJA 4A9NA 4YYIA 2KTBB 5A5OA 5LJ0A 5LVRA 3U5MA 5LKTA 5F61A 5DX4A 2OSSA 4X2IA 5AMEA 5HFRA 4AI6A 1EQFA 4C66A 4XY8A 3UVDA 1F68A 5II1A 5BT4A 5I83A 4NS5A 5CS8A 5CQAA 4NRCA 5DW2A 5IGLA 4O71A 4YY6A 3QZVA 3UVXA 5A5QA 5EM3A 4XUBA 1N72A 3IU5A 5E9MA 4NYWA 5A85A 3LQHA 4NUCA 4C67A 2GRCA 5D7XA 4MR3A 4QSRA 5IGNA 3P1DA 2R0VA 4ZQLA 5A5NA 5HQ7A 4YYKA 3D1DA 4NR4A 4TTEA 5ENFA 5F62A 2DVQA 4O7FA 4A9JA 5ENHA 5HENA 2R0SA 4LYIA 5HRVA 2DKWA 1ZS5A 1WUGA 4Z6HA 5EWDA 3O33A
chains in the Genus database with same CATH topology
5EWCA 5I7XA 4O74A 5E9LA 4LZ2A 3IU6A 4UIXA 3UV2A 5DBMA 4IR3A 4O7BA 4O72A 5FFYA 4XY9A 5D25A 4MR6A 4F3IA 4LRGA 4N4IA 5CFWA 3D7CA 2MJVB 4TS8A 5LKZA 5F5ZA 2WP2A 4NXJA 5E9YA 5FH6A 4WHWA 4NR8A 4AKNA 5D3JA 5CUAA 4CUPA 4CUQA 4PKLA 5BT3A 4UIYA 5DYAA 5E9KA 5F25A 4XYAA 5CUEA 5DFCA 5KU3A 4QSTA 5G4RA 5TCMA 5A5SA 4YYMA 5FBXA 5L8UA 2OO1A 5LJ1A 5EICA 4A9LA 5FFVA 3JVLA 5EQ1A 3P5OA 5E9VA 5AD3A 3P1EA 2RO1A 5EPRA 5KTUA 5E7DA 5HJCA 4NYVA 4TZ2A 5CUGA 4YH4A 5A5PA 4CFKA 4QNSA 4QYLA 4LC2A 4IR4A 4YYGA 2F6NA 4J0SA 4CUUA 4YBSA 3Q2EA 3ZYUA 4HBYA 3LQIA 5F2PA 3U5JA 5FH7A 2RNYA 5EVAA 3LJWA 5I29A 4HBVA 4QSQA 4O7CA 3MB3A 4TYLA 5ENIA 4Z93A 4Q0OA 4IR5A 3QZTA 5CGPA 5DYXA 4RVRA 4HXMA 5E74A 2YQDA 3MB4A 4YC9A 5CRZA 5AD2A 4N4HA 5II2A 3HMEA 4A9OA 4TU6A 4J0RA 4LZSA 4QR4A 4BW2A 2E7OA 5A82A 4MEPA 3O34A 5FE7A 5ENGA 5HEMA 4KV1A 4MEOA 4KV4A 2E7NA 4CL9A 5L99A 3I3JA 5HFQA 4NRBA 5F3AA 2YEMA 5DKDA 5C7NA 2D82A 5HQ5A 5D3TA 5ACYA 4BJXA 5CUBA 4HXLA 5HCLA 5HQ6A 2WP1A 4Z1SA 5EPSA 4HXKA 5DLZA 5CQ4A 4HXNA 5D3SA 5COIA 4QR3A 4N4FA 5ENJA 4O78A 4UITA 4LYSA 5I80A 5FFWA 4QSWA 2YEKA 4NUDA 1JM4B 4YH3A 4A9IA 2R0YA 3NXBA 2H60A 4Z6IA 3SVHA 5FE3A 4NR7A 4QUTA 2R10A 5HM0A 4UYDA 2E3KA 4WIVA 5EWWA 4BHWA 5D3NA 4YATA 2NXBA 4KCXA 4O77A 4QBMA 3QZSA 5FDZA 4DONA 4E96A 3G0JA 5E3DA 5ETBA 3MULA 4UYFB 5D3RA 5A5RA 5C4QA 5F1HA 2YDWA 5CQTA 5C85A 5A7CA 4O75A 5EV9A 5EWVA 5I40A 3GG3A 5CUCA 4QR5A 5CPEA 4A9KA 4Y03A 4CLBA 5DYCA 5C87A 2L84A 5F36A 4FLPA 4O70A 1WUMA 2LSPB 4J1PA 5I89A 5DW1A 3JVJA 5F63A 2YW5A 3LQJA 5K29A 3U5NA 4XUAA 4TT4A 4N3WA 4HXSA 3O35A 4NQMA 4UIWA 5EISA 3O36A 4NQNA 4YYNA 5IGMA 3K2JA 4WHUA 5EPBA 4A9MA 4UIVA 4TZ8A 5I88A 2RFJA 3U5OA 5FG4A 5IGKA 4LDFA 4NR9A 3Q2FA 5CU8A 4YYHA 5TB6A 4QSXA 5EGUA 4QC3A 2I7KA 5ENEA 5IG6A 2RS9B 5KHMA 5KTXA 1X0JA 4YYDA 5IIDA 3MXFA 4UYFA 3S91A 4OGJA 5I7YA 2DVVA 4BW1A 3G0LA 5CUDA 5EI4A 5H1VA 5FE4A 3TLPA 3S92A 4A9FA 4Z1QA 4QYDA 5CZGA 2FSAA 5L98A 5JWMA 5L96A 3ONIA 4IR6A 4BW3A 4YYJA 5AMFA 3SVGA 2D9EA 5J0DA 5EA1A 4UIZA 1JSPB 5H1TA 4NYXA 5F1LA 4CURA 4HXPA 5HLSA 5EU1A 4N4GA 5FE8A 5FB0A 2YELA 4MENA 5DFBA 5D24A 5E73A 4LR6A 5FE6A 4MEQA 4O7EA 5CY9A 5D0CA 4YK0A 5G4SA 4A9EA 4QSUA 5CQ8A 4HXRA 5D26A 4ZC9A 4YBTA 5F60A 5D3HA 4LYWA 5FE9A 4UYHA 2DATA 2I8NA 2L85A 4QEUA 4QSSA 4YADA 4HBXA 5I1QA 4QEVA 5EK9A 5D3LA 4QC1A 4HXOA 4OGIA 5LJ2A 5DFDA 4O76A 5L8TA 5LKXA 4LZRA 5DKHA 3AADA 2RNXA 5L97A 5LKUA 4QEWA 5DYUA 4IOOA 2RNWA 3P1FA 5CRMA 2RI7A 4BW4A 5HELA 4PS5A 5DLXA 4A9HA 1E6IA 4CUSA 3UW9A 4PCEA 5H85A 5DY7A 5LUUA 4NUEA 4PTBA 3MQMA 3MUKA 5EWHA 3UVWA 5E3GA 5D3PA 3DWYA 5FE1A 3U5KA 5I86A 3UVYA 3O37A 4TT6A 5C8GA 4O7AA 4CFLA 5CQ7A 4QY4A 2DVSA 5FG5A 4QB3A 5HRXA 5FB1A 4UYEA 4HBWA 4ALGA 3UV5A 4NR5A 3P1CA 4MR5A 3RCWA 3JVMA 4MR4A 4QSVA 3JVKA 4CUTA 4YABA 4ZW1A 2F6JA 5E0RA 3AQAA 5FH8A 3DAIA 4NRAA 5CQ3A 5IBNA 4UYGA 4IORA 4TQNA 5HRWA 3U5LA 2N9GA 2DVRA 4QZSA 5FE2A 3LXJA 3FKMX 5ETDA 4IOQA 4PY6A 4TT2A 4J3IA 3U5PA 3HMHA 5ENCA 2L5EA 5DKCA 5A81A 4YAXA 4ALHA 2OUOA 5CQ5A 5FE0A 5CTLA 4TU4A 5KO4A 5FG6A 2G4AA 3HMFA 4OUFA 4QSPA 5E9IA 4YY4A 3SVFA 5CQ6A 5H1UA 5EP7A 5FE5A 5C89A 2YYNA 5KTWA 4Q0NA 4YBMA 5LVQA 4PCIA 4NR6A 5A83A 4UIUA 2DWWA 5CP5A 5BT5A 5JI8A 4QUUA 5ENBA 3UV4A 4GPJA 4A9NA 4YYIA 2KTBB 5A5OA 5LJ0A 5LVRA 3U5MA 5LKTA 5F61A 5DX4A 2OSSA 4X2IA 5AMEA 5HFRA 1EQFA 4C66A 4XY8A 3UVDA 1F68A 5II1A 5BT4A 5I83A 4NS5A 5CS8A 5CQAA 4NRCA 5DW2A 5IGLA 4O71A 4YY6A 3QZVA 3UVXA 5A5QA 5EM3A 4XUBA 1N72A 3IU5A 5E9MA 4NYWA 5A85A 3LQHA 4NUCA 4C67A 2GRCA 5D7XA 4MR3A 4QSRA 5IGNA 3P1DA 2R0VA 4ZQLA 5A5NA 5HQ7A 4YYKA 4NR4A 4TTEA 5ENFA 5F62A 2DVQA 4O7FA 4A9JA 5ENHA 5HENA 2R0SA 4LYIA 5HRVA 2DKWA 1ZS5A 1WUGA 4Z6HA 5EWDA 3O33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWC A;  5I7X A;  4O74 A;  5E9L A;  4LZ2 A;  3IU6 A;  4UIX A;  3UV2 A;  5DBM A;  4IR3 A;  4O7B A;  4O72 A;  5FFY A;  4XY9 A;  5D25 A;  4MR6 A;  4F3I A;  4LRG A;  4N4I A;  5CFW A;  3D7C A;  2MJV B;  4TS8 A;  5LKZ A;  5F5Z A;  2WP2 A;  4NXJ A;  5E9Y A;  5FH6 A;  4WHW A;  4NR8 A;  4AKN A;  5D3J A;  5CUA A;  4CUP A;  4CUQ A;  4PKL A;  5BT3 A;  4UIY A;  5DYA A;  5E9K A;  5F25 A;  4XYA A;  5CUE A;  5DFC A;  5KU3 A;  4QST A;  5G4R A;  5TCM A;  5A5S A;  4YYM A;  5FBX A;  5L8U A;  2OO1 A;  5LJ1 A;  5EIC A;  4A9L A;  5FFV A;  3JVL A;  5EQ1 A;  3P5O A;  5E9V A;  5AD3 A;  3P1E A;  2RO1 A;  5EPR A;  5KTU A;  5E7D A;  5HJC A;  4NYV A;  4TZ2 A;  5CUG A;  4YH4 A;  5A5P A;  4CFK A;  4QNS A;  4QYL A;  4LC2 A;  4IR4 A;  4YYG A;  2F6N A;  4J0S A;  4CUU A;  4YBS A;  3Q2E A;  3ZYU A;  4HBY A;  3LQI A;  5F2P A;  3U5J A;  5FH7 A;  2RNY A;  5EVA A;  3LJW A;  5I29 A;  4HBV A;  4QSQ A;  4O7C A;  3MB3 A;  4TYL A;  5ENI A;  4Z93 A;  4Q0O A;  4IR5 A;  3QZT A;  5CGP A;  5DYX A;  4RVR A;  4HXM A;  5E74 A;  2YQD A;  3MB4 A;  4YC9 A;  5CRZ A;  5AD2 A;  4N4H A;  5II2 A;  3HME A;  4A9O A;  4TU6 A;  4J0R A;  4LZS A;  4QR4 A;  4BW2 A;  2E7O A;  5A82 A;  4MEP A;  3O34 A;  5FE7 A;  5ENG A;  5HEM A;  4KV1 A;  4MEO A;  4KV4 A;  2E7N A;  4CL9 A;  5L99 A;  3I3J A;  5HFQ A;  4NRB A;  5F3A A;  2YEM A;  5DKD A;  5C7N A;  2D82 A;  5HQ5 A;  5D3T A;  5ACY A;  4BJX A;  5CUB A;  4HXL A;  5HCL A;  5HQ6 A;  2WP1 A;  4Z1S A;  5EPS A;  4HXK A;  5DLZ A;  5CQ4 A;  4HXN A;  5D3S A;  5COI A;  4QR3 A;  4N4F A;  5ENJ A;  4O78 A;  4UIT A;  4LYS A;  5I80 A;  5FFW A;  4QSW A;  2YEK A;  4NUD A;  1JM4 B;  4YH3 A;  4A9I A;  2R0Y A;  3NXB A;  2H60 A;  4Z6I A;  3SVH A;  5FE3 A;  4NR7 A;  4QUT A;  2R10 A;  5HM0 A;  4UYD A;  2E3K A;  4WIV A;  5EWW A;  4BHW A;  5D3N A;  4YAT A;  2NXB A;  4KCX A;  4O77 A;  4QBM A;  3QZS A;  5FDZ A;  4DON A;  4E96 A;  3G0J A;  5E3D A;  5ETB A;  3MUL A;  4UYF B;  5D3R A;  5A5R A;  5C4Q A;  5F1H A;  2YDW A;  5CQT A;  5C85 A;  5A7C A;  4O75 A;  5EV9 A;  5EWV A;  5I40 A;  3GG3 A;  5CUC A;  4QR5 A;  5CPE A;  4A9K A;  4Y03 A;  4CLB A;  5DYC A;  5C87 A;  2L84 A;  5F36 A;  4FLP A;  4O70 A;  1WUM A;  2LSP B;  4J1P A;  5I89 A;  5DW1 A;  3JVJ A;  5F63 A;  2YW5 A;  3LQJ A;  5K29 A;  3U5N A;  4XUA A;  4TT4 A;  4N3W A;  4HXS A;  3O35 A;  4NQM A;  4UIW A;  5EIS A;  3O36 A;  4NQN A;  4YYN A;  5IGM A;  3K2J A;  4WHU A;  5EPB A;  4A9M A;  4UIV A;  4TZ8 A;  5I88 A;  2RFJ A;  3U5O A;  5FG4 A;  5IGK A;  4LDF A;  4NR9 A;  3Q2F A;  5CU8 A;  4YYH A;  5TB6 A;  4QSX A;  5EGU A;  4QC3 A;  2I7K A;  5ENE A;  5IG6 A;  2RS9 B;  5KHM A;  5KTX A;  1X0J A;  4YYD A;  5IID A;  3MXF A;  4UYF A;  3S91 A;  4OGJ A;  5I7Y A;  2DVV A;  4BW1 A;  3G0L A;  5CUD A;  5EI4 A;  5H1V A;  5FE4 A;  3TLP A;  3S92 A;  4A9F A;  4Z1Q A;  4QYD A;  5CZG A;  2FSA A;  5L98 A;  5JWM A;  5L96 A;  3ONI A;  4IR6 A;  4BW3 A;  4YYJ A;  5AMF A;  3SVG A;  2D9E A;  5J0D A;  5EA1 A;  4UIZ A;  1JSP B;  5H1T A;  4NYX A;  5F1L A;  4CUR A;  4HXP A;  5HLS A;  5EU1 A;  4N4G A;  5FE8 A;  5FB0 A;  2YEL A;  4MEN A;  5DFB A;  5D24 A;  5E73 A;  4LR6 A;  5FE6 A;  4MEQ A;  4O7E A;  5CY9 A;  5D0C A;  4YK0 A;  5G4S A;  4A9E A;  4QSU A;  5CQ8 A;  4HXR A;  5D26 A;  4ZC9 A;  4YBT A;  5F60 A;  5D3H A;  4LYW A;  5FE9 A;  4UYH A;  2DAT A;  2I8N A;  2L85 A;  4QEU A;  4QSS A;  4YAD A;  4HBX A;  5I1Q A;  4QEV A;  5EK9 A;  5D3L A;  4QC1 A;  4HXO A;  4OGI A;  5LJ2 A;  5DFD A;  4O76 A;  5L8T A;  5LKX A;  4LZR A;  5DKH A;  3AAD A;  2RNX A;  5L97 A;  5LKU A;  4QEW A;  5DYU A;  4IOO A;  2RNW A;  3P1F A;  5CRM A;  2RI7 A;  4BW4 A;  5HEL A;  4PS5 A;  5DLX A;  4A9H A;  1E6I A;  4CUS A;  3UW9 A;  4PCE A;  5H85 A;  5DY7 A;  5LUU A;  4NUE A;  4PTB A;  3MQM A;  3MUK A;  5EWH A;  3UVW A;  5E3G A;  5D3P A;  3DWY A;  5FE1 A;  3U5K A;  5I86 A;  3UVY A;  3O37 A;  4TT6 A;  5C8G A;  4O7A A;  4CFL A;  5CQ7 A;  4QY4 A;  2DVS A;  5FG5 A;  4QB3 A;  5HRX A;  5FB1 A;  4UYE A;  4HBW A;  4ALG A;  3UV5 A;  4NR5 A;  3P1C A;  4MR5 A;  3RCW A;  3JVM A;  4MR4 A;  4QSV A;  3JVK A;  4CUT A;  4YAB A;  4ZW1 A;  2F6J A;  5E0R A;  3AQA A;  5FH8 A;  3DAI A;  4NRA A;  5CQ3 A;  5IBN A;  4UYG A;  4IOR A;  4TQN A;  5HRW A;  3U5L A;  2N9G A;  2DVR A;  4QZS A;  5FE2 A;  3LXJ A;  3FKM X;  5ETD A;  4IOQ A;  4PY6 A;  4TT2 A;  4J3I A;  3U5P A;  3HMH A;  5ENC A;  2L5E A;  5DKC A;  5A81 A;  4YAX A;  4ALH A;  2OUO A;  5CQ5 A;  5FE0 A;  5CTL A;  4TU4 A;  5KO4 A;  5FG6 A;  2G4A A;  3HMF A;  4OUF A;  4QSP A;  5E9I A;  4YY4 A;  3SVF A;  5CQ6 A;  5H1U A;  5EP7 A;  5FE5 A;  5C89 A;  2YYN A;  5KTW A;  4Q0N A;  4YBM A;  5LVQ A;  4PCI A;  4NR6 A;  5A83 A;  4UIU A;  2DWW A;  5CP5 A;  5BT5 A;  5JI8 A;  4QUU A;  5ENB A;  3UV4 A;  4GPJ A;  4A9N A;  4YYI A;  2KTB B;  5A5O A;  5LJ0 A;  5LVR A;  3U5M A;  5LKT A;  5F61 A;  5DX4 A;  2OSS A;  4X2I A;  5AME A;  5HFR A;  1EQF A;  4C66 A;  4XY8 A;  3UVD A;  1F68 A;  5II1 A;  5BT4 A;  5I83 A;  4NS5 A;  5CS8 A;  5CQA A;  4NRC A;  5DW2 A;  5IGL A;  4O71 A;  4YY6 A;  3QZV A;  3UVX A;  5A5Q A;  5EM3 A;  4XUB A;  1N72 A;  3IU5 A;  5E9M A;  4NYW A;  5A85 A;  3LQH A;  4NUC A;  4C67 A;  2GRC A;  5D7X A;  4MR3 A;  4QSR A;  5IGN A;  3P1D A;  2R0V A;  4ZQL A;  5A5N A;  5HQ7 A;  4YYK A;  4NR4 A;  4TTE A;  5ENF A;  5F62 A;  2DVQ A;  4O7F A;  4A9J A;  5ENH A;  5HEN A;  2R0S A;  4LYI A;  5HRV A;  2DKW A;  1ZS5 A;  1WUG A;  4Z6H A;  5EWD A;  3O33 A; 
#chains in the Genus database with same CATH topology
 5EWC A;  5I7X A;  4O74 A;  5E9L A;  4LZ2 A;  3IU6 A;  4UIX A;  3UV2 A;  5DBM A;  4IR3 A;  4O7B A;  4O72 A;  5FFY A;  4XY9 A;  5D25 A;  4MR6 A;  4F3I A;  4LRG A;  4N4I A;  5CFW A;  3D7C A;  2MJV B;  4TS8 A;  5LKZ A;  5F5Z A;  3D1B A;  2WP2 A;  4NXJ A;  5E9Y A;  5FH6 A;  4WHW A;  4NR8 A;  4AKN A;  5D3J A;  5CUA A;  4CUP A;  1PUO A;  4CUQ A;  4PKL A;  5BT3 A;  4UIY A;  5DYA A;  5E9K A;  5F25 A;  4XYA A;  5CUE A;  5DFC A;  5KU3 A;  4QST A;  5G4R A;  5TCM A;  5A5S A;  4YYM A;  5FBX A;  5L8U A;  2OO1 A;  5LJ1 A;  5EIC A;  4A9L A;  5FFV A;  3JVL A;  5EQ1 A;  3P5O A;  5E9V A;  5AD3 A;  3P1E A;  2RO1 A;  5EPR A;  5KTU A;  5E7D A;  5HJC A;  4NYV A;  4TZ2 A;  5CUG A;  4YH4 A;  2EJN A;  5A5P A;  4CFK A;  4QNS A;  4QYL A;  4LC2 A;  4IR4 A;  4YYG A;  2F6N A;  4J0S A;  4CUU A;  4YBS A;  3Q2E A;  3ZYU A;  4HBY A;  3LQI A;  5F2P A;  3U5J A;  5FH7 A;  2RNY A;  5EVA A;  3LJW A;  5I29 A;  4HBV A;  4QSQ A;  4O7C A;  3MB3 A;  4TYL A;  5ENI A;  4Z93 A;  4Q0O A;  4IR5 A;  3QZT A;  5CGP A;  5DYX A;  4RVR A;  4HXM A;  5E74 A;  2YQD A;  3MB4 A;  4YC9 A;  5CRZ A;  5AD2 A;  4N4H A;  5II2 A;  3HME A;  4A9O A;  4TU6 A;  4J0R A;  4LZS A;  4QR4 A;  4BW2 A;  2E7O A;  5A82 A;  4MEP A;  3O34 A;  5FE7 A;  5ENG A;  5HEM A;  4KV1 A;  4MEO A;  4KV4 A;  2E7N A;  4CL9 A;  5L99 A;  4AKG A;  3I3J A;  5HFQ A;  4NRB A;  5F3A A;  2YEM A;  5DKD A;  5C7N A;  2D82 A;  5HQ5 A;  5D3T A;  5ACY A;  4BJX A;  5CUB A;  4HXL A;  5HCL A;  3VKG A;  5HQ6 A;  2WP1 A;  4Z1S A;  5EPS A;  4HXK A;  5DLZ A;  5CQ4 A;  4HXN A;  5D3S A;  5COI A;  4QR3 A;  4N4F A;  5ENJ A;  4O78 A;  4UIT A;  4LYS A;  5I80 A;  5FFW A;  4QSW A;  2YEK A;  4NUD A;  1JM4 B;  4YH3 A;  4A9I A;  2R0Y A;  3NXB A;  2H60 A;  4Z6I A;  4AKH A;  3SVH A;  5FE3 A;  4NR7 A;  4QUT A;  2R10 A;  5HM0 A;  4UYD A;  2E3K A;  4WIV A;  5EWW A;  4BHW A;  5D3N A;  4YAT A;  2NXB A;  4KCX A;  4O77 A;  4QBM A;  3QZS A;  5FDZ A;  4DON A;  4E96 A;  3G0J A;  5E3D A;  5ETB A;  3MUL A;  4UYF B;  5D3R A;  5A5R A;  5C4Q A;  5F1H A;  2YDW A;  5CQT A;  5C85 A;  5A7C A;  4O75 A;  5EV9 A;  5EWV A;  5I40 A;  3GG3 A;  5CUC A;  4QR5 A;  5CPE A;  4A9K A;  4Y03 A;  4CLB A;  5DYC A;  5C87 A;  2L84 A;  5F36 A;  4FLP A;  4O70 A;  1WUM A;  2LSP B;  4J1P A;  5I89 A;  5DW1 A;  3JVJ A;  5F63 A;  2YW5 A;  3LQJ A;  5K29 A;  3U5N A;  4XUA A;  4TT4 A;  4N3W A;  4HXS A;  3O35 A;  4NQM A;  4UIW A;  5EIS A;  3O36 A;  4NQN A;  4YYN A;  5IGM A;  3K2J A;  4WHU A;  5EPB A;  4A9M A;  4UIV A;  4TZ8 A;  5I88 A;  2RFJ A;  3U5O A;  5FG4 A;  5IGK A;  4LDF A;  4NR9 A;  3Q2F A;  5CU8 A;  4YYH A;  5TB6 A;  4QSX A;  5EGU A;  4QC3 A;  2I7K A;  5ENE A;  5IG6 A;  2RS9 B;  5KHM A;  5KTX A;  1X0J A;  4YYD A;  5IID A;  3MXF A;  4UYF A;  3S91 A;  4OGJ A;  5I7Y A;  2DVV A;  4BW1 A;  3G0L A;  5CUD A;  5EI4 A;  5H1V A;  5FE4 A;  3TLP A;  3S92 A;  4A9F A;  4Z1Q A;  4QYD A;  5CZG A;  2FSA A;  5L98 A;  5JWM A;  5L96 A;  3ONI A;  4IR6 A;  4BW3 A;  4YYJ A;  5AMF A;  3SVG A;  2D9E A;  5J0D A;  5EA1 A;  4UIZ A;  1JSP B;  5H1T A;  4NYX A;  5F1L A;  4CUR A;  4HXP A;  3ERR A;  5HLS A;  5EU1 A;  4N4G A;  5FE8 A;  5FB0 A;  2YEL A;  4MEN A;  5DFB A;  5D24 A;  5E73 A;  4LR6 A;  5FE6 A;  4MEQ A;  4O7E A;  5CY9 A;  5D0C A;  4YK0 A;  5G4S A;  4A9E A;  4QSU A;  5CQ8 A;  4HXR A;  5D26 A;  4ZC9 A;  4YBT A;  5F60 A;  5D3H A;  4LYW A;  5FE9 A;  4UYH A;  2DAT A;  2I8N A;  2L85 A;  4QEU A;  1ZKR A;  4QSS A;  4YAD A;  4HBX A;  5I1Q A;  4QEV A;  5EK9 A;  5D3L A;  4QC1 A;  4HXO A;  4OGI A;  5LJ2 A;  5DFD A;  4O76 A;  3VKH A;  5L8T A;  5LKX A;  4LZR A;  5DKH A;  3AAD A;  2RNX A;  5L97 A;  5LKU A;  4QEW A;  5DYU A;  4IOO A;  2RNW A;  3P1F A;  5CRM A;  2RI7 A;  4BW4 A;  5HEL A;  4PS5 A;  5DLX A;  4A9H A;  1E6I A;  4CUS A;  3UW9 A;  4PCE A;  5H85 A;  5DY7 A;  5LUU A;  4NUE A;  4PTB A;  3MQM A;  3MUK A;  5EWH A;  3UVW A;  5E3G A;  5D3P A;  3DWY A;  5FE1 A;  3U5K A;  5I86 A;  3UVY A;  3O37 A;  4TT6 A;  5C8G A;  4O7A A;  4CFL A;  5CQ7 A;  4QY4 A;  2DVS A;  5FG5 A;  4QB3 A;  5HRX A;  5FB1 A;  4UYE A;  4HBW A;  4AKI A;  4ALG A;  3UV5 A;  4NR5 A;  3P1C A;  4MR5 A;  3RCW A;  3JVM A;  4MR4 A;  4QSV A;  3JVK A;  4CUT A;  4YAB A;  4ZW1 A;  2F6J A;  5E0R A;  3AQA A;  5FH8 A;  3DAI A;  4NRA A;  5CQ3 A;  5IBN A;  4UYG A;  4IOR A;  4TQN A;  5HRW A;  3U5L A;  2N9G A;  2DVR A;  4QZS A;  5FE2 A;  3LXJ A;  3FKM X;  5ETD A;  4IOQ A;  4PY6 A;  4TT2 A;  4J3I A;  3U5P A;  3HMH A;  5ENC A;  2L5E A;  5DKC A;  5A81 A;  4YAX A;  4ALH A;  2OUO A;  5CQ5 A;  5FE0 A;  5CTL A;  4TU4 A;  5KO4 A;  5FG6 A;  2G4A A;  3HMF A;  4OUF A;  4QSP A;  5E9I A;  4YY4 A;  3SVF A;  5CQ6 A;  5H1U A;  5EP7 A;  5FE5 A;  5C89 A;  2YYN A;  5KTW A;  4Q0N A;  4YBM A;  5LVQ A;  4PCI A;  4NR6 A;  5A83 A;  4UIU A;  2DWW A;  5CP5 A;  5BT5 A;  5JI8 A;  4QUU A;  5ENB A;  3UV4 A;  4GPJ A;  4A9N A;  4YYI A;  2KTB B;  5A5O A;  5LJ0 A;  5LVR A;  3U5M A;  5LKT A;  5F61 A;  5DX4 A;  2OSS A;  4X2I A;  5AME A;  5HFR A;  4AI6 A;  1EQF A;  4C66 A;  4XY8 A;  3UVD A;  1F68 A;  5II1 A;  5BT4 A;  5I83 A;  4NS5 A;  5CS8 A;  5CQA A;  4NRC A;  5DW2 A;  5IGL A;  4O71 A;  4YY6 A;  3QZV A;  3UVX A;  5A5Q A;  5EM3 A;  4XUB A;  1N72 A;  3IU5 A;  5E9M A;  4NYW A;  5A85 A;  3LQH A;  4NUC A;  4C67 A;  2GRC A;  5D7X A;  4MR3 A;  4QSR A;  5IGN A;  3P1D A;  2R0V A;  4ZQL A;  5A5N A;  5HQ7 A;  4YYK A;  3D1D A;  4NR4 A;  4TTE A;  5ENF A;  5F62 A;  2DVQ A;  4O7F A;  4A9J A;  5ENH A;  5HEN A;  2R0S A;  4LYI A;  5HRV A;  2DKW A;  1ZS5 A;  1WUG A;  4Z6H A;  5EWD A;  3O33 A; 
#chains in the Genus database with same CATH homology
 5EWC A;  5I7X A;  4O74 A;  5E9L A;  4LZ2 A;  3IU6 A;  4UIX A;  3UV2 A;  5DBM A;  4IR3 A;  4O7B A;  4O72 A;  5FFY A;  4XY9 A;  5D25 A;  4MR6 A;  4F3I A;  4LRG A;  4N4I A;  5CFW A;  3D7C A;  2MJV B;  4TS8 A;  5LKZ A;  5F5Z A;  2WP2 A;  4NXJ A;  5E9Y A;  5FH6 A;  4WHW A;  4NR8 A;  4AKN A;  5D3J A;  5CUA A;  4CUP A;  4CUQ A;  4PKL A;  5BT3 A;  4UIY A;  5DYA A;  5E9K A;  5F25 A;  4XYA A;  5CUE A;  5DFC A;  5KU3 A;  4QST A;  5G4R A;  5TCM A;  5A5S A;  4YYM A;  5FBX A;  5L8U A;  2OO1 A;  5LJ1 A;  5EIC A;  4A9L A;  5FFV A;  3JVL A;  5EQ1 A;  3P5O A;  5E9V A;  5AD3 A;  3P1E A;  2RO1 A;  5EPR A;  5KTU A;  5E7D A;  5HJC A;  4NYV A;  4TZ2 A;  5CUG A;  4YH4 A;  5A5P A;  4CFK A;  4QNS A;  4QYL A;  4LC2 A;  4IR4 A;  4YYG A;  2F6N A;  4J0S A;  4CUU A;  4YBS A;  3Q2E A;  3ZYU A;  4HBY A;  3LQI A;  5F2P A;  3U5J A;  5FH7 A;  2RNY A;  5EVA A;  3LJW A;  5I29 A;  4HBV A;  4QSQ A;  4O7C A;  3MB3 A;  4TYL A;  5ENI A;  4Z93 A;  4Q0O A;  4IR5 A;  3QZT A;  5CGP A;  5DYX A;  4RVR A;  4HXM A;  5E74 A;  2YQD A;  3MB4 A;  4YC9 A;  5CRZ A;  5AD2 A;  4N4H A;  5II2 A;  3HME A;  4A9O A;  4TU6 A;  4J0R A;  4LZS A;  4QR4 A;  4BW2 A;  2E7O A;  5A82 A;  4MEP A;  3O34 A;  5FE7 A;  5ENG A;  5HEM A;  4KV1 A;  4MEO A;  4KV4 A;  2E7N A;  4CL9 A;  5L99 A;  3I3J A;  5HFQ A;  4NRB A;  5F3A A;  2YEM A;  5DKD A;  5C7N A;  2D82 A;  5HQ5 A;  5D3T A;  5ACY A;  4BJX A;  5CUB A;  4HXL A;  5HCL A;  5HQ6 A;  2WP1 A;  4Z1S A;  5EPS A;  4HXK A;  5DLZ A;  5CQ4 A;  4HXN A;  5D3S A;  5COI A;  4QR3 A;  4N4F A;  5ENJ A;  4O78 A;  4UIT A;  4LYS A;  5I80 A;  5FFW A;  4QSW A;  2YEK A;  4NUD A;  1JM4 B;  4YH3 A;  4A9I A;  2R0Y A;  3NXB A;  2H60 A;  4Z6I A;  3SVH A;  5FE3 A;  4NR7 A;  4QUT A;  2R10 A;  5HM0 A;  4UYD A;  2E3K A;  4WIV A;  5EWW A;  4BHW A;  5D3N A;  4YAT A;  2NXB A;  4KCX A;  4O77 A;  4QBM A;  3QZS A;  5FDZ A;  4DON A;  4E96 A;  3G0J A;  5E3D A;  5ETB A;  3MUL A;  4UYF B;  5D3R A;  5A5R A;  5C4Q A;  5F1H A;  2YDW A;  5CQT A;  5C85 A;  5A7C A;  4O75 A;  5EV9 A;  5EWV A;  5I40 A;  3GG3 A;  5CUC A;  4QR5 A;  5CPE A;  4A9K A;  4Y03 A;  4CLB A;  5DYC A;  5C87 A;  2L84 A;  5F36 A;  4FLP A;  4O70 A;  1WUM A;  2LSP B;  4J1P A;  5I89 A;  5DW1 A;  3JVJ A;  5F63 A;  2YW5 A;  3LQJ A;  5K29 A;  3U5N A;  4XUA A;  4TT4 A;  4N3W A;  4HXS A;  3O35 A;  4NQM A;  4UIW A;  5EIS A;  3O36 A;  4NQN A;  4YYN A;  5IGM A;  3K2J A;  4WHU A;  5EPB A;  4A9M A;  4UIV A;  4TZ8 A;  5I88 A;  2RFJ A;  3U5O A;  5FG4 A;  5IGK A;  4LDF A;  4NR9 A;  3Q2F A;  5CU8 A;  4YYH A;  5TB6 A;  4QSX A;  5EGU A;  4QC3 A;  2I7K A;  5ENE A;  5IG6 A;  2RS9 B;  5KHM A;  5KTX A;  1X0J A;  4YYD A;  5IID A;  3MXF A;  4UYF A;  3S91 A;  4OGJ A;  5I7Y A;  2DVV A;  4BW1 A;  3G0L A;  5CUD A;  5EI4 A;  5H1V A;  5FE4 A;  3TLP A;  3S92 A;  4A9F A;  4Z1Q A;  4QYD A;  5CZG A;  2FSA A;  5L98 A;  5JWM A;  5L96 A;  3ONI A;  4IR6 A;  4BW3 A;  4YYJ A;  5AMF A;  3SVG A;  2D9E A;  5J0D A;  5EA1 A;  4UIZ A;  1JSP B;  5H1T A;  4NYX A;  5F1L A;  4CUR A;  4HXP A;  5HLS A;  5EU1 A;  4N4G A;  5FE8 A;  5FB0 A;  2YEL A;  4MEN A;  5DFB A;  5D24 A;  5E73 A;  4LR6 A;  5FE6 A;  4MEQ A;  4O7E A;  5CY9 A;  5D0C A;  4YK0 A;  5G4S A;  4A9E A;  4QSU A;  5CQ8 A;  4HXR A;  5D26 A;  4ZC9 A;  4YBT A;  5F60 A;  5D3H A;  4LYW A;  5FE9 A;  4UYH A;  2DAT A;  2I8N A;  2L85 A;  4QEU A;  4QSS A;  4YAD A;  4HBX A;  5I1Q A;  4QEV A;  5EK9 A;  5D3L A;  4QC1 A;  4HXO A;  4OGI A;  5LJ2 A;  5DFD A;  4O76 A;  5L8T A;  5LKX A;  4LZR A;  5DKH A;  3AAD A;  2RNX A;  5L97 A;  5LKU A;  4QEW A;  5DYU A;  4IOO A;  2RNW A;  3P1F A;  5CRM A;  2RI7 A;  4BW4 A;  5HEL A;  4PS5 A;  5DLX A;  4A9H A;  1E6I A;  4CUS A;  3UW9 A;  4PCE A;  5H85 A;  5DY7 A;  5LUU A;  4NUE A;  4PTB A;  3MQM A;  3MUK A;  5EWH A;  3UVW A;  5E3G A;  5D3P A;  3DWY A;  5FE1 A;  3U5K A;  5I86 A;  3UVY A;  3O37 A;  4TT6 A;  5C8G A;  4O7A A;  4CFL A;  5CQ7 A;  4QY4 A;  2DVS A;  5FG5 A;  4QB3 A;  5HRX A;  5FB1 A;  4UYE A;  4HBW A;  4ALG A;  3UV5 A;  4NR5 A;  3P1C A;  4MR5 A;  3RCW A;  3JVM A;  4MR4 A;  4QSV A;  3JVK A;  4CUT A;  4YAB A;  4ZW1 A;  2F6J A;  5E0R A;  3AQA A;  5FH8 A;  3DAI A;  4NRA A;  5CQ3 A;  5IBN A;  4UYG A;  4IOR A;  4TQN A;  5HRW A;  3U5L A;  2N9G A;  2DVR A;  4QZS A;  5FE2 A;  3LXJ A;  3FKM X;  5ETD A;  4IOQ A;  4PY6 A;  4TT2 A;  4J3I A;  3U5P A;  3HMH A;  5ENC A;  2L5E A;  5DKC A;  5A81 A;  4YAX A;  4ALH A;  2OUO A;  5CQ5 A;  5FE0 A;  5CTL A;  4TU4 A;  5KO4 A;  5FG6 A;  2G4A A;  3HMF A;  4OUF A;  4QSP A;  5E9I A;  4YY4 A;  3SVF A;  5CQ6 A;  5H1U A;  5EP7 A;  5FE5 A;  5C89 A;  2YYN A;  5KTW A;  4Q0N A;  4YBM A;  5LVQ A;  4PCI A;  4NR6 A;  5A83 A;  4UIU A;  2DWW A;  5CP5 A;  5BT5 A;  5JI8 A;  4QUU A;  5ENB A;  3UV4 A;  4GPJ A;  4A9N A;  4YYI A;  2KTB B;  5A5O A;  5LJ0 A;  5LVR A;  3U5M A;  5LKT A;  5F61 A;  5DX4 A;  2OSS A;  4X2I A;  5AME A;  5HFR A;  1EQF A;  4C66 A;  4XY8 A;  3UVD A;  1F68 A;  5II1 A;  5BT4 A;  5I83 A;  4NS5 A;  5CS8 A;  5CQA A;  4NRC A;  5DW2 A;  5IGL A;  4O71 A;  4YY6 A;  3QZV A;  3UVX A;  5A5Q A;  5EM3 A;  4XUB A;  1N72 A;  3IU5 A;  5E9M A;  4NYW A;  5A85 A;  3LQH A;  4NUC A;  4C67 A;  2GRC A;  5D7X A;  4MR3 A;  4QSR A;  5IGN A;  3P1D A;  2R0V A;  4ZQL A;  5A5N A;  5HQ7 A;  4YYK A;  4NR4 A;  4TTE A;  5ENF A;  5F62 A;  2DVQ A;  4O7F A;  4A9J A;  5ENH A;  5HEN A;  2R0S A;  4LYI A;  5HRV A;  2DKW A;  1ZS5 A;  1WUG A;  4Z6H A;  5EWD A;  3O33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...