5EPRA

Crystal structure of the human brpf1 bromodomain in complex with seed11
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
112
structure length
112
Chain Sequence
b'MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 38
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5eprA00
2RNWA 5EI4A 4A9EA 4YYHA 5EM3A 5ENEA 4UIUA 4YAXA 5A7CA 4HXOA 3QZSA 5I83A 4PY6A 5DKHA 5DKCA 4PCIA 4IOOA 4QEUA 5A5OA 5I88A 2DVRA 4GPJA 5D3LA 5DLXA 4TQNA 4TYLA 2YELA 5DYCA 4Z1QA 2RI7A 5CP5A 4E96A 4QR5A 5DX4A 5EWVA 5H85A 4O7FA 4O70A 4MEPA 4J1PA 5CZGA 4A9NA 4CUSA 4Z93A 1E6IA 5JI8A 4TT6A 5DFDA 4QSWA 4YYMA 3P5OA 2LSPB 4YATA 4HXRA 5DYAA 4UYDA 5CQTA 5ENGA 4TU6A 3U5OA 5II2A 3O34A 2F6JA 5A5RA 4O75A 4LYWA 4C66A 4ALGA 4CUQA 4MR3A 3G0JA 5LKZA 4PS5A 5FB0A 5F61A 5DLZA 5FE8A 4QUTA 4IR5A 5E73A 4A9KA 4HXPA 3P1CA 3QZTA 4YYDA 4QEVA 3U5KA 3IU6A 5HENA 5DW1A 5LUUA 3HMFA 4QR3A 1JSPB 5HFQA 3AADA 5E9VA 4QSXA 4PKLA 4BW1A 5FE0A 4UYHA 5EWCA 4CLBA 4O7CA 5FFYA 5I89A 3HMHA 5ETBA 4HXLA 4LZ2A 3S91A 5CQ8A 3JVMA 5EPSA 4ZW1A 3I3JA 2R0VA 4XY8A 5F1HA 4BJXA 4QYDA 5LVRA 4YBTA 5LJ0A 4MR4A 5CU8A 4A9FA 3RCWA 4CURA 5FH7A 3MULA 5L8TA 4O7BA 3U5PA 2GRCA 4MR6A 5D3NA 5FH6A 2L85A 3O36A 4HXMA 4QNSA 4J0RA 2F6NA 4HBWA 5E7DA 5CQ7A 5I7XA 5CPEA 4UYFA 5J0DA 3LJWA 5KU3A 5E3DA 5LKTA 4NR5A 4NUDA 4Z1SA 5A82A 4LR6A 2E7NA 3JVKA 5I1QA 4XYAA 2R0SA 5IG6A 2G4AA 4LRGA 4UYFB 4O71A 4QB3A 3LXJA 5HRVA 5G4SA 3UV2A 3MQMA 3P1DA 3UV4A 5E74A 5L96A 1EQFA 5E9IA 5CUDA 5F2PA 5FG4A 3UVYA 2RO1A 5D3SA 2I7KA 5DFCA 4CUPA 2RNYA 5ENBA 5TCMA 4YY4A 5IGLA 2DVSA 4BHWA 3NXBA 4HBYA 5TB6A 4LDFA 5EWDA 5EP7A 2OO1A 4YH4A 5A5NA 3AQAA 2NXBA 2YYNA 5LKXA 5AMFA 4N3WA 5CUEA 2DKWA 5CQ5A 5D25A 5C7NA 4YADA 5EICA 4NR9A 5D3JA 2KTBB 3U5MA 5HRXA 3DAIA 2DWWA 4TZ2A 3SVHA 2WP1A 5EPRA 2D9EA 5L98A 4CUTA 4NRAA 5II1A 3P1FA 4KV1A 5CQAA 3D7CA 4UIZA 5KTXA 5C89A 5FDZA 4UIXA 5AMEA 5HELA 4Z6HA 3JVJA 4Z6IA 5C85A 5D0CA 5L97A 5D3RA 4LZSA 3UW9A 5KTWA 3UVDA 2L5EA 5CRMA 5F25A 5LJ2A 4LC2A 5CUBA 4O76A 3G0LA 4KV4A 4N4IA 5I40A 4UIYA 5KTUA 4Y03A 4HXSA 5FE1A 3ZYUA 4NYXA 5EU1A 5D3TA 4NR8A 4YYGA 4YYIA 5E9KA 5FE9A 5I29A 4HXKA 1F68A 5FBXA 5ETDA 4YYNA 4UIVA 5ACYA 4QYLA 5DKDA 5DY7A 5CUGA 2E7OA 4NR4A 5HLSA 3GG3A 5KHMA 5IBNA 4OGIA 3Q2FA 4NR6A 3DWYA 4YBSA 5IGNA 4TT2A 2RFJA 2D82A 5C8GA 3S92A 4A9MA 4QSRA 5DW2A 2I8NA 4QC1A 4ALHA 4IORA 5F36A 4QSUA 5ENFA 2OUOA 5EQ1A 4A9JA 5A81A 4F3IA 4NQNA 5EISA 4OUFA 4QSSA 5A5PA 5CRZA 4PTBA 5E9MA 4UIWA 4J0SA 5L8UA 2DVVA 4MR5A 5LKUA 5C87A 4QY4A 5HEMA 5HRWA 5FG5A 4O77A 2MJVB 5G4RA 4O7EA 5EVAA 4QUUA 4CUUA 4TZ8A 5DBMA 5EV9A 5A83A 5FB1A 5CY9A 4QR4A 4X2IA 4CL9A 5EWWA 5FFWA 2RNXA 4QSQA 5F1LA 4N4HA 4QEWA 5DYXA 5HJCA 4MENA 5FE3A 5I80A 2N9GA 5HFRA 3P1EA 5DYUA 4A9IA 5A5SA 4NUEA 3FKMX 4XUBA 4DONA 5F60A 5FE2A 3O35A 5D26A 5CFWA 3SVFA 4IR6A 4BW2A 5F63A 5CQ4A 4XY9A 4CFKA 4C67A 5C4QA 2RS9B 4O74A 4FLPA 5HQ6A 5A5QA 2YW5A 2H60A 5F3AA 3SVGA 3MUKA 4NQMA 5E9LA 5JWMA 5CS8A 3U5LA 3IU5A 4HBXA 2OSSA 4Q0NA 5BT5A 5IIDA 4HXNA 5ENJA 4NS5A 4TS8A 4J3IA 4A9LA 4QSVA 4QBMA 2YDWA 1JM4B 5ENCA 3LQJA 4YK0A 4ZQLA 3U5JA 3Q2EA 2FSAA 2R0YA 4QSTA 3O33A 4QC3A 2YEKA 3HMEA 4TT4A 4O72A 5EGUA 5D3PA 4CFLA 4UYGA 4MEQA 4LZRA 5CTLA 5H1UA 4NYVA 3ONIA 4WHWA 1ZS5A 4LYSA 5FH8A 5ENIA 4YYJA 5EA1A 4O7AA 5CQ3A 5L99A 4TU4A 3JVLA 4N4FA 4YABA 2WP2A 5KO4A 3O37A 5E0RA 5BT3A 4KCXA 4MEOA 4HBVA 5FE5A 5I7YA 4Q0OA 1N72A 5FE6A 5H1VA 4OGJA 2R10A 4UITA 4BW4A 4A9HA 4YBMA 5DFBA 3K2JA 5D3HA 4UYEA 5CGPA 4N4GA 4NR7A 5FFVA 5CQ6A 4TTEA 3LQIA 5AD2A 5COIA 2L84A 4NXJA 4AKNA 3TLPA 5IGKA 5HQ7A 5K29A 3QZVA 5F62A 3UV5A 5FG6A 4NYWA 1WUMA 4IR4A 5FE4A 5IGMA 5A85A 4NRCA 5FE7A 3UVXA 2YQDA 4PCEA 5F5ZA 5D7XA 4IOQA 4YC9A 5EPBA 4QZSA 5ENHA 5HQ5A 3UVWA 4XUAA 4YY6A 3U5NA 2DATA 4NRBA 4YYKA 5LVQA 5HCLA 4YH3A 5EWHA 4O78A 5E9YA 4BW3A 2YEMA 5HM0A 1X0JA 2E3KA 4NUCA 2DVQA 3MB3A 5D24A 4LYIA 5CUCA 5E3GA 4A9OA 4WIVA 5H1TA 3MB4A 5I86A 1WUGA 5AD3A 3MXFA 3LQHA 5LJ1A 4ZC9A 4WHUA 4QSPA 4RVRA 5BT4A 5CUAA 4IR3A 5EK9A
chains in the Genus database with same CATH superfamily
2RNWA 5EI4A 4A9EA 4YYHA 1PUOA 5EM3A 5ENEA 4UIUA 4YAXA 5A7CA 4HXOA 3QZSA 5I83A 4PY6A 5DKHA 5DKCA 4PCIA 4IOOA 4QEUA 5A5OA 5I88A 2DVRA 4GPJA 5D3LA 5DLXA 4TQNA 4TYLA 2YELA 5DYCA 4Z1QA 2RI7A 5CP5A 4E96A 4QR5A 5DX4A 5EWVA 5H85A 4O7FA 4O70A 4MEPA 4J1PA 5CZGA 4A9NA 4CUSA 4Z93A 1E6IA 5JI8A 4TT6A 5DFDA 4QSWA 4YYMA 3P5OA 2LSPB 4YATA 4HXRA 5DYAA 4UYDA 5CQTA 5ENGA 4TU6A 3U5OA 5II2A 3O34A 2F6JA 5A5RA 4O75A 4LYWA 4C66A 4ALGA 3D1DA 4CUQA 4MR3A 3G0JA 5LKZA 4PS5A 5FB0A 5F61A 5DLZA 5FE8A 4QUTA 4IR5A 5E73A 4A9KA 4HXPA 3P1CA 3QZTA 4YYDA 4QEVA 3U5KA 3IU6A 5HENA 5DW1A 5LUUA 3HMFA 4QR3A 1JSPB 5HFQA 3AADA 5E9VA 4QSXA 4PKLA 4BW1A 5FE0A 4UYHA 5EWCA 4CLBA 4O7CA 5FFYA 5I89A 3HMHA 5ETBA 4HXLA 4LZ2A 3S91A 5CQ8A 3JVMA 5EPSA 4ZW1A 3I3JA 2R0VA 4XY8A 5F1HA 4BJXA 4QYDA 5LVRA 4YBTA 5LJ0A 4MR4A 5CU8A 4A9FA 3RCWA 4CURA 5FH7A 4AI6A 3MULA 5L8TA 4O7BA 3U5PA 2GRCA 4MR6A 5D3NA 5FH6A 2L85A 3O36A 4HXMA 4QNSA 4J0RA 2F6NA 4HBWA 5E7DA 5CQ7A 5I7XA 5CPEA 4UYFA 5J0DA 3LJWA 5KU3A 5E3DA 5LKTA 4NR5A 4NUDA 4Z1SA 5A82A 4LR6A 2E7NA 3JVKA 5I1QA 4XYAA 2R0SA 5IG6A 2G4AA 4LRGA 4UYFB 4O71A 4QB3A 3LXJA 5HRVA 5G4SA 3UV2A 3MQMA 3P1DA 3UV4A 5E74A 5L96A 1EQFA 5E9IA 5CUDA 5F2PA 5FG4A 3UVYA 2RO1A 5D3SA 2I7KA 5DFCA 4CUPA 2RNYA 5ENBA 5TCMA 4YY4A 5IGLA 2DVSA 4BHWA 3NXBA 4HBYA 5TB6A 4LDFA 5EWDA 5EP7A 2OO1A 4YH4A 5A5NA 3AQAA 2NXBA 2YYNA 5LKXA 5AMFA 4N3WA 5CUEA 2DKWA 5CQ5A 5D25A 5C7NA 4YADA 5EICA 4NR9A 5D3JA 2KTBB 3U5MA 5HRXA 3DAIA 2DWWA 4TZ2A 3SVHA 2WP1A 5EPRA 2D9EA 5L98A 4CUTA 4NRAA 5II1A 3P1FA 4KV1A 5CQAA 3D7CA 4UIZA 5KTXA 5C89A 5FDZA 4UIXA 5AMEA 5HELA 4Z6HA 3JVJA 4Z6IA 5C85A 5D0CA 5L97A 5D3RA 4LZSA 3UW9A 5KTWA 3UVDA 2L5EA 5CRMA 5F25A 5LJ2A 4LC2A 5CUBA 3VKGA 4O76A 3G0LA 4KV4A 4N4IA 5I40A 4UIYA 5KTUA 4Y03A 4HXSA 5FE1A 3ZYUA 4NYXA 3ERRA 5EU1A 5D3TA 3D1BA 4NR8A 4YYGA 4YYIA 5E9KA 5FE9A 5I29A 4HXKA 1F68A 5FBXA 5ETDA 4YYNA 4UIVA 5ACYA 4QYLA 5DKDA 5DY7A 5CUGA 2E7OA 4NR4A 5HLSA 3GG3A 5KHMA 5IBNA 4OGIA 3Q2FA 4NR6A 3DWYA 4YBSA 5IGNA 4AKHA 4TT2A 2RFJA 2D82A 5C8GA 3S92A 4A9MA 4QSRA 5DW2A 2I8NA 4QC1A 4ALHA 4IORA 5F36A 4QSUA 5ENFA 2OUOA 5EQ1A 4A9JA 5A81A 4F3IA 4NQNA 5EISA 4OUFA 4QSSA 5A5PA 5CRZA 4PTBA 5E9MA 4UIWA 4J0SA 5L8UA 2DVVA 4MR5A 5LKUA 5C87A 4QY4A 5HEMA 5HRWA 5FG5A 4O77A 2MJVB 5G4RA 4O7EA 5EVAA 4QUUA 4CUUA 4TZ8A 5DBMA 5EV9A 5A83A 5FB1A 5CY9A 4QR4A 4X2IA 4CL9A 5EWWA 5FFWA 2RNXA 4QSQA 5F1LA 4N4HA 4QEWA 5DYXA 5HJCA 4MENA 5FE3A 5I80A 2N9GA 5HFRA 3P1EA 5DYUA 4A9IA 5A5SA 4NUEA 1ZKRA 3FKMX 4XUBA 4DONA 5F60A 5FE2A 3O35A 5D26A 5CFWA 3SVFA 4IR6A 4BW2A 5F63A 5CQ4A 4XY9A 4CFKA 4C67A 5C4QA 4AKIA 2RS9B 4O74A 4FLPA 5HQ6A 2EJNA 5A5QA 2YW5A 2H60A 5F3AA 3SVGA 3MUKA 4NQMA 5E9LA 5JWMA 5CS8A 3U5LA 3IU5A 4HBXA 2OSSA 4Q0NA 5BT5A 5IIDA 4HXNA 5ENJA 4NS5A 4TS8A 4AKGA 4J3IA 4A9LA 4QSVA 4QBMA 2YDWA 1JM4B 5ENCA 3LQJA 4YK0A 4ZQLA 3U5JA 3Q2EA 2FSAA 2R0YA 4QSTA 3O33A 4QC3A 3VKHA 2YEKA 3HMEA 4TT4A 4O72A 5EGUA 5D3PA 4CFLA 4UYGA 4MEQA 4LZRA 5CTLA 5H1UA 4NYVA 3ONIA 4WHWA 1ZS5A 4LYSA 5FH8A 5ENIA 4YYJA 5EA1A 4O7AA 5CQ3A 5L99A 4TU4A 3JVLA 4N4FA 4YABA 2WP2A 5KO4A 3O37A 5E0RA 5BT3A 4KCXA 4MEOA 4HBVA 5FE5A 5I7YA 4Q0OA 1N72A 5FE6A 5H1VA 4OGJA 2R10A 4UITA 4BW4A 4A9HA 4YBMA 5DFBA 3K2JA 5D3HA 4UYEA 5CGPA 4N4GA 4NR7A 5FFVA 5CQ6A 4TTEA 3LQIA 5AD2A 5COIA 2L84A 4NXJA 4AKNA 3TLPA 5IGKA 5HQ7A 5K29A 3QZVA 5F62A 3UV5A 5FG6A 4NYWA 1WUMA 4IR4A 5FE4A 5IGMA 5A85A 4NRCA 5FE7A 3UVXA 2YQDA 4PCEA 5F5ZA 5D7XA 4IOQA 4YC9A 5EPBA 4QZSA 5ENHA 5HQ5A 3UVWA 4XUAA 4YY6A 3U5NA 2DATA 4NRBA 4YYKA 5LVQA 5HCLA 4YH3A 5EWHA 4O78A 5E9YA 4BW3A 2YEMA 5HM0A 1X0JA 2E3KA 4NUCA 2DVQA 3MB3A 5D24A 4LYIA 5CUCA 5E3GA 4A9OA 4WIVA 5H1TA 3MB4A 5I86A 1WUGA 5AD3A 3MXFA 3LQHA 5LJ1A 4ZC9A 4WHUA 4QSPA 4RVRA 5BT4A 5CUAA 4IR3A 5EK9A
chains in the Genus database with same CATH topology
2RNWA 5EI4A 4A9EA 4YYHA 5EM3A 5ENEA 4UIUA 4YAXA 5A7CA 4HXOA 3QZSA 5I83A 4PY6A 5DKHA 5DKCA 4PCIA 4IOOA 4QEUA 5A5OA 5I88A 2DVRA 4GPJA 5D3LA 5DLXA 4TQNA 4TYLA 2YELA 5DYCA 4Z1QA 2RI7A 5CP5A 4E96A 4QR5A 5DX4A 5EWVA 5H85A 4O7FA 4O70A 4MEPA 4J1PA 5CZGA 4A9NA 4CUSA 4Z93A 1E6IA 5JI8A 4TT6A 5DFDA 4QSWA 4YYMA 3P5OA 2LSPB 4YATA 4HXRA 5DYAA 4UYDA 5CQTA 5ENGA 4TU6A 3U5OA 5II2A 3O34A 2F6JA 5A5RA 4O75A 4LYWA 4C66A 4ALGA 4CUQA 4MR3A 3G0JA 5LKZA 4PS5A 5FB0A 5F61A 5DLZA 5FE8A 4QUTA 4IR5A 5E73A 4A9KA 4HXPA 3P1CA 3QZTA 4YYDA 4QEVA 3U5KA 3IU6A 5HENA 5DW1A 5LUUA 3HMFA 4QR3A 1JSPB 5HFQA 3AADA 5E9VA 4QSXA 4PKLA 4BW1A 5FE0A 4UYHA 5EWCA 4CLBA 4O7CA 5FFYA 5I89A 3HMHA 5ETBA 4HXLA 4LZ2A 3S91A 5CQ8A 3JVMA 5EPSA 4ZW1A 3I3JA 2R0VA 4XY8A 5F1HA 4BJXA 4QYDA 5LVRA 4YBTA 5LJ0A 4MR4A 5CU8A 4A9FA 3RCWA 4CURA 5FH7A 3MULA 5L8TA 4O7BA 3U5PA 2GRCA 4MR6A 5D3NA 5FH6A 2L85A 3O36A 4HXMA 4QNSA 4J0RA 2F6NA 4HBWA 5E7DA 5CQ7A 5I7XA 5CPEA 4UYFA 5J0DA 3LJWA 5KU3A 5E3DA 5LKTA 4NR5A 4NUDA 4Z1SA 5A82A 4LR6A 2E7NA 3JVKA 5I1QA 4XYAA 2R0SA 5IG6A 2G4AA 4LRGA 4UYFB 4O71A 4QB3A 3LXJA 5HRVA 5G4SA 3UV2A 3MQMA 3P1DA 3UV4A 5E74A 5L96A 1EQFA 5E9IA 5CUDA 5F2PA 5FG4A 3UVYA 2RO1A 5D3SA 2I7KA 5DFCA 4CUPA 2RNYA 5ENBA 5TCMA 4YY4A 5IGLA 2DVSA 4BHWA 3NXBA 4HBYA 5TB6A 4LDFA 5EWDA 5EP7A 2OO1A 4YH4A 5A5NA 3AQAA 2NXBA 2YYNA 5LKXA 5AMFA 4N3WA 5CUEA 2DKWA 5CQ5A 5D25A 5C7NA 4YADA 5EICA 4NR9A 5D3JA 2KTBB 3U5MA 5HRXA 3DAIA 2DWWA 4TZ2A 3SVHA 2WP1A 5EPRA 2D9EA 5L98A 4CUTA 4NRAA 5II1A 3P1FA 4KV1A 5CQAA 3D7CA 4UIZA 5KTXA 5C89A 5FDZA 4UIXA 5AMEA 5HELA 4Z6HA 3JVJA 4Z6IA 5C85A 5D0CA 5L97A 5D3RA 4LZSA 3UW9A 5KTWA 3UVDA 2L5EA 5CRMA 5F25A 5LJ2A 4LC2A 5CUBA 4O76A 3G0LA 4KV4A 4N4IA 5I40A 4UIYA 5KTUA 4Y03A 4HXSA 5FE1A 3ZYUA 4NYXA 5EU1A 5D3TA 4NR8A 4YYGA 4YYIA 5E9KA 5FE9A 5I29A 4HXKA 1F68A 5FBXA 5ETDA 4YYNA 4UIVA 5ACYA 4QYLA 5DKDA 5DY7A 5CUGA 2E7OA 4NR4A 5HLSA 3GG3A 5KHMA 5IBNA 4OGIA 3Q2FA 4NR6A 3DWYA 4YBSA 5IGNA 4TT2A 2RFJA 2D82A 5C8GA 3S92A 4A9MA 4QSRA 5DW2A 2I8NA 4QC1A 4ALHA 4IORA 5F36A 4QSUA 5ENFA 2OUOA 5EQ1A 4A9JA 5A81A 4F3IA 4NQNA 5EISA 4OUFA 4QSSA 5A5PA 5CRZA 4PTBA 5E9MA 4UIWA 4J0SA 5L8UA 2DVVA 4MR5A 5LKUA 5C87A 4QY4A 5HEMA 5HRWA 5FG5A 4O77A 2MJVB 5G4RA 4O7EA 5EVAA 4QUUA 4CUUA 4TZ8A 5DBMA 5EV9A 5A83A 5FB1A 5CY9A 4QR4A 4X2IA 4CL9A 5EWWA 5FFWA 2RNXA 4QSQA 5F1LA 4N4HA 4QEWA 5DYXA 5HJCA 4MENA 5FE3A 5I80A 2N9GA 5HFRA 3P1EA 5DYUA 4A9IA 5A5SA 4NUEA 3FKMX 4XUBA 4DONA 5F60A 5FE2A 3O35A 5D26A 5CFWA 3SVFA 4IR6A 4BW2A 5F63A 5CQ4A 4XY9A 4CFKA 4C67A 5C4QA 2RS9B 4O74A 4FLPA 5HQ6A 5A5QA 2YW5A 2H60A 5F3AA 3SVGA 3MUKA 4NQMA 5E9LA 5JWMA 5CS8A 3U5LA 3IU5A 4HBXA 2OSSA 4Q0NA 5BT5A 5IIDA 4HXNA 5ENJA 4NS5A 4TS8A 4J3IA 4A9LA 4QSVA 4QBMA 2YDWA 1JM4B 5ENCA 3LQJA 4YK0A 4ZQLA 3U5JA 3Q2EA 2FSAA 2R0YA 4QSTA 3O33A 4QC3A 2YEKA 3HMEA 4TT4A 4O72A 5EGUA 5D3PA 4CFLA 4UYGA 4MEQA 4LZRA 5CTLA 5H1UA 4NYVA 3ONIA 4WHWA 1ZS5A 4LYSA 5FH8A 5ENIA 4YYJA 5EA1A 4O7AA 5CQ3A 5L99A 4TU4A 3JVLA 4N4FA 4YABA 2WP2A 5KO4A 3O37A 5E0RA 5BT3A 4KCXA 4MEOA 4HBVA 5FE5A 5I7YA 4Q0OA 1N72A 5FE6A 5H1VA 4OGJA 2R10A 4UITA 4BW4A 4A9HA 4YBMA 5DFBA 3K2JA 5D3HA 4UYEA 5CGPA 4N4GA 4NR7A 5FFVA 5CQ6A 4TTEA 3LQIA 5AD2A 5COIA 2L84A 4NXJA 4AKNA 3TLPA 5IGKA 5HQ7A 5K29A 3QZVA 5F62A 3UV5A 5FG6A 4NYWA 1WUMA 4IR4A 5FE4A 5IGMA 5A85A 4NRCA 5FE7A 3UVXA 2YQDA 4PCEA 5F5ZA 5D7XA 4IOQA 4YC9A 5EPBA 4QZSA 5ENHA 5HQ5A 3UVWA 4XUAA 4YY6A 3U5NA 2DATA 4NRBA 4YYKA 5LVQA 5HCLA 4YH3A 5EWHA 4O78A 5E9YA 4BW3A 2YEMA 5HM0A 1X0JA 2E3KA 4NUCA 2DVQA 3MB3A 5D24A 4LYIA 5CUCA 5E3GA 4A9OA 4WIVA 5H1TA 3MB4A 5I86A 1WUGA 5AD3A 3MXFA 3LQHA 5LJ1A 4ZC9A 4WHUA 4QSPA 4RVRA 5BT4A 5CUAA 4IR3A 5EK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNW A;  5EI4 A;  4A9E A;  4YYH A;  5EM3 A;  5ENE A;  4UIU A;  4YAX A;  5A7C A;  4HXO A;  3QZS A;  5I83 A;  4PY6 A;  5DKH A;  5DKC A;  4PCI A;  4IOO A;  4QEU A;  5A5O A;  5I88 A;  2DVR A;  4GPJ A;  5D3L A;  5DLX A;  4TQN A;  4TYL A;  2YEL A;  5DYC A;  4Z1Q A;  2RI7 A;  5CP5 A;  4E96 A;  4QR5 A;  5DX4 A;  5EWV A;  5H85 A;  4O7F A;  4O70 A;  4MEP A;  4J1P A;  5CZG A;  4A9N A;  4CUS A;  4Z93 A;  1E6I A;  5JI8 A;  4TT6 A;  5DFD A;  4QSW A;  4YYM A;  3P5O A;  2LSP B;  4YAT A;  4HXR A;  5DYA A;  4UYD A;  5CQT A;  5ENG A;  4TU6 A;  3U5O A;  5II2 A;  3O34 A;  2F6J A;  5A5R A;  4O75 A;  4LYW A;  4C66 A;  4ALG A;  4CUQ A;  4MR3 A;  3G0J A;  5LKZ A;  4PS5 A;  5FB0 A;  5F61 A;  5DLZ A;  5FE8 A;  4QUT A;  4IR5 A;  5E73 A;  4A9K A;  4HXP A;  3P1C A;  3QZT A;  4YYD A;  4QEV A;  3U5K A;  3IU6 A;  5HEN A;  5DW1 A;  5LUU A;  3HMF A;  4QR3 A;  1JSP B;  5HFQ A;  3AAD A;  5E9V A;  4QSX A;  4PKL A;  4BW1 A;  5FE0 A;  4UYH A;  5EWC A;  4CLB A;  4O7C A;  5FFY A;  5I89 A;  3HMH A;  5ETB A;  4HXL A;  4LZ2 A;  3S91 A;  5CQ8 A;  3JVM A;  5EPS A;  4ZW1 A;  3I3J A;  2R0V A;  4XY8 A;  5F1H A;  4BJX A;  4QYD A;  5LVR A;  4YBT A;  5LJ0 A;  4MR4 A;  5CU8 A;  4A9F A;  3RCW A;  4CUR A;  5FH7 A;  3MUL A;  5L8T A;  4O7B A;  3U5P A;  2GRC A;  4MR6 A;  5D3N A;  5FH6 A;  2L85 A;  3O36 A;  4HXM A;  4QNS A;  4J0R A;  2F6N A;  4HBW A;  5E7D A;  5CQ7 A;  5I7X A;  5CPE A;  4UYF A;  5J0D A;  3LJW A;  5KU3 A;  5E3D A;  5LKT A;  4NR5 A;  4NUD A;  4Z1S A;  5A82 A;  4LR6 A;  2E7N A;  3JVK A;  5I1Q A;  4XYA A;  2R0S A;  5IG6 A;  2G4A A;  4LRG A;  4UYF B;  4O71 A;  4QB3 A;  3LXJ A;  5HRV A;  5G4S A;  3UV2 A;  3MQM A;  3P1D A;  3UV4 A;  5E74 A;  5L96 A;  1EQF A;  5E9I A;  5CUD A;  5F2P A;  5FG4 A;  3UVY A;  2RO1 A;  5D3S A;  2I7K A;  5DFC A;  4CUP A;  2RNY A;  5ENB A;  5TCM A;  4YY4 A;  5IGL A;  2DVS A;  4BHW A;  3NXB A;  4HBY A;  5TB6 A;  4LDF A;  5EWD A;  5EP7 A;  2OO1 A;  4YH4 A;  5A5N A;  3AQA A;  2NXB A;  2YYN A;  5LKX A;  5AMF A;  4N3W A;  5CUE A;  2DKW A;  5CQ5 A;  5D25 A;  5C7N A;  4YAD A;  5EIC A;  4NR9 A;  5D3J A;  2KTB B;  3U5M A;  5HRX A;  3DAI A;  2DWW A;  4TZ2 A;  3SVH A;  2WP1 A;  5EPR A;  2D9E A;  5L98 A;  4CUT A;  4NRA A;  5II1 A;  3P1F A;  4KV1 A;  5CQA A;  3D7C A;  4UIZ A;  5KTX A;  5C89 A;  5FDZ A;  4UIX A;  5AME A;  5HEL A;  4Z6H A;  3JVJ A;  4Z6I A;  5C85 A;  5D0C A;  5L97 A;  5D3R A;  4LZS A;  3UW9 A;  5KTW A;  3UVD A;  2L5E A;  5CRM A;  5F25 A;  5LJ2 A;  4LC2 A;  5CUB A;  4O76 A;  3G0L A;  4KV4 A;  4N4I A;  5I40 A;  4UIY A;  5KTU A;  4Y03 A;  4HXS A;  5FE1 A;  3ZYU A;  4NYX A;  5EU1 A;  5D3T A;  4NR8 A;  4YYG A;  4YYI A;  5E9K A;  5FE9 A;  5I29 A;  4HXK A;  1F68 A;  5FBX A;  5ETD A;  4YYN A;  4UIV A;  5ACY A;  4QYL A;  5DKD A;  5DY7 A;  5CUG A;  2E7O A;  4NR4 A;  5HLS A;  3GG3 A;  5KHM A;  5IBN A;  4OGI A;  3Q2F A;  4NR6 A;  3DWY A;  4YBS A;  5IGN A;  4TT2 A;  2RFJ A;  2D82 A;  5C8G A;  3S92 A;  4A9M A;  4QSR A;  5DW2 A;  2I8N A;  4QC1 A;  4ALH A;  4IOR A;  5F36 A;  4QSU A;  5ENF A;  2OUO A;  5EQ1 A;  4A9J A;  5A81 A;  4F3I A;  4NQN A;  5EIS A;  4OUF A;  4QSS A;  5A5P A;  5CRZ A;  4PTB A;  5E9M A;  4UIW A;  4J0S A;  5L8U A;  2DVV A;  4MR5 A;  5LKU A;  5C87 A;  4QY4 A;  5HEM A;  5HRW A;  5FG5 A;  4O77 A;  2MJV B;  5G4R A;  4O7E A;  5EVA A;  4QUU A;  4CUU A;  4TZ8 A;  5DBM A;  5EV9 A;  5A83 A;  5FB1 A;  5CY9 A;  4QR4 A;  4X2I A;  4CL9 A;  5EWW A;  5FFW A;  2RNX A;  4QSQ A;  5F1L A;  4N4H A;  4QEW A;  5DYX A;  5HJC A;  4MEN A;  5FE3 A;  5I80 A;  2N9G A;  5HFR A;  3P1E A;  5DYU A;  4A9I A;  5A5S A;  4NUE A;  3FKM X;  4XUB A;  4DON A;  5F60 A;  5FE2 A;  3O35 A;  5D26 A;  5CFW A;  3SVF A;  4IR6 A;  4BW2 A;  5F63 A;  5CQ4 A;  4XY9 A;  4CFK A;  4C67 A;  5C4Q A;  2RS9 B;  4O74 A;  4FLP A;  5HQ6 A;  5A5Q A;  2YW5 A;  2H60 A;  5F3A A;  3SVG A;  3MUK A;  4NQM A;  5E9L A;  5JWM A;  5CS8 A;  3U5L A;  3IU5 A;  4HBX A;  2OSS A;  4Q0N A;  5BT5 A;  5IID A;  4HXN A;  5ENJ A;  4NS5 A;  4TS8 A;  4J3I A;  4A9L A;  4QSV A;  4QBM A;  2YDW A;  1JM4 B;  5ENC A;  3LQJ A;  4YK0 A;  4ZQL A;  3U5J A;  3Q2E A;  2FSA A;  2R0Y A;  4QST A;  3O33 A;  4QC3 A;  2YEK A;  3HME A;  4TT4 A;  4O72 A;  5EGU A;  5D3P A;  4CFL A;  4UYG A;  4MEQ A;  4LZR A;  5CTL A;  5H1U A;  4NYV A;  3ONI A;  4WHW A;  1ZS5 A;  4LYS A;  5FH8 A;  5ENI A;  4YYJ A;  5EA1 A;  4O7A A;  5CQ3 A;  5L99 A;  4TU4 A;  3JVL A;  4N4F A;  4YAB A;  2WP2 A;  5KO4 A;  3O37 A;  5E0R A;  5BT3 A;  4KCX A;  4MEO A;  4HBV A;  5FE5 A;  5I7Y A;  4Q0O A;  1N72 A;  5FE6 A;  5H1V A;  4OGJ A;  2R10 A;  4UIT A;  4BW4 A;  4A9H A;  4YBM A;  5DFB A;  3K2J A;  5D3H A;  4UYE A;  5CGP A;  4N4G A;  4NR7 A;  5FFV A;  5CQ6 A;  4TTE A;  3LQI A;  5AD2 A;  5COI A;  2L84 A;  4NXJ A;  4AKN A;  3TLP A;  5IGK A;  5HQ7 A;  5K29 A;  3QZV A;  5F62 A;  3UV5 A;  5FG6 A;  4NYW A;  1WUM A;  4IR4 A;  5FE4 A;  5IGM A;  5A85 A;  4NRC A;  5FE7 A;  3UVX A;  2YQD A;  4PCE A;  5F5Z A;  5D7X A;  4IOQ A;  4YC9 A;  5EPB A;  4QZS A;  5ENH A;  5HQ5 A;  3UVW A;  4XUA A;  4YY6 A;  3U5N A;  2DAT A;  4NRB A;  4YYK A;  5LVQ A;  5HCL A;  4YH3 A;  5EWH A;  4O78 A;  5E9Y A;  4BW3 A;  2YEM A;  5HM0 A;  1X0J A;  2E3K A;  4NUC A;  2DVQ A;  3MB3 A;  5D24 A;  4LYI A;  5CUC A;  5E3G A;  4A9O A;  4WIV A;  5H1T A;  3MB4 A;  5I86 A;  1WUG A;  5AD3 A;  3MXF A;  3LQH A;  5LJ1 A;  4ZC9 A;  4WHU A;  4QSP A;  4RVR A;  5BT4 A;  5CUA A;  4IR3 A;  5EK9 A; 
#chains in the Genus database with same CATH topology
 2RNW A;  5EI4 A;  4A9E A;  4YYH A;  1PUO A;  5EM3 A;  5ENE A;  4UIU A;  4YAX A;  5A7C A;  4HXO A;  3QZS A;  5I83 A;  4PY6 A;  5DKH A;  5DKC A;  4PCI A;  4IOO A;  4QEU A;  5A5O A;  5I88 A;  2DVR A;  4GPJ A;  5D3L A;  5DLX A;  4TQN A;  4TYL A;  2YEL A;  5DYC A;  4Z1Q A;  2RI7 A;  5CP5 A;  4E96 A;  4QR5 A;  5DX4 A;  5EWV A;  5H85 A;  4O7F A;  4O70 A;  4MEP A;  4J1P A;  5CZG A;  4A9N A;  4CUS A;  4Z93 A;  1E6I A;  5JI8 A;  4TT6 A;  5DFD A;  4QSW A;  4YYM A;  3P5O A;  2LSP B;  4YAT A;  4HXR A;  5DYA A;  4UYD A;  5CQT A;  5ENG A;  4TU6 A;  3U5O A;  5II2 A;  3O34 A;  2F6J A;  5A5R A;  4O75 A;  4LYW A;  4C66 A;  4ALG A;  3D1D A;  4CUQ A;  4MR3 A;  3G0J A;  5LKZ A;  4PS5 A;  5FB0 A;  5F61 A;  5DLZ A;  5FE8 A;  4QUT A;  4IR5 A;  5E73 A;  4A9K A;  4HXP A;  3P1C A;  3QZT A;  4YYD A;  4QEV A;  3U5K A;  3IU6 A;  5HEN A;  5DW1 A;  5LUU A;  3HMF A;  4QR3 A;  1JSP B;  5HFQ A;  3AAD A;  5E9V A;  4QSX A;  4PKL A;  4BW1 A;  5FE0 A;  4UYH A;  5EWC A;  4CLB A;  4O7C A;  5FFY A;  5I89 A;  3HMH A;  5ETB A;  4HXL A;  4LZ2 A;  3S91 A;  5CQ8 A;  3JVM A;  5EPS A;  4ZW1 A;  3I3J A;  2R0V A;  4XY8 A;  5F1H A;  4BJX A;  4QYD A;  5LVR A;  4YBT A;  5LJ0 A;  4MR4 A;  5CU8 A;  4A9F A;  3RCW A;  4CUR A;  5FH7 A;  4AI6 A;  3MUL A;  5L8T A;  4O7B A;  3U5P A;  2GRC A;  4MR6 A;  5D3N A;  5FH6 A;  2L85 A;  3O36 A;  4HXM A;  4QNS A;  4J0R A;  2F6N A;  4HBW A;  5E7D A;  5CQ7 A;  5I7X A;  5CPE A;  4UYF A;  5J0D A;  3LJW A;  5KU3 A;  5E3D A;  5LKT A;  4NR5 A;  4NUD A;  4Z1S A;  5A82 A;  4LR6 A;  2E7N A;  3JVK A;  5I1Q A;  4XYA A;  2R0S A;  5IG6 A;  2G4A A;  4LRG A;  4UYF B;  4O71 A;  4QB3 A;  3LXJ A;  5HRV A;  5G4S A;  3UV2 A;  3MQM A;  3P1D A;  3UV4 A;  5E74 A;  5L96 A;  1EQF A;  5E9I A;  5CUD A;  5F2P A;  5FG4 A;  3UVY A;  2RO1 A;  5D3S A;  2I7K A;  5DFC A;  4CUP A;  2RNY A;  5ENB A;  5TCM A;  4YY4 A;  5IGL A;  2DVS A;  4BHW A;  3NXB A;  4HBY A;  5TB6 A;  4LDF A;  5EWD A;  5EP7 A;  2OO1 A;  4YH4 A;  5A5N A;  3AQA A;  2NXB A;  2YYN A;  5LKX A;  5AMF A;  4N3W A;  5CUE A;  2DKW A;  5CQ5 A;  5D25 A;  5C7N A;  4YAD A;  5EIC A;  4NR9 A;  5D3J A;  2KTB B;  3U5M A;  5HRX A;  3DAI A;  2DWW A;  4TZ2 A;  3SVH A;  2WP1 A;  5EPR A;  2D9E A;  5L98 A;  4CUT A;  4NRA A;  5II1 A;  3P1F A;  4KV1 A;  5CQA A;  3D7C A;  4UIZ A;  5KTX A;  5C89 A;  5FDZ A;  4UIX A;  5AME A;  5HEL A;  4Z6H A;  3JVJ A;  4Z6I A;  5C85 A;  5D0C A;  5L97 A;  5D3R A;  4LZS A;  3UW9 A;  5KTW A;  3UVD A;  2L5E A;  5CRM A;  5F25 A;  5LJ2 A;  4LC2 A;  5CUB A;  3VKG A;  4O76 A;  3G0L A;  4KV4 A;  4N4I A;  5I40 A;  4UIY A;  5KTU A;  4Y03 A;  4HXS A;  5FE1 A;  3ZYU A;  4NYX A;  3ERR A;  5EU1 A;  5D3T A;  3D1B A;  4NR8 A;  4YYG A;  4YYI A;  5E9K A;  5FE9 A;  5I29 A;  4HXK A;  1F68 A;  5FBX A;  5ETD A;  4YYN A;  4UIV A;  5ACY A;  4QYL A;  5DKD A;  5DY7 A;  5CUG A;  2E7O A;  4NR4 A;  5HLS A;  3GG3 A;  5KHM A;  5IBN A;  4OGI A;  3Q2F A;  4NR6 A;  3DWY A;  4YBS A;  5IGN A;  4AKH A;  4TT2 A;  2RFJ A;  2D82 A;  5C8G A;  3S92 A;  4A9M A;  4QSR A;  5DW2 A;  2I8N A;  4QC1 A;  4ALH A;  4IOR A;  5F36 A;  4QSU A;  5ENF A;  2OUO A;  5EQ1 A;  4A9J A;  5A81 A;  4F3I A;  4NQN A;  5EIS A;  4OUF A;  4QSS A;  5A5P A;  5CRZ A;  4PTB A;  5E9M A;  4UIW A;  4J0S A;  5L8U A;  2DVV A;  4MR5 A;  5LKU A;  5C87 A;  4QY4 A;  5HEM A;  5HRW A;  5FG5 A;  4O77 A;  2MJV B;  5G4R A;  4O7E A;  5EVA A;  4QUU A;  4CUU A;  4TZ8 A;  5DBM A;  5EV9 A;  5A83 A;  5FB1 A;  5CY9 A;  4QR4 A;  4X2I A;  4CL9 A;  5EWW A;  5FFW A;  2RNX A;  4QSQ A;  5F1L A;  4N4H A;  4QEW A;  5DYX A;  5HJC A;  4MEN A;  5FE3 A;  5I80 A;  2N9G A;  5HFR A;  3P1E A;  5DYU A;  4A9I A;  5A5S A;  4NUE A;  1ZKR A;  3FKM X;  4XUB A;  4DON A;  5F60 A;  5FE2 A;  3O35 A;  5D26 A;  5CFW A;  3SVF A;  4IR6 A;  4BW2 A;  5F63 A;  5CQ4 A;  4XY9 A;  4CFK A;  4C67 A;  5C4Q A;  4AKI A;  2RS9 B;  4O74 A;  4FLP A;  5HQ6 A;  2EJN A;  5A5Q A;  2YW5 A;  2H60 A;  5F3A A;  3SVG A;  3MUK A;  4NQM A;  5E9L A;  5JWM A;  5CS8 A;  3U5L A;  3IU5 A;  4HBX A;  2OSS A;  4Q0N A;  5BT5 A;  5IID A;  4HXN A;  5ENJ A;  4NS5 A;  4TS8 A;  4AKG A;  4J3I A;  4A9L A;  4QSV A;  4QBM A;  2YDW A;  1JM4 B;  5ENC A;  3LQJ A;  4YK0 A;  4ZQL A;  3U5J A;  3Q2E A;  2FSA A;  2R0Y A;  4QST A;  3O33 A;  4QC3 A;  3VKH A;  2YEK A;  3HME A;  4TT4 A;  4O72 A;  5EGU A;  5D3P A;  4CFL A;  4UYG A;  4MEQ A;  4LZR A;  5CTL A;  5H1U A;  4NYV A;  3ONI A;  4WHW A;  1ZS5 A;  4LYS A;  5FH8 A;  5ENI A;  4YYJ A;  5EA1 A;  4O7A A;  5CQ3 A;  5L99 A;  4TU4 A;  3JVL A;  4N4F A;  4YAB A;  2WP2 A;  5KO4 A;  3O37 A;  5E0R A;  5BT3 A;  4KCX A;  4MEO A;  4HBV A;  5FE5 A;  5I7Y A;  4Q0O A;  1N72 A;  5FE6 A;  5H1V A;  4OGJ A;  2R10 A;  4UIT A;  4BW4 A;  4A9H A;  4YBM A;  5DFB A;  3K2J A;  5D3H A;  4UYE A;  5CGP A;  4N4G A;  4NR7 A;  5FFV A;  5CQ6 A;  4TTE A;  3LQI A;  5AD2 A;  5COI A;  2L84 A;  4NXJ A;  4AKN A;  3TLP A;  5IGK A;  5HQ7 A;  5K29 A;  3QZV A;  5F62 A;  3UV5 A;  5FG6 A;  4NYW A;  1WUM A;  4IR4 A;  5FE4 A;  5IGM A;  5A85 A;  4NRC A;  5FE7 A;  3UVX A;  2YQD A;  4PCE A;  5F5Z A;  5D7X A;  4IOQ A;  4YC9 A;  5EPB A;  4QZS A;  5ENH A;  5HQ5 A;  3UVW A;  4XUA A;  4YY6 A;  3U5N A;  2DAT A;  4NRB A;  4YYK A;  5LVQ A;  5HCL A;  4YH3 A;  5EWH A;  4O78 A;  5E9Y A;  4BW3 A;  2YEM A;  5HM0 A;  1X0J A;  2E3K A;  4NUC A;  2DVQ A;  3MB3 A;  5D24 A;  4LYI A;  5CUC A;  5E3G A;  4A9O A;  4WIV A;  5H1T A;  3MB4 A;  5I86 A;  1WUG A;  5AD3 A;  3MXF A;  3LQH A;  5LJ1 A;  4ZC9 A;  4WHU A;  4QSP A;  4RVR A;  5BT4 A;  5CUA A;  4IR3 A;  5EK9 A; 
#chains in the Genus database with same CATH homology
 2RNW A;  5EI4 A;  4A9E A;  4YYH A;  5EM3 A;  5ENE A;  4UIU A;  4YAX A;  5A7C A;  4HXO A;  3QZS A;  5I83 A;  4PY6 A;  5DKH A;  5DKC A;  4PCI A;  4IOO A;  4QEU A;  5A5O A;  5I88 A;  2DVR A;  4GPJ A;  5D3L A;  5DLX A;  4TQN A;  4TYL A;  2YEL A;  5DYC A;  4Z1Q A;  2RI7 A;  5CP5 A;  4E96 A;  4QR5 A;  5DX4 A;  5EWV A;  5H85 A;  4O7F A;  4O70 A;  4MEP A;  4J1P A;  5CZG A;  4A9N A;  4CUS A;  4Z93 A;  1E6I A;  5JI8 A;  4TT6 A;  5DFD A;  4QSW A;  4YYM A;  3P5O A;  2LSP B;  4YAT A;  4HXR A;  5DYA A;  4UYD A;  5CQT A;  5ENG A;  4TU6 A;  3U5O A;  5II2 A;  3O34 A;  2F6J A;  5A5R A;  4O75 A;  4LYW A;  4C66 A;  4ALG A;  4CUQ A;  4MR3 A;  3G0J A;  5LKZ A;  4PS5 A;  5FB0 A;  5F61 A;  5DLZ A;  5FE8 A;  4QUT A;  4IR5 A;  5E73 A;  4A9K A;  4HXP A;  3P1C A;  3QZT A;  4YYD A;  4QEV A;  3U5K A;  3IU6 A;  5HEN A;  5DW1 A;  5LUU A;  3HMF A;  4QR3 A;  1JSP B;  5HFQ A;  3AAD A;  5E9V A;  4QSX A;  4PKL A;  4BW1 A;  5FE0 A;  4UYH A;  5EWC A;  4CLB A;  4O7C A;  5FFY A;  5I89 A;  3HMH A;  5ETB A;  4HXL A;  4LZ2 A;  3S91 A;  5CQ8 A;  3JVM A;  5EPS A;  4ZW1 A;  3I3J A;  2R0V A;  4XY8 A;  5F1H A;  4BJX A;  4QYD A;  5LVR A;  4YBT A;  5LJ0 A;  4MR4 A;  5CU8 A;  4A9F A;  3RCW A;  4CUR A;  5FH7 A;  3MUL A;  5L8T A;  4O7B A;  3U5P A;  2GRC A;  4MR6 A;  5D3N A;  5FH6 A;  2L85 A;  3O36 A;  4HXM A;  4QNS A;  4J0R A;  2F6N A;  4HBW A;  5E7D A;  5CQ7 A;  5I7X A;  5CPE A;  4UYF A;  5J0D A;  3LJW A;  5KU3 A;  5E3D A;  5LKT A;  4NR5 A;  4NUD A;  4Z1S A;  5A82 A;  4LR6 A;  2E7N A;  3JVK A;  5I1Q A;  4XYA A;  2R0S A;  5IG6 A;  2G4A A;  4LRG A;  4UYF B;  4O71 A;  4QB3 A;  3LXJ A;  5HRV A;  5G4S A;  3UV2 A;  3MQM A;  3P1D A;  3UV4 A;  5E74 A;  5L96 A;  1EQF A;  5E9I A;  5CUD A;  5F2P A;  5FG4 A;  3UVY A;  2RO1 A;  5D3S A;  2I7K A;  5DFC A;  4CUP A;  2RNY A;  5ENB A;  5TCM A;  4YY4 A;  5IGL A;  2DVS A;  4BHW A;  3NXB A;  4HBY A;  5TB6 A;  4LDF A;  5EWD A;  5EP7 A;  2OO1 A;  4YH4 A;  5A5N A;  3AQA A;  2NXB A;  2YYN A;  5LKX A;  5AMF A;  4N3W A;  5CUE A;  2DKW A;  5CQ5 A;  5D25 A;  5C7N A;  4YAD A;  5EIC A;  4NR9 A;  5D3J A;  2KTB B;  3U5M A;  5HRX A;  3DAI A;  2DWW A;  4TZ2 A;  3SVH A;  2WP1 A;  5EPR A;  2D9E A;  5L98 A;  4CUT A;  4NRA A;  5II1 A;  3P1F A;  4KV1 A;  5CQA A;  3D7C A;  4UIZ A;  5KTX A;  5C89 A;  5FDZ A;  4UIX A;  5AME A;  5HEL A;  4Z6H A;  3JVJ A;  4Z6I A;  5C85 A;  5D0C A;  5L97 A;  5D3R A;  4LZS A;  3UW9 A;  5KTW A;  3UVD A;  2L5E A;  5CRM A;  5F25 A;  5LJ2 A;  4LC2 A;  5CUB A;  4O76 A;  3G0L A;  4KV4 A;  4N4I A;  5I40 A;  4UIY A;  5KTU A;  4Y03 A;  4HXS A;  5FE1 A;  3ZYU A;  4NYX A;  5EU1 A;  5D3T A;  4NR8 A;  4YYG A;  4YYI A;  5E9K A;  5FE9 A;  5I29 A;  4HXK A;  1F68 A;  5FBX A;  5ETD A;  4YYN A;  4UIV A;  5ACY A;  4QYL A;  5DKD A;  5DY7 A;  5CUG A;  2E7O A;  4NR4 A;  5HLS A;  3GG3 A;  5KHM A;  5IBN A;  4OGI A;  3Q2F A;  4NR6 A;  3DWY A;  4YBS A;  5IGN A;  4TT2 A;  2RFJ A;  2D82 A;  5C8G A;  3S92 A;  4A9M A;  4QSR A;  5DW2 A;  2I8N A;  4QC1 A;  4ALH A;  4IOR A;  5F36 A;  4QSU A;  5ENF A;  2OUO A;  5EQ1 A;  4A9J A;  5A81 A;  4F3I A;  4NQN A;  5EIS A;  4OUF A;  4QSS A;  5A5P A;  5CRZ A;  4PTB A;  5E9M A;  4UIW A;  4J0S A;  5L8U A;  2DVV A;  4MR5 A;  5LKU A;  5C87 A;  4QY4 A;  5HEM A;  5HRW A;  5FG5 A;  4O77 A;  2MJV B;  5G4R A;  4O7E A;  5EVA A;  4QUU A;  4CUU A;  4TZ8 A;  5DBM A;  5EV9 A;  5A83 A;  5FB1 A;  5CY9 A;  4QR4 A;  4X2I A;  4CL9 A;  5EWW A;  5FFW A;  2RNX A;  4QSQ A;  5F1L A;  4N4H A;  4QEW A;  5DYX A;  5HJC A;  4MEN A;  5FE3 A;  5I80 A;  2N9G A;  5HFR A;  3P1E A;  5DYU A;  4A9I A;  5A5S A;  4NUE A;  3FKM X;  4XUB A;  4DON A;  5F60 A;  5FE2 A;  3O35 A;  5D26 A;  5CFW A;  3SVF A;  4IR6 A;  4BW2 A;  5F63 A;  5CQ4 A;  4XY9 A;  4CFK A;  4C67 A;  5C4Q A;  2RS9 B;  4O74 A;  4FLP A;  5HQ6 A;  5A5Q A;  2YW5 A;  2H60 A;  5F3A A;  3SVG A;  3MUK A;  4NQM A;  5E9L A;  5JWM A;  5CS8 A;  3U5L A;  3IU5 A;  4HBX A;  2OSS A;  4Q0N A;  5BT5 A;  5IID A;  4HXN A;  5ENJ A;  4NS5 A;  4TS8 A;  4J3I A;  4A9L A;  4QSV A;  4QBM A;  2YDW A;  1JM4 B;  5ENC A;  3LQJ A;  4YK0 A;  4ZQL A;  3U5J A;  3Q2E A;  2FSA A;  2R0Y A;  4QST A;  3O33 A;  4QC3 A;  2YEK A;  3HME A;  4TT4 A;  4O72 A;  5EGU A;  5D3P A;  4CFL A;  4UYG A;  4MEQ A;  4LZR A;  5CTL A;  5H1U A;  4NYV A;  3ONI A;  4WHW A;  1ZS5 A;  4LYS A;  5FH8 A;  5ENI A;  4YYJ A;  5EA1 A;  4O7A A;  5CQ3 A;  5L99 A;  4TU4 A;  3JVL A;  4N4F A;  4YAB A;  2WP2 A;  5KO4 A;  3O37 A;  5E0R A;  5BT3 A;  4KCX A;  4MEO A;  4HBV A;  5FE5 A;  5I7Y A;  4Q0O A;  1N72 A;  5FE6 A;  5H1V A;  4OGJ A;  2R10 A;  4UIT A;  4BW4 A;  4A9H A;  4YBM A;  5DFB A;  3K2J A;  5D3H A;  4UYE A;  5CGP A;  4N4G A;  4NR7 A;  5FFV A;  5CQ6 A;  4TTE A;  3LQI A;  5AD2 A;  5COI A;  2L84 A;  4NXJ A;  4AKN A;  3TLP A;  5IGK A;  5HQ7 A;  5K29 A;  3QZV A;  5F62 A;  3UV5 A;  5FG6 A;  4NYW A;  1WUM A;  4IR4 A;  5FE4 A;  5IGM A;  5A85 A;  4NRC A;  5FE7 A;  3UVX A;  2YQD A;  4PCE A;  5F5Z A;  5D7X A;  4IOQ A;  4YC9 A;  5EPB A;  4QZS A;  5ENH A;  5HQ5 A;  3UVW A;  4XUA A;  4YY6 A;  3U5N A;  2DAT A;  4NRB A;  4YYK A;  5LVQ A;  5HCL A;  4YH3 A;  5EWH A;  4O78 A;  5E9Y A;  4BW3 A;  2YEM A;  5HM0 A;  1X0J A;  2E3K A;  4NUC A;  2DVQ A;  3MB3 A;  5D24 A;  4LYI A;  5CUC A;  5E3G A;  4A9O A;  4WIV A;  5H1T A;  3MB4 A;  5I86 A;  1WUG A;  5AD3 A;  3MXF A;  3LQH A;  5LJ1 A;  4ZC9 A;  4WHU A;  4QSP A;  4RVR A;  5BT4 A;  5CUA A;  4IR3 A;  5EK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...