2L5EA

Complex between bd1 of brd3 and gata-1 c-tail
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
127
structure length
127
Chain Sequence
PLGSEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 3
publication title Structural basis and specificity of acetylated transcription factor GATA1 recognition by BET family bromodomain protein Brd3.
pubmed doi rcsb
source organism Mus musculus
molecule tags Nuclear protein/transcription
total genus 40
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2l5eA01
4YBTA 5TCMA 2LSPB 5DKCA 2YQDA 4O72A 4AKNA 3UVYA 4NYXA 3P1FA 4O76A 3IU6A 5FE0A 4O71A 5EQ1A 5DYAA 3O35A 4TT2A 5I83A 5HFQA 4ALGA 5CU8A 5HJCA 5ENBA 5LJ1A 5C8GA 4PY6A 4TU6A 5FH8A 5TB6A 5G4SA 4Y03A 5FG5A 4OGIA 4WHWA 5HLSA 4LZSA 5FFWA 5FE7A 2L85A 5FE6A 3UV2A 5EWVA 2F6NA 4UYGA 2E3KA 4QC1A 4A9HA 4YYMA 4UITA 5DYUA 4FLPA 5FBXA 4BW3A 5KTWA 4QZSA 5F62A 4TS8A 3ONIA 3MUKA 2R0YA 5IBNA 4UYFA 5CUEA 5DYCA 5A82A 4NRBA 4Z1SA 5FG4A 3LQHA 4QSPA 5HRWA 4YAXA 4HXNA 5K29A 1WUMA 4NR5A 4KV4A 5BT3A 3P1CA 4CLBA 2YW5A 5F63A 3U5PA 2L5EA 4QSRA 3Q2FA 2RFJA 4KV1A 5FB1A 3LJWA 5KHMA 4YY4A 4TT6A 4MR3A 4LR6A 4QSXA 5FFVA 5EWCA 4QBMA 4QUUA 3NXBA 3JVKA 5I7YA 3SVGA 5KTXA 4MEOA 4CURA 3U5LA 3UVDA 4NYVA 5KU3A 4QYDA 4O77A 5IGMA 4O74A 3QZTA 2WP1A 5FE3A 4C66A 4HXMA 4TU4A 5A5RA 2RNYA 3HMHA 4A9OA 5HM0A 4UIYA 4YYKA 2D82A 5D26A 4QEWA 3HMEA 4LYIA 3U5NA 5F25A 3UVWA 2YEKA 4CUUA 5ENIA 4QC3A 3O33A 5FE5A 5DY7A 4IOQA 4XUBA 4A9IA 1E6IA 5BT4A 5E0RA 4LRGA 5ENHA 4A9JA 4N4IA 5EWWA 4N4HA 4YYNA 4O70A 4NR8A 3LXJA 4YATA 4QR3A 5CTLA 3JVLA 4HBWA 4UYFB 5EM3A 4CUSA 1X0JA 2YEMA 2RS9B 4ZC9A 5CQ4A 5D0CA 4PKLA 5A5OA 5H1TA 4TQNA 4YBSA 5LVQA 3DAIA 2E7OA 3SVHA 4UIXA 5D3LA 5FDZA 3O36A 4HXLA 5D3JA 4YK0A 4ALHA 5DKHA 4HXRA 5FE4A 4HBXA 5A81A 4BW1A 4CFLA 5FE1A 5HFRA 4TYLA 4O7CA 5EWHA 4XY8A 4NYWA 4Q0OA 5LKXA 5JWMA 5FE2A 4YADA 4QY4A 4UYDA 4NR7A 4NRCA 5D24A 5E73A 4QR5A 5KO4A 5DFBA 3LQJA 4NQNA 4UIUA 5HQ5A 4J1PA 5CQAA 4QSVA 5I88A 5IGLA 2RNXA 2DVRA 4LDFA 4QSWA 5D3PA 4A9NA 2RNWA 5CRZA 5AD2A 5I1QA 4Z93A 3I3JA 5DW2A 5CPEA 4PTBA 4MR6A 5HQ7A 4J3IA 2R0SA 5DLXA 5F36A 5IGNA 4HBYA 3U5JA 3SVFA 4PCEA 3D7CA 4IR5A 5L96A 4A9MA 2OUOA 5ENFA 4IORA 4YC9A 3O37A 2KTBB 5LJ2A 2N9GA 5C85A 4UIVA 3U5KA 4A9EA 4A9FA 5E9KA 4MENA 4Z6IA 4CFKA 5CUBA 5EPRA 4WIVA 3U5OA 5F61A 4QUTA 5D3TA 5A5NA 3ZYUA 5FB0A 4YYDA 5HQ6A 4NUDA 4YBMA 3U5MA 4YYJA 4NR6A 5L8UA 4LC2A 5COIA 4TTEA 5H85A 5CQ8A 5II2A 3FKMX 5CQ7A 5E9IA 4BW2A 3MXFA 4NRAA 5L99A 5BT5A 2DKWA 2RI7A 4N4GA 5F3AA 4HBVA 2DATA 3UW9A 5CZGA 4F3IA 4N3WA 4HXKA 5FE9A 5E74A 5II1A 4NQMA 2OSSA 4QNSA 5F5ZA 5FE8A 3Q2EA 4GPJA 5CGPA 5LJ0A 3HMFA 2D9EA 5CS8A 4BW4A 4IOOA 3G0JA 4QB3A 5CFWA 1ZS5A 4KCXA 5A85A 4MEQA 5CY9A 4YYIA 5CQ6A 5A5QA 5ACYA 5FG6A 5CQ3A 4QSUA 5E9LA 2DWWA 5E9MA 4Q0NA 4A9LA 4CL9A 2R10A 4O7AA 4TZ8A 5JI8A 4LYWA 3O34A 4MEPA 4ZQLA 4Z6HA 5IGKA 1N72A 5I89A 5D25A 5HEMA 5F2PA 3LQIA 2YELA 4C67A 4DONA 3MB4A 5E7DA 4UIZA 3S91A 5HELA 2YDWA 5KTUA 5C87A 3G0LA 5LVRA 4O75A 5DKDA 5EWDA 5F1HA 5EA1A 4QEVA 2WP2A 3TLPA 5C4QA 5LKTA 4UIWA 4CUQA 5I29A 4YABA 5DBMA 4IR6A 5H1UA 4MR5A 4HXOA 5L98A 5J0DA 3MULA 4WHUA 3IU5A 4XYAA 3S92A 5IIDA 5EP7A 5EPSA 5EVAA 2OO1A 5D7XA 5FFYA 5H1VA 1F68A 2MJVB 4TZ2A 5DX4A 5EICA 5EPBA 5ENGA 5A5PA 3K2JA 5CUCA 4HXSA 4N4FA 5ENEA 5DFDA 4YYHA 5DW1A 5ETBA 5CP5A 5EV9A 4XY9A 5F60A 3AQAA 5F1LA 4IR3A 4NXJA 3JVMA 4E96A 2I8NA 5L97A 4NUCA 5C7NA 2R0VA 2RO1A 5G4RA 5EISA 5EI4A 3P5OA 5HRVA 4CUPA 2L84A 5D3RA 2NXBA 5A5SA 3QZSA 4A9KA 5LUUA 2DVSA 5D3SA 4IR4A 5FH7A 4NR9A 5EGUA 3UV4A 4LZ2A 3DWYA 4NS5A 4O78A 4QSSA 5HCLA 5I86A 3JVJA 4QYLA 4UYEA 5EK9A 5D3NA 4YYGA 4YY6A 4QR4A 3MQMA 3GG3A 4HXPA 5ETDA 4YH3A 4J0RA 2FSAA 2I7KA 4QSTA 5LKZA 5E9VA 1EQFA 5ENJA 5I80A 1WUGA 4LYSA 5L8TA 2G4AA 4O7EA 4OUFA 5E3GA 5CUGA 4TT4A 4RVRA 2DVQA 2E7NA 4YH4A 5AMFA 4CUTA 5HRXA 5A83A 3RCWA 3P1EA 4O7FA 5ENCA 5E3DA 5DYXA 5IG6A 5EU1A 5CUDA 4XUAA 5CQ5A 5HENA 4PCIA 4ZW1A 3AADA 4PS5A 5DFCA 5D3HA 4NUEA 2GRCA 4QEUA 5CRMA 3UVXA 5A7CA 5DLZA 1JM4B 4MR4A 2H60A 5CUAA 5CQTA 4BJXA 2F6JA 3MB3A 5LKUA 5E9YA 5I7XA 4Z1QA 3UV5A 4UYHA 5I40A 4BHWA 5AD3A 3P1DA 4O7BA 1JSPB 5C89A 3QZVA 4X2IA 2DVVA 5FH6A 4QSQA 4OGJA 2YYNA 4J0SA 4NR4A 5AMEA 4LZRA
chains in the Genus database with same CATH superfamily
4YBTA 5TCMA 2LSPB 5DKCA 2YQDA 4O72A 4AKNA 3UVYA 4NYXA 3P1FA 4O76A 3IU6A 5FE0A 4O71A 5EQ1A 5DYAA 3O35A 4TT2A 2EJNA 5I83A 5HFQA 4ALGA 5CU8A 5HJCA 5ENBA 5LJ1A 5C8GA 3ERRA 4PY6A 4TU6A 5FH8A 5TB6A 5G4SA 4Y03A 5FG5A 4OGIA 4WHWA 5HLSA 4LZSA 5FFWA 5FE7A 2L85A 5FE6A 3UV2A 5EWVA 2F6NA 4UYGA 2E3KA 4QC1A 4A9HA 4YYMA 4UITA 5DYUA 4FLPA 5FBXA 4BW3A 5KTWA 4QZSA 5F62A 4TS8A 3ONIA 3MUKA 2R0YA 5IBNA 4UYFA 5CUEA 5DYCA 5A82A 4NRBA 4Z1SA 5FG4A 3LQHA 4QSPA 5HRWA 4YAXA 4HXNA 5K29A 1WUMA 4NR5A 4KV4A 5BT3A 3P1CA 4CLBA 2YW5A 5F63A 3U5PA 2L5EA 4QSRA 3Q2FA 2RFJA 4KV1A 5FB1A 3LJWA 5KHMA 4YY4A 4TT6A 4MR3A 4LR6A 4QSXA 5FFVA 5EWCA 4QBMA 4QUUA 3NXBA 3JVKA 5I7YA 3SVGA 5KTXA 3VKGA 4MEOA 4CURA 3U5LA 3UVDA 4NYVA 4AKGA 5KU3A 4QYDA 4O77A 5IGMA 4O74A 3QZTA 2WP1A 5FE3A 4C66A 4HXMA 4TU4A 5A5RA 2RNYA 3HMHA 4A9OA 5HM0A 4UIYA 4YYKA 2D82A 5D26A 4QEWA 3HMEA 4LYIA 3U5NA 5F25A 3UVWA 2YEKA 4CUUA 5ENIA 4QC3A 3O33A 5FE5A 5DY7A 4IOQA 4XUBA 4A9IA 1E6IA 5BT4A 5E0RA 4LRGA 5ENHA 4A9JA 4N4IA 5EWWA 4N4HA 4YYNA 4O70A 4NR8A 3LXJA 4YATA 4QR3A 5CTLA 3JVLA 4HBWA 4UYFB 5EM3A 4CUSA 1X0JA 2YEMA 2RS9B 4ZC9A 5CQ4A 5D0CA 4PKLA 5A5OA 5H1TA 4TQNA 4YBSA 5LVQA 3DAIA 2E7OA 3SVHA 4UIXA 5D3LA 5FDZA 3O36A 4HXLA 5D3JA 4YK0A 4ALHA 5DKHA 4HXRA 5FE4A 4HBXA 5A81A 4BW1A 4CFLA 5FE1A 5HFRA 4TYLA 4O7CA 5EWHA 4XY8A 4NYWA 4Q0OA 5LKXA 5JWMA 5FE2A 4YADA 4QY4A 4UYDA 4NR7A 4NRCA 5D24A 5E73A 4QR5A 5KO4A 5DFBA 3LQJA 4NQNA 4UIUA 5HQ5A 4J1PA 5CQAA 4QSVA 5I88A 5IGLA 2RNXA 2DVRA 4LDFA 4QSWA 5D3PA 4A9NA 2RNWA 5CRZA 5AD2A 5I1QA 4Z93A 3I3JA 5DW2A 5CPEA 4PTBA 3VKHA 4MR6A 5HQ7A 4J3IA 2R0SA 3D1DA 5DLXA 5F36A 5IGNA 4HBYA 3U5JA 3SVFA 4PCEA 3D7CA 4IR5A 5L96A 4A9MA 2OUOA 5ENFA 4IORA 4YC9A 3O37A 3D1BA 2KTBB 5LJ2A 2N9GA 5C85A 4UIVA 3U5KA 4A9EA 4A9FA 5E9KA 4MENA 4Z6IA 4CFKA 5CUBA 5EPRA 4WIVA 3U5OA 5F61A 4QUTA 5D3TA 5A5NA 3ZYUA 5FB0A 4YYDA 5HQ6A 4NUDA 4YBMA 3U5MA 4YYJA 4NR6A 5L8UA 4LC2A 5COIA 4TTEA 5H85A 5CQ8A 5II2A 3FKMX 5CQ7A 5E9IA 4BW2A 3MXFA 4NRAA 5L99A 5BT5A 2DKWA 2RI7A 4N4GA 5F3AA 4HBVA 2DATA 3UW9A 5CZGA 4F3IA 4N3WA 4HXKA 5FE9A 5E74A 5II1A 4NQMA 2OSSA 4QNSA 5F5ZA 5FE8A 3Q2EA 4AI6A 4GPJA 5CGPA 5LJ0A 3HMFA 2D9EA 5CS8A 4BW4A 4IOOA 3G0JA 4QB3A 5CFWA 1ZS5A 4KCXA 5A85A 4MEQA 5CY9A 4YYIA 5CQ6A 5A5QA 5ACYA 5FG6A 5CQ3A 4QSUA 5E9LA 2DWWA 5E9MA 4Q0NA 4A9LA 4CL9A 2R10A 4O7AA 4TZ8A 5JI8A 4LYWA 3O34A 4MEPA 4ZQLA 4Z6HA 5IGKA 1N72A 5I89A 5D25A 5HEMA 5F2PA 3LQIA 2YELA 4C67A 4DONA 3MB4A 5E7DA 4UIZA 3S91A 5HELA 2YDWA 1ZKRA 5KTUA 5C87A 3G0LA 4AKHA 5LVRA 4O75A 5DKDA 5EWDA 5F1HA 5EA1A 4QEVA 2WP2A 3TLPA 5C4QA 5LKTA 4UIWA 4CUQA 5I29A 4YABA 5DBMA 4IR6A 5H1UA 4MR5A 4HXOA 5L98A 5J0DA 3MULA 4WHUA 3IU5A 4XYAA 3S92A 5IIDA 5EP7A 5EPSA 5EVAA 2OO1A 5D7XA 5FFYA 5H1VA 1F68A 2MJVB 4TZ2A 5DX4A 5EICA 5EPBA 5ENGA 5A5PA 3K2JA 5CUCA 4HXSA 4N4FA 5ENEA 5DFDA 4YYHA 5DW1A 5ETBA 5CP5A 5EV9A 4XY9A 5F60A 3AQAA 5F1LA 4IR3A 4NXJA 3JVMA 4E96A 2I8NA 5L97A 4NUCA 5C7NA 2R0VA 2RO1A 5G4RA 5EISA 5EI4A 3P5OA 5HRVA 4CUPA 2L84A 5D3RA 2NXBA 5A5SA 3QZSA 4A9KA 5LUUA 2DVSA 5D3SA 4IR4A 5FH7A 4NR9A 5EGUA 3UV4A 4LZ2A 3DWYA 4NS5A 4O78A 4QSSA 5HCLA 5I86A 3JVJA 4QYLA 4UYEA 5EK9A 5D3NA 4YYGA 4YY6A 4QR4A 4AKIA 3MQMA 3GG3A 4HXPA 5ETDA 4YH3A 4J0RA 2FSAA 2I7KA 4QSTA 5LKZA 5E9VA 1EQFA 5ENJA 5I80A 1WUGA 4LYSA 5L8TA 2G4AA 4O7EA 4OUFA 5E3GA 5CUGA 4TT4A 4RVRA 2DVQA 2E7NA 4YH4A 5AMFA 4CUTA 5HRXA 5A83A 3RCWA 3P1EA 4O7FA 5ENCA 5E3DA 5DYXA 5IG6A 5EU1A 5CUDA 4XUAA 5CQ5A 5HENA 4PCIA 4ZW1A 3AADA 4PS5A 5DFCA 5D3HA 4NUEA 2GRCA 4QEUA 5CRMA 3UVXA 5A7CA 5DLZA 1JM4B 4MR4A 2H60A 5CUAA 1PUOA 5CQTA 4BJXA 2F6JA 3MB3A 5LKUA 5E9YA 5I7XA 4Z1QA 3UV5A 4UYHA 5I40A 4BHWA 5AD3A 3P1DA 4O7BA 1JSPB 5C89A 3QZVA 4X2IA 2DVVA 5FH6A 4QSQA 4OGJA 2YYNA 4J0SA 4NR4A 5AMEA 4LZRA
chains in the Genus database with same CATH topology
4YBTA 5TCMA 2LSPB 5DKCA 2YQDA 4O72A 4AKNA 3UVYA 4NYXA 3P1FA 4O76A 3IU6A 5FE0A 4O71A 5EQ1A 5DYAA 3O35A 4TT2A 5I83A 5HFQA 4ALGA 5CU8A 5HJCA 5ENBA 5LJ1A 5C8GA 4PY6A 4TU6A 5FH8A 5TB6A 5G4SA 4Y03A 5FG5A 4OGIA 4WHWA 5HLSA 4LZSA 5FFWA 5FE7A 2L85A 5FE6A 3UV2A 5EWVA 2F6NA 4UYGA 2E3KA 4QC1A 4A9HA 4YYMA 4UITA 5DYUA 4FLPA 5FBXA 4BW3A 5KTWA 4QZSA 5F62A 4TS8A 3ONIA 3MUKA 2R0YA 5IBNA 4UYFA 5CUEA 5DYCA 5A82A 4NRBA 4Z1SA 5FG4A 3LQHA 4QSPA 5HRWA 4YAXA 4HXNA 5K29A 1WUMA 4NR5A 4KV4A 5BT3A 3P1CA 4CLBA 2YW5A 5F63A 3U5PA 2L5EA 4QSRA 3Q2FA 2RFJA 4KV1A 5FB1A 3LJWA 5KHMA 4YY4A 4TT6A 4MR3A 4LR6A 4QSXA 5FFVA 5EWCA 4QBMA 4QUUA 3NXBA 3JVKA 5I7YA 3SVGA 5KTXA 4MEOA 4CURA 3U5LA 3UVDA 4NYVA 5KU3A 4QYDA 4O77A 5IGMA 4O74A 3QZTA 2WP1A 5FE3A 4C66A 4HXMA 4TU4A 5A5RA 2RNYA 3HMHA 4A9OA 5HM0A 4UIYA 4YYKA 2D82A 5D26A 4QEWA 3HMEA 4LYIA 3U5NA 5F25A 3UVWA 2YEKA 4CUUA 5ENIA 4QC3A 3O33A 5FE5A 5DY7A 4IOQA 4XUBA 4A9IA 1E6IA 5BT4A 5E0RA 4LRGA 5ENHA 4A9JA 4N4IA 5EWWA 4N4HA 4YYNA 4O70A 4NR8A 3LXJA 4YATA 4QR3A 5CTLA 3JVLA 4HBWA 4UYFB 5EM3A 4CUSA 1X0JA 2YEMA 2RS9B 4ZC9A 5CQ4A 5D0CA 4PKLA 5A5OA 5H1TA 4TQNA 4YBSA 5LVQA 3DAIA 2E7OA 3SVHA 4UIXA 5D3LA 5FDZA 3O36A 4HXLA 5D3JA 4YK0A 4ALHA 5DKHA 4HXRA 5FE4A 4HBXA 5A81A 4BW1A 4CFLA 5FE1A 5HFRA 4TYLA 4O7CA 5EWHA 4XY8A 4NYWA 4Q0OA 5LKXA 5JWMA 5FE2A 4YADA 4QY4A 4UYDA 4NR7A 4NRCA 5D24A 5E73A 4QR5A 5KO4A 5DFBA 3LQJA 4NQNA 4UIUA 5HQ5A 4J1PA 5CQAA 4QSVA 5I88A 5IGLA 2RNXA 2DVRA 4LDFA 4QSWA 5D3PA 4A9NA 2RNWA 5CRZA 5AD2A 5I1QA 4Z93A 3I3JA 5DW2A 5CPEA 4PTBA 4MR6A 5HQ7A 4J3IA 2R0SA 5DLXA 5F36A 5IGNA 4HBYA 3U5JA 3SVFA 4PCEA 3D7CA 4IR5A 5L96A 4A9MA 2OUOA 5ENFA 4IORA 4YC9A 3O37A 2KTBB 5LJ2A 2N9GA 5C85A 4UIVA 3U5KA 4A9EA 4A9FA 5E9KA 4MENA 4Z6IA 4CFKA 5CUBA 5EPRA 4WIVA 3U5OA 5F61A 4QUTA 5D3TA 5A5NA 3ZYUA 5FB0A 4YYDA 5HQ6A 4NUDA 4YBMA 3U5MA 4YYJA 4NR6A 5L8UA 4LC2A 5COIA 4TTEA 5H85A 5CQ8A 5II2A 3FKMX 5CQ7A 5E9IA 4BW2A 3MXFA 4NRAA 5L99A 5BT5A 2DKWA 2RI7A 4N4GA 5F3AA 4HBVA 2DATA 3UW9A 5CZGA 4F3IA 4N3WA 4HXKA 5FE9A 5E74A 5II1A 4NQMA 2OSSA 4QNSA 5F5ZA 5FE8A 3Q2EA 4GPJA 5CGPA 5LJ0A 3HMFA 2D9EA 5CS8A 4BW4A 4IOOA 3G0JA 4QB3A 5CFWA 1ZS5A 4KCXA 5A85A 4MEQA 5CY9A 4YYIA 5CQ6A 5A5QA 5ACYA 5FG6A 5CQ3A 4QSUA 5E9LA 2DWWA 5E9MA 4Q0NA 4A9LA 4CL9A 2R10A 4O7AA 4TZ8A 5JI8A 4LYWA 3O34A 4MEPA 4ZQLA 4Z6HA 5IGKA 1N72A 5I89A 5D25A 5HEMA 5F2PA 3LQIA 2YELA 4C67A 4DONA 3MB4A 5E7DA 4UIZA 3S91A 5HELA 2YDWA 5KTUA 5C87A 3G0LA 5LVRA 4O75A 5DKDA 5EWDA 5F1HA 5EA1A 4QEVA 2WP2A 3TLPA 5C4QA 5LKTA 4UIWA 4CUQA 5I29A 4YABA 5DBMA 4IR6A 5H1UA 4MR5A 4HXOA 5L98A 5J0DA 3MULA 4WHUA 3IU5A 4XYAA 3S92A 5IIDA 5EP7A 5EPSA 5EVAA 2OO1A 5D7XA 5FFYA 5H1VA 1F68A 2MJVB 4TZ2A 5DX4A 5EICA 5EPBA 5ENGA 5A5PA 3K2JA 5CUCA 4HXSA 4N4FA 5ENEA 5DFDA 4YYHA 5DW1A 5ETBA 5CP5A 5EV9A 4XY9A 5F60A 3AQAA 5F1LA 4IR3A 4NXJA 3JVMA 4E96A 2I8NA 5L97A 4NUCA 5C7NA 2R0VA 2RO1A 5G4RA 5EISA 5EI4A 3P5OA 5HRVA 4CUPA 2L84A 5D3RA 2NXBA 5A5SA 3QZSA 4A9KA 5LUUA 2DVSA 5D3SA 4IR4A 5FH7A 4NR9A 5EGUA 3UV4A 4LZ2A 3DWYA 4NS5A 4O78A 4QSSA 5HCLA 5I86A 3JVJA 4QYLA 4UYEA 5EK9A 5D3NA 4YYGA 4YY6A 4QR4A 3MQMA 3GG3A 4HXPA 5ETDA 4YH3A 4J0RA 2FSAA 2I7KA 4QSTA 5LKZA 5E9VA 1EQFA 5ENJA 5I80A 1WUGA 4LYSA 5L8TA 2G4AA 4O7EA 4OUFA 5E3GA 5CUGA 4TT4A 4RVRA 2DVQA 2E7NA 4YH4A 5AMFA 4CUTA 5HRXA 5A83A 3RCWA 3P1EA 4O7FA 5ENCA 5E3DA 5DYXA 5IG6A 5EU1A 5CUDA 4XUAA 5CQ5A 5HENA 4PCIA 4ZW1A 3AADA 4PS5A 5DFCA 5D3HA 4NUEA 2GRCA 4QEUA 5CRMA 3UVXA 5A7CA 5DLZA 1JM4B 4MR4A 2H60A 5CUAA 5CQTA 4BJXA 2F6JA 3MB3A 5LKUA 5E9YA 5I7XA 4Z1QA 3UV5A 4UYHA 5I40A 4BHWA 5AD3A 3P1DA 4O7BA 1JSPB 5C89A 3QZVA 4X2IA 2DVVA 5FH6A 4QSQA 4OGJA 2YYNA 4J0SA 4NR4A 5AMEA 4LZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YBT A;  5TCM A;  2LSP B;  5DKC A;  2YQD A;  4O72 A;  4AKN A;  3UVY A;  4NYX A;  3P1F A;  4O76 A;  3IU6 A;  5FE0 A;  4O71 A;  5EQ1 A;  5DYA A;  3O35 A;  4TT2 A;  5I83 A;  5HFQ A;  4ALG A;  5CU8 A;  5HJC A;  5ENB A;  5LJ1 A;  5C8G A;  4PY6 A;  4TU6 A;  5FH8 A;  5TB6 A;  5G4S A;  4Y03 A;  5FG5 A;  4OGI A;  4WHW A;  5HLS A;  4LZS A;  5FFW A;  5FE7 A;  2L85 A;  5FE6 A;  3UV2 A;  5EWV A;  2F6N A;  4UYG A;  2E3K A;  4QC1 A;  4A9H A;  4YYM A;  4UIT A;  5DYU A;  4FLP A;  5FBX A;  4BW3 A;  5KTW A;  4QZS A;  5F62 A;  4TS8 A;  3ONI A;  3MUK A;  2R0Y A;  5IBN A;  4UYF A;  5CUE A;  5DYC A;  5A82 A;  4NRB A;  4Z1S A;  5FG4 A;  3LQH A;  4QSP A;  5HRW A;  4YAX A;  4HXN A;  5K29 A;  1WUM A;  4NR5 A;  4KV4 A;  5BT3 A;  3P1C A;  4CLB A;  2YW5 A;  5F63 A;  3U5P A;  2L5E A;  4QSR A;  3Q2F A;  2RFJ A;  4KV1 A;  5FB1 A;  3LJW A;  5KHM A;  4YY4 A;  4TT6 A;  4MR3 A;  4LR6 A;  4QSX A;  5FFV A;  5EWC A;  4QBM A;  4QUU A;  3NXB A;  3JVK A;  5I7Y A;  3SVG A;  5KTX A;  4MEO A;  4CUR A;  3U5L A;  3UVD A;  4NYV A;  5KU3 A;  4QYD A;  4O77 A;  5IGM A;  4O74 A;  3QZT A;  2WP1 A;  5FE3 A;  4C66 A;  4HXM A;  4TU4 A;  5A5R A;  2RNY A;  3HMH A;  4A9O A;  5HM0 A;  4UIY A;  4YYK A;  2D82 A;  5D26 A;  4QEW A;  3HME A;  4LYI A;  3U5N A;  5F25 A;  3UVW A;  2YEK A;  4CUU A;  5ENI A;  4QC3 A;  3O33 A;  5FE5 A;  5DY7 A;  4IOQ A;  4XUB A;  4A9I A;  1E6I A;  5BT4 A;  5E0R A;  4LRG A;  5ENH A;  4A9J A;  4N4I A;  5EWW A;  4N4H A;  4YYN A;  4O70 A;  4NR8 A;  3LXJ A;  4YAT A;  4QR3 A;  5CTL A;  3JVL A;  4HBW A;  4UYF B;  5EM3 A;  4CUS A;  1X0J A;  2YEM A;  2RS9 B;  4ZC9 A;  5CQ4 A;  5D0C A;  4PKL A;  5A5O A;  5H1T A;  4TQN A;  4YBS A;  5LVQ A;  3DAI A;  2E7O A;  3SVH A;  4UIX A;  5D3L A;  5FDZ A;  3O36 A;  4HXL A;  5D3J A;  4YK0 A;  4ALH A;  5DKH A;  4HXR A;  5FE4 A;  4HBX A;  5A81 A;  4BW1 A;  4CFL A;  5FE1 A;  5HFR A;  4TYL A;  4O7C A;  5EWH A;  4XY8 A;  4NYW A;  4Q0O A;  5LKX A;  5JWM A;  5FE2 A;  4YAD A;  4QY4 A;  4UYD A;  4NR7 A;  4NRC A;  5D24 A;  5E73 A;  4QR5 A;  5KO4 A;  5DFB A;  3LQJ A;  4NQN A;  4UIU A;  5HQ5 A;  4J1P A;  5CQA A;  4QSV A;  5I88 A;  5IGL A;  2RNX A;  2DVR A;  4LDF A;  4QSW A;  5D3P A;  4A9N A;  2RNW A;  5CRZ A;  5AD2 A;  5I1Q A;  4Z93 A;  3I3J A;  5DW2 A;  5CPE A;  4PTB A;  4MR6 A;  5HQ7 A;  4J3I A;  2R0S A;  5DLX A;  5F36 A;  5IGN A;  4HBY A;  3U5J A;  3SVF A;  4PCE A;  3D7C A;  4IR5 A;  5L96 A;  4A9M A;  2OUO A;  5ENF A;  4IOR A;  4YC9 A;  3O37 A;  2KTB B;  5LJ2 A;  2N9G A;  5C85 A;  4UIV A;  3U5K A;  4A9E A;  4A9F A;  5E9K A;  4MEN A;  4Z6I A;  4CFK A;  5CUB A;  5EPR A;  4WIV A;  3U5O A;  5F61 A;  4QUT A;  5D3T A;  5A5N A;  3ZYU A;  5FB0 A;  4YYD A;  5HQ6 A;  4NUD A;  4YBM A;  3U5M A;  4YYJ A;  4NR6 A;  5L8U A;  4LC2 A;  5COI A;  4TTE A;  5H85 A;  5CQ8 A;  5II2 A;  3FKM X;  5CQ7 A;  5E9I A;  4BW2 A;  3MXF A;  4NRA A;  5L99 A;  5BT5 A;  2DKW A;  2RI7 A;  4N4G A;  5F3A A;  4HBV A;  2DAT A;  3UW9 A;  5CZG A;  4F3I A;  4N3W A;  4HXK A;  5FE9 A;  5E74 A;  5II1 A;  4NQM A;  2OSS A;  4QNS A;  5F5Z A;  5FE8 A;  3Q2E A;  4GPJ A;  5CGP A;  5LJ0 A;  3HMF A;  2D9E A;  5CS8 A;  4BW4 A;  4IOO A;  3G0J A;  4QB3 A;  5CFW A;  1ZS5 A;  4KCX A;  5A85 A;  4MEQ A;  5CY9 A;  4YYI A;  5CQ6 A;  5A5Q A;  5ACY A;  5FG6 A;  5CQ3 A;  4QSU A;  5E9L A;  2DWW A;  5E9M A;  4Q0N A;  4A9L A;  4CL9 A;  2R10 A;  4O7A A;  4TZ8 A;  5JI8 A;  4LYW A;  3O34 A;  4MEP A;  4ZQL A;  4Z6H A;  5IGK A;  1N72 A;  5I89 A;  5D25 A;  5HEM A;  5F2P A;  3LQI A;  2YEL A;  4C67 A;  4DON A;  3MB4 A;  5E7D A;  4UIZ A;  3S91 A;  5HEL A;  2YDW A;  5KTU A;  5C87 A;  3G0L A;  5LVR A;  4O75 A;  5DKD A;  5EWD A;  5F1H A;  5EA1 A;  4QEV A;  2WP2 A;  3TLP A;  5C4Q A;  5LKT A;  4UIW A;  4CUQ A;  5I29 A;  4YAB A;  5DBM A;  4IR6 A;  5H1U A;  4MR5 A;  4HXO A;  5L98 A;  5J0D A;  3MUL A;  4WHU A;  3IU5 A;  4XYA A;  3S92 A;  5IID A;  5EP7 A;  5EPS A;  5EVA A;  2OO1 A;  5D7X A;  5FFY A;  5H1V A;  1F68 A;  2MJV B;  4TZ2 A;  5DX4 A;  5EIC A;  5EPB A;  5ENG A;  5A5P A;  3K2J A;  5CUC A;  4HXS A;  4N4F A;  5ENE A;  5DFD A;  4YYH A;  5DW1 A;  5ETB A;  5CP5 A;  5EV9 A;  4XY9 A;  5F60 A;  3AQA A;  5F1L A;  4IR3 A;  4NXJ A;  3JVM A;  4E96 A;  2I8N A;  5L97 A;  4NUC A;  5C7N A;  2R0V A;  2RO1 A;  5G4R A;  5EIS A;  5EI4 A;  3P5O A;  5HRV A;  4CUP A;  2L84 A;  5D3R A;  2NXB A;  5A5S A;  3QZS A;  4A9K A;  5LUU A;  2DVS A;  5D3S A;  4IR4 A;  5FH7 A;  4NR9 A;  5EGU A;  3UV4 A;  4LZ2 A;  3DWY A;  4NS5 A;  4O78 A;  4QSS A;  5HCL A;  5I86 A;  3JVJ A;  4QYL A;  4UYE A;  5EK9 A;  5D3N A;  4YYG A;  4YY6 A;  4QR4 A;  3MQM A;  3GG3 A;  4HXP A;  5ETD A;  4YH3 A;  4J0R A;  2FSA A;  2I7K A;  4QST A;  5LKZ A;  5E9V A;  1EQF A;  5ENJ A;  5I80 A;  1WUG A;  4LYS A;  5L8T A;  2G4A A;  4O7E A;  4OUF A;  5E3G A;  5CUG A;  4TT4 A;  4RVR A;  2DVQ A;  2E7N A;  4YH4 A;  5AMF A;  4CUT A;  5HRX A;  5A83 A;  3RCW A;  3P1E A;  4O7F A;  5ENC A;  5E3D A;  5DYX A;  5IG6 A;  5EU1 A;  5CUD A;  4XUA A;  5CQ5 A;  5HEN A;  4PCI A;  4ZW1 A;  3AAD A;  4PS5 A;  5DFC A;  5D3H A;  4NUE A;  2GRC A;  4QEU A;  5CRM A;  3UVX A;  5A7C A;  5DLZ A;  1JM4 B;  4MR4 A;  2H60 A;  5CUA A;  5CQT A;  4BJX A;  2F6J A;  3MB3 A;  5LKU A;  5E9Y A;  5I7X A;  4Z1Q A;  3UV5 A;  4UYH A;  5I40 A;  4BHW A;  5AD3 A;  3P1D A;  4O7B A;  1JSP B;  5C89 A;  3QZV A;  4X2I A;  2DVV A;  5FH6 A;  4QSQ A;  4OGJ A;  2YYN A;  4J0S A;  4NR4 A;  5AME A;  4LZR A; 
#chains in the Genus database with same CATH topology
 4YBT A;  5TCM A;  2LSP B;  5DKC A;  2YQD A;  4O72 A;  4AKN A;  3UVY A;  4NYX A;  3P1F A;  4O76 A;  3IU6 A;  5FE0 A;  4O71 A;  5EQ1 A;  5DYA A;  3O35 A;  4TT2 A;  2EJN A;  5I83 A;  5HFQ A;  4ALG A;  5CU8 A;  5HJC A;  5ENB A;  5LJ1 A;  5C8G A;  3ERR A;  4PY6 A;  4TU6 A;  5FH8 A;  5TB6 A;  5G4S A;  4Y03 A;  5FG5 A;  4OGI A;  4WHW A;  5HLS A;  4LZS A;  5FFW A;  5FE7 A;  2L85 A;  5FE6 A;  3UV2 A;  5EWV A;  2F6N A;  4UYG A;  2E3K A;  4QC1 A;  4A9H A;  4YYM A;  4UIT A;  5DYU A;  4FLP A;  5FBX A;  4BW3 A;  5KTW A;  4QZS A;  5F62 A;  4TS8 A;  3ONI A;  3MUK A;  2R0Y A;  5IBN A;  4UYF A;  5CUE A;  5DYC A;  5A82 A;  4NRB A;  4Z1S A;  5FG4 A;  3LQH A;  4QSP A;  5HRW A;  4YAX A;  4HXN A;  5K29 A;  1WUM A;  4NR5 A;  4KV4 A;  5BT3 A;  3P1C A;  4CLB A;  2YW5 A;  5F63 A;  3U5P A;  2L5E A;  4QSR A;  3Q2F A;  2RFJ A;  4KV1 A;  5FB1 A;  3LJW A;  5KHM A;  4YY4 A;  4TT6 A;  4MR3 A;  4LR6 A;  4QSX A;  5FFV A;  5EWC A;  4QBM A;  4QUU A;  3NXB A;  3JVK A;  5I7Y A;  3SVG A;  5KTX A;  3VKG A;  4MEO A;  4CUR A;  3U5L A;  3UVD A;  4NYV A;  4AKG A;  5KU3 A;  4QYD A;  4O77 A;  5IGM A;  4O74 A;  3QZT A;  2WP1 A;  5FE3 A;  4C66 A;  4HXM A;  4TU4 A;  5A5R A;  2RNY A;  3HMH A;  4A9O A;  5HM0 A;  4UIY A;  4YYK A;  2D82 A;  5D26 A;  4QEW A;  3HME A;  4LYI A;  3U5N A;  5F25 A;  3UVW A;  2YEK A;  4CUU A;  5ENI A;  4QC3 A;  3O33 A;  5FE5 A;  5DY7 A;  4IOQ A;  4XUB A;  4A9I A;  1E6I A;  5BT4 A;  5E0R A;  4LRG A;  5ENH A;  4A9J A;  4N4I A;  5EWW A;  4N4H A;  4YYN A;  4O70 A;  4NR8 A;  3LXJ A;  4YAT A;  4QR3 A;  5CTL A;  3JVL A;  4HBW A;  4UYF B;  5EM3 A;  4CUS A;  1X0J A;  2YEM A;  2RS9 B;  4ZC9 A;  5CQ4 A;  5D0C A;  4PKL A;  5A5O A;  5H1T A;  4TQN A;  4YBS A;  5LVQ A;  3DAI A;  2E7O A;  3SVH A;  4UIX A;  5D3L A;  5FDZ A;  3O36 A;  4HXL A;  5D3J A;  4YK0 A;  4ALH A;  5DKH A;  4HXR A;  5FE4 A;  4HBX A;  5A81 A;  4BW1 A;  4CFL A;  5FE1 A;  5HFR A;  4TYL A;  4O7C A;  5EWH A;  4XY8 A;  4NYW A;  4Q0O A;  5LKX A;  5JWM A;  5FE2 A;  4YAD A;  4QY4 A;  4UYD A;  4NR7 A;  4NRC A;  5D24 A;  5E73 A;  4QR5 A;  5KO4 A;  5DFB A;  3LQJ A;  4NQN A;  4UIU A;  5HQ5 A;  4J1P A;  5CQA A;  4QSV A;  5I88 A;  5IGL A;  2RNX A;  2DVR A;  4LDF A;  4QSW A;  5D3P A;  4A9N A;  2RNW A;  5CRZ A;  5AD2 A;  5I1Q A;  4Z93 A;  3I3J A;  5DW2 A;  5CPE A;  4PTB A;  3VKH A;  4MR6 A;  5HQ7 A;  4J3I A;  2R0S A;  3D1D A;  5DLX A;  5F36 A;  5IGN A;  4HBY A;  3U5J A;  3SVF A;  4PCE A;  3D7C A;  4IR5 A;  5L96 A;  4A9M A;  2OUO A;  5ENF A;  4IOR A;  4YC9 A;  3O37 A;  3D1B A;  2KTB B;  5LJ2 A;  2N9G A;  5C85 A;  4UIV A;  3U5K A;  4A9E A;  4A9F A;  5E9K A;  4MEN A;  4Z6I A;  4CFK A;  5CUB A;  5EPR A;  4WIV A;  3U5O A;  5F61 A;  4QUT A;  5D3T A;  5A5N A;  3ZYU A;  5FB0 A;  4YYD A;  5HQ6 A;  4NUD A;  4YBM A;  3U5M A;  4YYJ A;  4NR6 A;  5L8U A;  4LC2 A;  5COI A;  4TTE A;  5H85 A;  5CQ8 A;  5II2 A;  3FKM X;  5CQ7 A;  5E9I A;  4BW2 A;  3MXF A;  4NRA A;  5L99 A;  5BT5 A;  2DKW A;  2RI7 A;  4N4G A;  5F3A A;  4HBV A;  2DAT A;  3UW9 A;  5CZG A;  4F3I A;  4N3W A;  4HXK A;  5FE9 A;  5E74 A;  5II1 A;  4NQM A;  2OSS A;  4QNS A;  5F5Z A;  5FE8 A;  3Q2E A;  4AI6 A;  4GPJ A;  5CGP A;  5LJ0 A;  3HMF A;  2D9E A;  5CS8 A;  4BW4 A;  4IOO A;  3G0J A;  4QB3 A;  5CFW A;  1ZS5 A;  4KCX A;  5A85 A;  4MEQ A;  5CY9 A;  4YYI A;  5CQ6 A;  5A5Q A;  5ACY A;  5FG6 A;  5CQ3 A;  4QSU A;  5E9L A;  2DWW A;  5E9M A;  4Q0N A;  4A9L A;  4CL9 A;  2R10 A;  4O7A A;  4TZ8 A;  5JI8 A;  4LYW A;  3O34 A;  4MEP A;  4ZQL A;  4Z6H A;  5IGK A;  1N72 A;  5I89 A;  5D25 A;  5HEM A;  5F2P A;  3LQI A;  2YEL A;  4C67 A;  4DON A;  3MB4 A;  5E7D A;  4UIZ A;  3S91 A;  5HEL A;  2YDW A;  1ZKR A;  5KTU A;  5C87 A;  3G0L A;  4AKH A;  5LVR A;  4O75 A;  5DKD A;  5EWD A;  5F1H A;  5EA1 A;  4QEV A;  2WP2 A;  3TLP A;  5C4Q A;  5LKT A;  4UIW A;  4CUQ A;  5I29 A;  4YAB A;  5DBM A;  4IR6 A;  5H1U A;  4MR5 A;  4HXO A;  5L98 A;  5J0D A;  3MUL A;  4WHU A;  3IU5 A;  4XYA A;  3S92 A;  5IID A;  5EP7 A;  5EPS A;  5EVA A;  2OO1 A;  5D7X A;  5FFY A;  5H1V A;  1F68 A;  2MJV B;  4TZ2 A;  5DX4 A;  5EIC A;  5EPB A;  5ENG A;  5A5P A;  3K2J A;  5CUC A;  4HXS A;  4N4F A;  5ENE A;  5DFD A;  4YYH A;  5DW1 A;  5ETB A;  5CP5 A;  5EV9 A;  4XY9 A;  5F60 A;  3AQA A;  5F1L A;  4IR3 A;  4NXJ A;  3JVM A;  4E96 A;  2I8N A;  5L97 A;  4NUC A;  5C7N A;  2R0V A;  2RO1 A;  5G4R A;  5EIS A;  5EI4 A;  3P5O A;  5HRV A;  4CUP A;  2L84 A;  5D3R A;  2NXB A;  5A5S A;  3QZS A;  4A9K A;  5LUU A;  2DVS A;  5D3S A;  4IR4 A;  5FH7 A;  4NR9 A;  5EGU A;  3UV4 A;  4LZ2 A;  3DWY A;  4NS5 A;  4O78 A;  4QSS A;  5HCL A;  5I86 A;  3JVJ A;  4QYL A;  4UYE A;  5EK9 A;  5D3N A;  4YYG A;  4YY6 A;  4QR4 A;  4AKI A;  3MQM A;  3GG3 A;  4HXP A;  5ETD A;  4YH3 A;  4J0R A;  2FSA A;  2I7K A;  4QST A;  5LKZ A;  5E9V A;  1EQF A;  5ENJ A;  5I80 A;  1WUG A;  4LYS A;  5L8T A;  2G4A A;  4O7E A;  4OUF A;  5E3G A;  5CUG A;  4TT4 A;  4RVR A;  2DVQ A;  2E7N A;  4YH4 A;  5AMF A;  4CUT A;  5HRX A;  5A83 A;  3RCW A;  3P1E A;  4O7F A;  5ENC A;  5E3D A;  5DYX A;  5IG6 A;  5EU1 A;  5CUD A;  4XUA A;  5CQ5 A;  5HEN A;  4PCI A;  4ZW1 A;  3AAD A;  4PS5 A;  5DFC A;  5D3H A;  4NUE A;  2GRC A;  4QEU A;  5CRM A;  3UVX A;  5A7C A;  5DLZ A;  1JM4 B;  4MR4 A;  2H60 A;  5CUA A;  1PUO A;  5CQT A;  4BJX A;  2F6J A;  3MB3 A;  5LKU A;  5E9Y A;  5I7X A;  4Z1Q A;  3UV5 A;  4UYH A;  5I40 A;  4BHW A;  5AD3 A;  3P1D A;  4O7B A;  1JSP B;  5C89 A;  3QZV A;  4X2I A;  2DVV A;  5FH6 A;  4QSQ A;  4OGJ A;  2YYN A;  4J0S A;  4NR4 A;  5AME A;  4LZR A; 
#chains in the Genus database with same CATH homology
 4YBT A;  5TCM A;  2LSP B;  5DKC A;  2YQD A;  4O72 A;  4AKN A;  3UVY A;  4NYX A;  3P1F A;  4O76 A;  3IU6 A;  5FE0 A;  4O71 A;  5EQ1 A;  5DYA A;  3O35 A;  4TT2 A;  5I83 A;  5HFQ A;  4ALG A;  5CU8 A;  5HJC A;  5ENB A;  5LJ1 A;  5C8G A;  4PY6 A;  4TU6 A;  5FH8 A;  5TB6 A;  5G4S A;  4Y03 A;  5FG5 A;  4OGI A;  4WHW A;  5HLS A;  4LZS A;  5FFW A;  5FE7 A;  2L85 A;  5FE6 A;  3UV2 A;  5EWV A;  2F6N A;  4UYG A;  2E3K A;  4QC1 A;  4A9H A;  4YYM A;  4UIT A;  5DYU A;  4FLP A;  5FBX A;  4BW3 A;  5KTW A;  4QZS A;  5F62 A;  4TS8 A;  3ONI A;  3MUK A;  2R0Y A;  5IBN A;  4UYF A;  5CUE A;  5DYC A;  5A82 A;  4NRB A;  4Z1S A;  5FG4 A;  3LQH A;  4QSP A;  5HRW A;  4YAX A;  4HXN A;  5K29 A;  1WUM A;  4NR5 A;  4KV4 A;  5BT3 A;  3P1C A;  4CLB A;  2YW5 A;  5F63 A;  3U5P A;  2L5E A;  4QSR A;  3Q2F A;  2RFJ A;  4KV1 A;  5FB1 A;  3LJW A;  5KHM A;  4YY4 A;  4TT6 A;  4MR3 A;  4LR6 A;  4QSX A;  5FFV A;  5EWC A;  4QBM A;  4QUU A;  3NXB A;  3JVK A;  5I7Y A;  3SVG A;  5KTX A;  4MEO A;  4CUR A;  3U5L A;  3UVD A;  4NYV A;  5KU3 A;  4QYD A;  4O77 A;  5IGM A;  4O74 A;  3QZT A;  2WP1 A;  5FE3 A;  4C66 A;  4HXM A;  4TU4 A;  5A5R A;  2RNY A;  3HMH A;  4A9O A;  5HM0 A;  4UIY A;  4YYK A;  2D82 A;  5D26 A;  4QEW A;  3HME A;  4LYI A;  3U5N A;  5F25 A;  3UVW A;  2YEK A;  4CUU A;  5ENI A;  4QC3 A;  3O33 A;  5FE5 A;  5DY7 A;  4IOQ A;  4XUB A;  4A9I A;  1E6I A;  5BT4 A;  5E0R A;  4LRG A;  5ENH A;  4A9J A;  4N4I A;  5EWW A;  4N4H A;  4YYN A;  4O70 A;  4NR8 A;  3LXJ A;  4YAT A;  4QR3 A;  5CTL A;  3JVL A;  4HBW A;  4UYF B;  5EM3 A;  4CUS A;  1X0J A;  2YEM A;  2RS9 B;  4ZC9 A;  5CQ4 A;  5D0C A;  4PKL A;  5A5O A;  5H1T A;  4TQN A;  4YBS A;  5LVQ A;  3DAI A;  2E7O A;  3SVH A;  4UIX A;  5D3L A;  5FDZ A;  3O36 A;  4HXL A;  5D3J A;  4YK0 A;  4ALH A;  5DKH A;  4HXR A;  5FE4 A;  4HBX A;  5A81 A;  4BW1 A;  4CFL A;  5FE1 A;  5HFR A;  4TYL A;  4O7C A;  5EWH A;  4XY8 A;  4NYW A;  4Q0O A;  5LKX A;  5JWM A;  5FE2 A;  4YAD A;  4QY4 A;  4UYD A;  4NR7 A;  4NRC A;  5D24 A;  5E73 A;  4QR5 A;  5KO4 A;  5DFB A;  3LQJ A;  4NQN A;  4UIU A;  5HQ5 A;  4J1P A;  5CQA A;  4QSV A;  5I88 A;  5IGL A;  2RNX A;  2DVR A;  4LDF A;  4QSW A;  5D3P A;  4A9N A;  2RNW A;  5CRZ A;  5AD2 A;  5I1Q A;  4Z93 A;  3I3J A;  5DW2 A;  5CPE A;  4PTB A;  4MR6 A;  5HQ7 A;  4J3I A;  2R0S A;  5DLX A;  5F36 A;  5IGN A;  4HBY A;  3U5J A;  3SVF A;  4PCE A;  3D7C A;  4IR5 A;  5L96 A;  4A9M A;  2OUO A;  5ENF A;  4IOR A;  4YC9 A;  3O37 A;  2KTB B;  5LJ2 A;  2N9G A;  5C85 A;  4UIV A;  3U5K A;  4A9E A;  4A9F A;  5E9K A;  4MEN A;  4Z6I A;  4CFK A;  5CUB A;  5EPR A;  4WIV A;  3U5O A;  5F61 A;  4QUT A;  5D3T A;  5A5N A;  3ZYU A;  5FB0 A;  4YYD A;  5HQ6 A;  4NUD A;  4YBM A;  3U5M A;  4YYJ A;  4NR6 A;  5L8U A;  4LC2 A;  5COI A;  4TTE A;  5H85 A;  5CQ8 A;  5II2 A;  3FKM X;  5CQ7 A;  5E9I A;  4BW2 A;  3MXF A;  4NRA A;  5L99 A;  5BT5 A;  2DKW A;  2RI7 A;  4N4G A;  5F3A A;  4HBV A;  2DAT A;  3UW9 A;  5CZG A;  4F3I A;  4N3W A;  4HXK A;  5FE9 A;  5E74 A;  5II1 A;  4NQM A;  2OSS A;  4QNS A;  5F5Z A;  5FE8 A;  3Q2E A;  4GPJ A;  5CGP A;  5LJ0 A;  3HMF A;  2D9E A;  5CS8 A;  4BW4 A;  4IOO A;  3G0J A;  4QB3 A;  5CFW A;  1ZS5 A;  4KCX A;  5A85 A;  4MEQ A;  5CY9 A;  4YYI A;  5CQ6 A;  5A5Q A;  5ACY A;  5FG6 A;  5CQ3 A;  4QSU A;  5E9L A;  2DWW A;  5E9M A;  4Q0N A;  4A9L A;  4CL9 A;  2R10 A;  4O7A A;  4TZ8 A;  5JI8 A;  4LYW A;  3O34 A;  4MEP A;  4ZQL A;  4Z6H A;  5IGK A;  1N72 A;  5I89 A;  5D25 A;  5HEM A;  5F2P A;  3LQI A;  2YEL A;  4C67 A;  4DON A;  3MB4 A;  5E7D A;  4UIZ A;  3S91 A;  5HEL A;  2YDW A;  5KTU A;  5C87 A;  3G0L A;  5LVR A;  4O75 A;  5DKD A;  5EWD A;  5F1H A;  5EA1 A;  4QEV A;  2WP2 A;  3TLP A;  5C4Q A;  5LKT A;  4UIW A;  4CUQ A;  5I29 A;  4YAB A;  5DBM A;  4IR6 A;  5H1U A;  4MR5 A;  4HXO A;  5L98 A;  5J0D A;  3MUL A;  4WHU A;  3IU5 A;  4XYA A;  3S92 A;  5IID A;  5EP7 A;  5EPS A;  5EVA A;  2OO1 A;  5D7X A;  5FFY A;  5H1V A;  1F68 A;  2MJV B;  4TZ2 A;  5DX4 A;  5EIC A;  5EPB A;  5ENG A;  5A5P A;  3K2J A;  5CUC A;  4HXS A;  4N4F A;  5ENE A;  5DFD A;  4YYH A;  5DW1 A;  5ETB A;  5CP5 A;  5EV9 A;  4XY9 A;  5F60 A;  3AQA A;  5F1L A;  4IR3 A;  4NXJ A;  3JVM A;  4E96 A;  2I8N A;  5L97 A;  4NUC A;  5C7N A;  2R0V A;  2RO1 A;  5G4R A;  5EIS A;  5EI4 A;  3P5O A;  5HRV A;  4CUP A;  2L84 A;  5D3R A;  2NXB A;  5A5S A;  3QZS A;  4A9K A;  5LUU A;  2DVS A;  5D3S A;  4IR4 A;  5FH7 A;  4NR9 A;  5EGU A;  3UV4 A;  4LZ2 A;  3DWY A;  4NS5 A;  4O78 A;  4QSS A;  5HCL A;  5I86 A;  3JVJ A;  4QYL A;  4UYE A;  5EK9 A;  5D3N A;  4YYG A;  4YY6 A;  4QR4 A;  3MQM A;  3GG3 A;  4HXP A;  5ETD A;  4YH3 A;  4J0R A;  2FSA A;  2I7K A;  4QST A;  5LKZ A;  5E9V A;  1EQF A;  5ENJ A;  5I80 A;  1WUG A;  4LYS A;  5L8T A;  2G4A A;  4O7E A;  4OUF A;  5E3G A;  5CUG A;  4TT4 A;  4RVR A;  2DVQ A;  2E7N A;  4YH4 A;  5AMF A;  4CUT A;  5HRX A;  5A83 A;  3RCW A;  3P1E A;  4O7F A;  5ENC A;  5E3D A;  5DYX A;  5IG6 A;  5EU1 A;  5CUD A;  4XUA A;  5CQ5 A;  5HEN A;  4PCI A;  4ZW1 A;  3AAD A;  4PS5 A;  5DFC A;  5D3H A;  4NUE A;  2GRC A;  4QEU A;  5CRM A;  3UVX A;  5A7C A;  5DLZ A;  1JM4 B;  4MR4 A;  2H60 A;  5CUA A;  5CQT A;  4BJX A;  2F6J A;  3MB3 A;  5LKU A;  5E9Y A;  5I7X A;  4Z1Q A;  3UV5 A;  4UYH A;  5I40 A;  4BHW A;  5AD3 A;  3P1D A;  4O7B A;  1JSP B;  5C89 A;  3QZV A;  4X2I A;  2DVV A;  5FH6 A;  4QSQ A;  4OGJ A;  2YYN A;  4J0S A;  4NR4 A;  5AME A;  4LZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...