2L5EA

Complex between bd1 of brd3 and gata-1 c-tail
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
127
structure length
127
Chain Sequence
PLGSEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein/transcription
molecule keywords Bromodomain-containing protein 3
publication title Structural basis and specificity of acetylated transcription factor GATA1 recognition by BET family bromodomain protein Brd3.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2010-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2l5eA01
4HXOA 4LZSA 3O36A 3O35A 4HBXA 5DYXA 5E73A 4A9FA 4C67A 5F5ZA 4NUCA 5L96A 4BW2A 5A5SA 2GRCA 4YYDA 5HRXA 2R0YA 5ETBA 4Y03A 5EM3A 3U5OA 5ENBA 4UYHA 5A5OA 5LJ0A 5IGLA 4TT4A 5CQTA 5I88A 5D3JA 5II2A 5IIDA 3TLPA 4YY6A 2DVQA 4HXPA 5E7DA 5EWWA 3K2JA 4NYXA 3Q2FA 5FE6A 5DKCA 3DWYA 4UITA 5A7CA 5II1A 2D82A 5C89A 2DVSA 4UYDA 3U5JA 5CQ3A 4CFLA 3MUKA 4UYEA 4PS5A 5E74A 5DLZA 5LKUA 3UVDA 5E9IA 5CZGA 2I8NA 4CFKA 5COIA 3LQIA 4QR3A 5FE0A 5L8TA 3SVHA 5CRZA 4A9IA 5LVRA 5ENEA 3S92A 5HELA 4TTEA 3JVKA 4J3IA 5D7XA 5JWMA 4TU4A 4IR5A 5A5QA 4OGIA 4PCIA 4OUFA 4QYLA 2DWWA 5HFQA 4UYFA 4YYHA 5F60A 5C85A 5IBNA 4YATA 5FG5A 4QC3A 2WP1A 4UIYA 4Z6IA 4A9MA 4NXJA 2H60A 3ZYUA 4NRAA 5IGNA 5TB6A 5EWDA 5CS8A 3JVLA 5LVQA 1ZS5A 4PY6A 5HCLA 4HBVA 3QZVA 4LRGA 2YDWA 4ZQLA 5DBMA 4YYMA 4YY4A 4TT6A 5A5RA 4QR5A 2YYNA 4MR4A 2FSAA 4QSUA 4NYVA 5EWVA 5G4SA 5CUBA 3HMFA 3I3JA 3S91A 4A9NA 5H1TA 4WHWA 5I86A 3JVJA 5HEMA 5H1VA 4Z6HA 4XY9A 4N4GA 4O74A 4O7CA 4TU6A 4NRCA 5EA1A 4CUTA 5IGMA 5BT3A 2YEMA 3MB3A 3LJWA 5D26A 4LZRA 4ALGA 4PTBA 5CQ7A 5C87A 3P1DA 4YABA 3Q2EA 2YEKA 4NR6A 5DW2A 5I83A 3U5NA 2OO1A 4ZW1A 4YAXA 4O75A 5CTLA 5FFYA 5A82A 2E7NA 3O33A 2L85A 4LR6A 5D0CA 5FE1A 5HQ5A 5J0DA 5LKXA 5HRWA 5EQ1A 5DLXA 3FKMX 5D3PA 3JVMA 2DVVA 4LYWA 5FE3A 4QY4A 3IU6A 4J1PA 5K29A 5HQ6A 4BW3A 3P1EA 5CQ4A 5F36A 4TT2A 3G0LA 2G4AA 4PKLA 4C66A 5L98A 4NR9A 4A9EA 5L99A 5FFVA 5ENFA 4UIXA 1WUMA 5F1HA 1F68A 3SVGA 5CFWA 5D3RA 3DAIA 4NQNA 4QSVA 2NXBA 4YC9A 5KTUA 2YW5A 3NXBA 2YQDA 4WHUA 3P1CA 3U5KA 5I1QA 3MXFA 4YYKA 3LQHA 5DYUA 3QZTA 2N9GA 4CUPA 5FH7A 4HBWA 4YK0A 5EWCA 4ZC9A 4QSPA 5G4RA 4O7FA 4KCXA 5IG6A 4QUUA 4X2IA 3U5MA 5E9MA 5EK9A 2I7KA 4Q0OA 2R10A 2RS9B 4LYIA 4NUDA 5I40A 4A9HA 5E0RA 4O7BA 4QSXA 5E3GA 4Z1SA 3UW9A 4O7AA 4QSSA 5HJCA 3O34A 3AADA 5EICA 5EU1A 4Z93A 4YYNA 4BW1A 3HMHA 3IU5A 4HXLA 5EWHA 2DATA 3UVYA 4QUTA 3MQMA 4BHWA 4YYIA 4RVRA 5FE9A 4A9OA 5H1UA 5KTWA 5ENCA 5KTXA 5KHMA 4O78A 4YH3A 4QSQA 5A83A 4O71A 4J0RA 4NYWA 5E9LA 5EGUA 5TCMA 5KO4A 5D24A 4HXKA 4HXMA 5DY7A 4QNSA 4N4HA 4LC2A 3P1FA 5FE2A 4F3IA 5JI8A 4O72A 4Q0NA 5F2PA 5CPEA 3UV5A 5HRVA 3UV4A 5BT5A 2OUOA 5H85A 4YBTA 4CUQA 4QC1A 5IGKA 4QSWA 2RNYA 5E3DA 5EPRA 5ENGA 5DKHA 5FBXA 5EPBA 5A81A 5CQ8A 4N4FA 1X0JA 5E9KA 2R0VA 4NQMA 5D3HA 4E96A 5EV9A 4YADA 2RFJA 5CGPA 5ENJA 2OSSA 4LZ2A 5CUDA 2RNXA 1WUGA 4J0SA 4UYFB 4UIWA 5F61A 5AD3A 2E3KA 5HFRA 5CQ5A 2D9EA 4HXSA 5LKZA 4MR3A 5FG6A 5HM0A 5FB1A 4A9LA 5HENA 3O37A 4A9KA 5BT4A 3MULA 5FE7A 4O76A 5FE5A 4QSTA 5CUAA 2RO1A 5DFDA 3U5PA 4MEQA 5CQ6A 5CRMA 4IORA 5FFWA 4O7EA 4IOQA 5DX4A 4UIZA 3D7CA 4CL9A 5FH8A 4QEVA 1EQFA 4IOOA 4XUBA 2YELA 4MR6A 4A9JA 4O70A 4XUAA 5DYCA 5E9YA 5F62A 5I29A 4YBSA 4BJXA 2F6JA 5LJ2A 5FE4A 4TZ8A 4OGJA 5I89A 5A5NA 5I80A 4QSRA 4GPJA 4TS8A 5C8GA 5D25A 3P5OA 5CP5A 4MR5A 4YYJA 4QBMA 5D3TA 4YH4A 4NR5A 4LDFA 3UVXA 1N72A 4MENA 5ENIA 4UYGA 4CURA 5AMEA 4QEWA 3AQAA 5DKDA 5CQAA 5E9VA 4QZSA 5FB0A 5HQ7A 4QYDA 4TYLA 5FG4A 4HBYA 4N4IA 1JM4B 5D3SA 2MJVB 5CUEA 3ONIA 5F3AA 5ETDA 4YYGA 4ALHA 4QR4A 4IR4A 5HLSA 5AD2A 4NS5A 2DVRA 4XY8A 4UIUA 4Z1QA 4IR6A 4KV1A 5DFBA 3LQJA 4BW4A 4HXRA 4DONA 3RCWA 5EISA 4TQNA 4O77A 4NUEA 3HMEA 4TZ2A 5LUUA 5C4QA 4N3WA 4NR7A 4QEUA 2WP2A 5F1LA 2L5EA 5FDZA 5CUGA 5I7XA 2E7OA 5A5PA 4CLBA 4UIVA 5DW1A 1JSPB 5D3NA 4PCEA 4XYAA 5C7NA 2KTBB 5L8UA 5F63A 4NRBA 4YBMA 5CY9A 5EI4A 5A85A 5D3LA 5I7YA 3UV2A 4MEPA 4QB3A 5LJ1A 2L84A 4CUUA 5DFCA 5FH6A 5EVAA 2DKWA 5CUCA 4NR4A 4FLPA 4KV4A 4NR8A 4HXNA 5CU8A 2R0SA 5EPSA 5ACYA 3SVFA 4MEOA 1E6IA 3U5LA 5FE8A 5L97A 3MB4A 2F6NA 4WIVA 2LSPB 5DYAA 5ENHA 2RNWA 5EP7A 5AMFA 2RI7A 4IR3A 3LXJA 4LYSA 4CUSA 5KU3A 3G0JA 5LKTA 5F25A 3GG3A 3QZSA 4AKNA 3UVWA
chains in the Genus database with same CATH superfamily
4HXOA 4LZSA 3O36A 3O35A 4HBXA 5DYXA 5E73A 4A9FA 4C67A 5F5ZA 4NUCA 5L96A 4BW2A 5A5SA 2GRCA 4YYDA 5HRXA 2R0YA 5ETBA 4Y03A 5EM3A 3U5OA 5ENBA 4UYHA 5A5OA 5LJ0A 5IGLA 4TT4A 5CQTA 5I88A 5D3JA 5II2A 5IIDA 3TLPA 4YY6A 2DVQA 4HXPA 5E7DA 5EWWA 3K2JA 4NYXA 3Q2FA 5FE6A 5DKCA 3DWYA 4UITA 5A7CA 5II1A 2D82A 5C89A 2DVSA 4UYDA 3U5JA 5CQ3A 4CFLA 3MUKA 4UYEA 4PS5A 5E74A 5DLZA 5LKUA 3UVDA 5E9IA 5CZGA 2I8NA 4CFKA 5COIA 3LQIA 4QR3A 5FE0A 5L8TA 3SVHA 5CRZA 4A9IA 5LVRA 5ENEA 3S92A 5HELA 4TTEA 3JVKA 4J3IA 5D7XA 5JWMA 4TU4A 4IR5A 5A5QA 4OGIA 4PCIA 4OUFA 4QYLA 2DWWA 5HFQA 4UYFA 4YYHA 5F60A 5C85A 5IBNA 4YATA 5FG5A 4QC3A 2WP1A 4UIYA 4Z6IA 4A9MA 4NXJA 2H60A 3ZYUA 4NRAA 5IGNA 5TB6A 5EWDA 5CS8A 3JVLA 5LVQA 1ZS5A 4PY6A 5HCLA 4HBVA 3QZVA 4LRGA 2YDWA 4ZQLA 5DBMA 4YYMA 4YY4A 4TT6A 5A5RA 4QR5A 2YYNA 4MR4A 2FSAA 4QSUA 4NYVA 5EWVA 5G4SA 5CUBA 3HMFA 3I3JA 3S91A 4A9NA 5H1TA 4WHWA 5I86A 3JVJA 5HEMA 5H1VA 4Z6HA 4AI6A 4XY9A 4N4GA 4O74A 4O7CA 4TU6A 4NRCA 5EA1A 4CUTA 5IGMA 5BT3A 2YEMA 3MB3A 3LJWA 5D26A 4LZRA 4ALGA 4PTBA 5CQ7A 5C87A 3P1DA 4YABA 3Q2EA 2YEKA 4NR6A 5DW2A 5I83A 3U5NA 2OO1A 4ZW1A 4YAXA 4O75A 5CTLA 5FFYA 5A82A 2E7NA 3O33A 2L85A 4LR6A 5D0CA 5FE1A 5HQ5A 5J0DA 5LKXA 5HRWA 5EQ1A 5DLXA 3FKMX 5D3PA 3JVMA 2DVVA 4LYWA 5FE3A 4QY4A 3IU6A 4J1PA 5K29A 5HQ6A 4BW3A 3P1EA 5CQ4A 5F36A 4TT2A 3G0LA 2G4AA 4PKLA 4C66A 5L98A 4NR9A 4A9EA 5L99A 5FFVA 5ENFA 4UIXA 1WUMA 4AKIA 5F1HA 1F68A 3SVGA 5CFWA 5D3RA 3DAIA 4NQNA 4QSVA 2NXBA 4YC9A 5KTUA 2YW5A 3NXBA 2YQDA 4WHUA 3D1BA 3P1CA 3U5KA 5I1QA 3MXFA 4YYKA 3LQHA 5DYUA 3QZTA 2N9GA 4CUPA 5FH7A 4HBWA 4YK0A 5EWCA 4ZC9A 4QSPA 5G4RA 4O7FA 4KCXA 5IG6A 4QUUA 4X2IA 3U5MA 5E9MA 5EK9A 2I7KA 4Q0OA 2R10A 2RS9B 4LYIA 4NUDA 5I40A 4A9HA 5E0RA 4O7BA 4QSXA 5E3GA 4Z1SA 3UW9A 4O7AA 4QSSA 5HJCA 3O34A 3AADA 5EICA 5EU1A 4Z93A 4YYNA 4BW1A 3HMHA 3IU5A 4HXLA 5EWHA 2DATA 3UVYA 4QUTA 3MQMA 4BHWA 4YYIA 4RVRA 5FE9A 4A9OA 5H1UA 5KTWA 5ENCA 5KTXA 5KHMA 4O78A 4YH3A 4QSQA 5A83A 4O71A 4J0RA 4NYWA 5E9LA 5EGUA 5TCMA 5KO4A 5D24A 4HXKA 4HXMA 5DY7A 4QNSA 4N4HA 4LC2A 3P1FA 5FE2A 4F3IA 5JI8A 4O72A 4Q0NA 3ERRA 5F2PA 5CPEA 3UV5A 5HRVA 3UV4A 5BT5A 2OUOA 5H85A 4YBTA 4CUQA 4QC1A 5IGKA 4QSWA 2RNYA 5E3DA 4AKHA 5EPRA 5ENGA 5DKHA 5FBXA 5EPBA 5A81A 5CQ8A 4N4FA 1X0JA 5E9KA 2R0VA 4NQMA 5D3HA 4E96A 5EV9A 4YADA 2RFJA 5CGPA 5ENJA 2OSSA 4LZ2A 5CUDA 2RNXA 1WUGA 4J0SA 4UYFB 4UIWA 5F61A 5AD3A 2E3KA 5HFRA 5CQ5A 2D9EA 4HXSA 5LKZA 4MR3A 5FG6A 5HM0A 5FB1A 4A9LA 5HENA 3O37A 4A9KA 5BT4A 3MULA 5FE7A 4O76A 5FE5A 4QSTA 5CUAA 2RO1A 5DFDA 3U5PA 2EJNA 4MEQA 5CQ6A 5CRMA 4IORA 5FFWA 4O7EA 4IOQA 5DX4A 4UIZA 3D7CA 4CL9A 5FH8A 4QEVA 1EQFA 4IOOA 4XUBA 2YELA 4MR6A 4A9JA 4O70A 4XUAA 5DYCA 5E9YA 1ZKRA 5F62A 5I29A 4YBSA 4BJXA 2F6JA 5LJ2A 5FE4A 4TZ8A 4OGJA 5I89A 5A5NA 5I80A 4QSRA 4GPJA 4TS8A 5C8GA 5D25A 3P5OA 5CP5A 4MR5A 3VKHA 4YYJA 4QBMA 5D3TA 4YH4A 4NR5A 4LDFA 3UVXA 1N72A 4MENA 5ENIA 4UYGA 4CURA 5AMEA 4QEWA 3AQAA 5DKDA 5CQAA 5E9VA 1PUOA 4QZSA 5FB0A 5HQ7A 4QYDA 4TYLA 5FG4A 4HBYA 4N4IA 1JM4B 5D3SA 2MJVB 5CUEA 3ONIA 5F3AA 5ETDA 4YYGA 4ALHA 4QR4A 4IR4A 5HLSA 5AD2A 4NS5A 2DVRA 4XY8A 4UIUA 4AKGA 4Z1QA 4IR6A 4KV1A 5DFBA 3LQJA 4BW4A 4HXRA 4DONA 3RCWA 5EISA 4TQNA 4O77A 4NUEA 3HMEA 4TZ2A 5LUUA 5C4QA 4N3WA 4NR7A 4QEUA 2WP2A 5F1LA 2L5EA 5FDZA 5CUGA 5I7XA 2E7OA 5A5PA 4CLBA 4UIVA 5DW1A 1JSPB 5D3NA 4PCEA 4XYAA 5C7NA 2KTBB 5L8UA 5F63A 4NRBA 4YBMA 5CY9A 5EI4A 5A85A 5D3LA 5I7YA 3UV2A 4MEPA 4QB3A 5LJ1A 2L84A 4CUUA 5DFCA 5FH6A 5EVAA 3VKGA 2DKWA 5CUCA 4NR4A 4FLPA 4KV4A 4NR8A 4HXNA 5CU8A 2R0SA 5EPSA 5ACYA 3SVFA 4MEOA 1E6IA 3U5LA 5FE8A 5L97A 3MB4A 2F6NA 4WIVA 2LSPB 5DYAA 5ENHA 2RNWA 5EP7A 5AMFA 2RI7A 4IR3A 3LXJA 4LYSA 4CUSA 5KU3A 3G0JA 3D1DA 5F25A 5LKTA 3GG3A 3QZSA 4AKNA 3UVWA
chains in the Genus database with same CATH topology
4HXOA 4LZSA 3O36A 3O35A 4HBXA 5DYXA 5E73A 4A9FA 4C67A 5F5ZA 4NUCA 5L96A 4BW2A 5A5SA 2GRCA 4YYDA 5HRXA 2R0YA 5ETBA 4Y03A 5EM3A 3U5OA 5ENBA 4UYHA 5A5OA 5LJ0A 5IGLA 4TT4A 5CQTA 5I88A 5D3JA 5II2A 5IIDA 3TLPA 4YY6A 2DVQA 4HXPA 5E7DA 5EWWA 3K2JA 4NYXA 3Q2FA 5FE6A 5DKCA 3DWYA 4UITA 5A7CA 5II1A 2D82A 5C89A 2DVSA 4UYDA 3U5JA 5CQ3A 4CFLA 3MUKA 4UYEA 4PS5A 5E74A 5DLZA 5LKUA 3UVDA 5E9IA 5CZGA 2I8NA 4CFKA 5COIA 3LQIA 4QR3A 5FE0A 5L8TA 3SVHA 5CRZA 4A9IA 5LVRA 5ENEA 3S92A 5HELA 4TTEA 3JVKA 4J3IA 5D7XA 5JWMA 4TU4A 4IR5A 5A5QA 4OGIA 4PCIA 4OUFA 4QYLA 2DWWA 5HFQA 4UYFA 4YYHA 5F60A 5C85A 5IBNA 4YATA 5FG5A 4QC3A 2WP1A 4UIYA 4Z6IA 4A9MA 4NXJA 2H60A 3ZYUA 4NRAA 5IGNA 5TB6A 5EWDA 5CS8A 3JVLA 5LVQA 1ZS5A 4PY6A 5HCLA 4HBVA 3QZVA 4LRGA 2YDWA 4ZQLA 5DBMA 4YYMA 4YY4A 4TT6A 5A5RA 4QR5A 2YYNA 4MR4A 2FSAA 4QSUA 4NYVA 5EWVA 5G4SA 5CUBA 3HMFA 3I3JA 3S91A 4A9NA 5H1TA 4WHWA 5I86A 3JVJA 5HEMA 5H1VA 4Z6HA 4XY9A 4N4GA 4O74A 4O7CA 4TU6A 4NRCA 5EA1A 4CUTA 5IGMA 5BT3A 2YEMA 3MB3A 3LJWA 5D26A 4LZRA 4ALGA 4PTBA 5CQ7A 5C87A 3P1DA 4YABA 3Q2EA 2YEKA 4NR6A 5DW2A 5I83A 3U5NA 2OO1A 4ZW1A 4YAXA 4O75A 5CTLA 5FFYA 5A82A 2E7NA 3O33A 2L85A 4LR6A 5D0CA 5FE1A 5HQ5A 5J0DA 5LKXA 5HRWA 5EQ1A 5DLXA 3FKMX 5D3PA 3JVMA 2DVVA 4LYWA 5FE3A 4QY4A 3IU6A 4J1PA 5K29A 5HQ6A 4BW3A 3P1EA 5CQ4A 5F36A 4TT2A 3G0LA 2G4AA 4PKLA 4C66A 5L98A 4NR9A 4A9EA 5L99A 5FFVA 5ENFA 4UIXA 1WUMA 5F1HA 1F68A 3SVGA 5CFWA 5D3RA 3DAIA 4NQNA 4QSVA 2NXBA 4YC9A 5KTUA 2YW5A 3NXBA 2YQDA 4WHUA 3P1CA 3U5KA 5I1QA 3MXFA 4YYKA 3LQHA 5DYUA 3QZTA 2N9GA 4CUPA 5FH7A 4HBWA 4YK0A 5EWCA 4ZC9A 4QSPA 5G4RA 4O7FA 4KCXA 5IG6A 4QUUA 4X2IA 3U5MA 5E9MA 5EK9A 2I7KA 4Q0OA 2R10A 2RS9B 4LYIA 4NUDA 5I40A 4A9HA 5E0RA 4O7BA 4QSXA 5E3GA 4Z1SA 3UW9A 4O7AA 4QSSA 5HJCA 3O34A 3AADA 5EICA 5EU1A 4Z93A 4YYNA 4BW1A 3HMHA 3IU5A 4HXLA 5EWHA 2DATA 3UVYA 4QUTA 3MQMA 4BHWA 4YYIA 4RVRA 5FE9A 4A9OA 5H1UA 5KTWA 5ENCA 5KTXA 5KHMA 4O78A 4YH3A 4QSQA 5A83A 4O71A 4J0RA 4NYWA 5E9LA 5EGUA 5TCMA 5KO4A 5D24A 4HXKA 4HXMA 5DY7A 4QNSA 4N4HA 4LC2A 3P1FA 5FE2A 4F3IA 5JI8A 4O72A 4Q0NA 5F2PA 5CPEA 3UV5A 5HRVA 3UV4A 5BT5A 2OUOA 5H85A 4YBTA 4CUQA 4QC1A 5IGKA 4QSWA 2RNYA 5E3DA 5EPRA 5ENGA 5DKHA 5FBXA 5EPBA 5A81A 5CQ8A 4N4FA 1X0JA 5E9KA 2R0VA 4NQMA 5D3HA 4E96A 5EV9A 4YADA 2RFJA 5CGPA 5ENJA 2OSSA 4LZ2A 5CUDA 2RNXA 1WUGA 4J0SA 4UYFB 4UIWA 5F61A 5AD3A 2E3KA 5HFRA 5CQ5A 2D9EA 4HXSA 5LKZA 4MR3A 5FG6A 5HM0A 5FB1A 4A9LA 5HENA 3O37A 4A9KA 5BT4A 3MULA 5FE7A 4O76A 5FE5A 4QSTA 5CUAA 2RO1A 5DFDA 3U5PA 4MEQA 5CQ6A 5CRMA 4IORA 5FFWA 4O7EA 4IOQA 5DX4A 4UIZA 3D7CA 4CL9A 5FH8A 4QEVA 1EQFA 4IOOA 4XUBA 2YELA 4MR6A 4A9JA 4O70A 4XUAA 5DYCA 5E9YA 5F62A 5I29A 4YBSA 4BJXA 2F6JA 5LJ2A 5FE4A 4TZ8A 4OGJA 5I89A 5A5NA 5I80A 4QSRA 4GPJA 4TS8A 5C8GA 5D25A 3P5OA 5CP5A 4MR5A 4YYJA 4QBMA 5D3TA 4YH4A 4NR5A 4LDFA 3UVXA 1N72A 4MENA 5ENIA 4UYGA 4CURA 5AMEA 4QEWA 3AQAA 5DKDA 5CQAA 5E9VA 4QZSA 5FB0A 5HQ7A 4QYDA 4TYLA 5FG4A 4HBYA 4N4IA 1JM4B 5D3SA 2MJVB 5CUEA 3ONIA 5F3AA 5ETDA 4YYGA 4ALHA 4QR4A 4IR4A 5HLSA 5AD2A 4NS5A 2DVRA 4XY8A 4UIUA 4Z1QA 4IR6A 4KV1A 5DFBA 3LQJA 4BW4A 4HXRA 4DONA 3RCWA 5EISA 4TQNA 4O77A 4NUEA 3HMEA 4TZ2A 5LUUA 5C4QA 4N3WA 4NR7A 4QEUA 2WP2A 5F1LA 2L5EA 5FDZA 5CUGA 5I7XA 2E7OA 5A5PA 4CLBA 4UIVA 5DW1A 1JSPB 5D3NA 4PCEA 4XYAA 5C7NA 2KTBB 5L8UA 5F63A 4NRBA 4YBMA 5CY9A 5EI4A 5A85A 5D3LA 5I7YA 3UV2A 4MEPA 4QB3A 5LJ1A 2L84A 4CUUA 5DFCA 5FH6A 5EVAA 2DKWA 5CUCA 4NR4A 4FLPA 4KV4A 4NR8A 4HXNA 5CU8A 2R0SA 5EPSA 5ACYA 3SVFA 4MEOA 1E6IA 3U5LA 5FE8A 5L97A 3MB4A 2F6NA 4WIVA 2LSPB 5DYAA 5ENHA 2RNWA 5EP7A 5AMFA 2RI7A 4IR3A 3LXJA 4LYSA 4CUSA 5KU3A 3G0JA 5LKTA 5F25A 3GG3A 3QZSA 4AKNA 3UVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXO A;  4LZS A;  3O36 A;  3O35 A;  4HBX A;  5DYX A;  5E73 A;  4A9F A;  4C67 A;  5F5Z A;  4NUC A;  5L96 A;  4BW2 A;  5A5S A;  2GRC A;  4YYD A;  5HRX A;  2R0Y A;  5ETB A;  4Y03 A;  5EM3 A;  3U5O A;  5ENB A;  4UYH A;  5A5O A;  5LJ0 A;  5IGL A;  4TT4 A;  5CQT A;  5I88 A;  5D3J A;  5II2 A;  5IID A;  3TLP A;  4YY6 A;  2DVQ A;  4HXP A;  5E7D A;  5EWW A;  3K2J A;  4NYX A;  3Q2F A;  5FE6 A;  5DKC A;  3DWY A;  4UIT A;  5A7C A;  5II1 A;  2D82 A;  5C89 A;  2DVS A;  4UYD A;  3U5J A;  5CQ3 A;  4CFL A;  3MUK A;  4UYE A;  4PS5 A;  5E74 A;  5DLZ A;  5LKU A;  3UVD A;  5E9I A;  5CZG A;  2I8N A;  4CFK A;  5COI A;  3LQI A;  4QR3 A;  5FE0 A;  5L8T A;  3SVH A;  5CRZ A;  4A9I A;  5LVR A;  5ENE A;  3S92 A;  5HEL A;  4TTE A;  3JVK A;  4J3I A;  5D7X A;  5JWM A;  4TU4 A;  4IR5 A;  5A5Q A;  4OGI A;  4PCI A;  4OUF A;  4QYL A;  2DWW A;  5HFQ A;  4UYF A;  4YYH A;  5F60 A;  5C85 A;  5IBN A;  4YAT A;  5FG5 A;  4QC3 A;  2WP1 A;  4UIY A;  4Z6I A;  4A9M A;  4NXJ A;  2H60 A;  3ZYU A;  4NRA A;  5IGN A;  5TB6 A;  5EWD A;  5CS8 A;  3JVL A;  5LVQ A;  1ZS5 A;  4PY6 A;  5HCL A;  4HBV A;  3QZV A;  4LRG A;  2YDW A;  4ZQL A;  5DBM A;  4YYM A;  4YY4 A;  4TT6 A;  5A5R A;  4QR5 A;  2YYN A;  4MR4 A;  2FSA A;  4QSU A;  4NYV A;  5EWV A;  5G4S A;  5CUB A;  3HMF A;  3I3J A;  3S91 A;  4A9N A;  5H1T A;  4WHW A;  5I86 A;  3JVJ A;  5HEM A;  5H1V A;  4Z6H A;  4XY9 A;  4N4G A;  4O74 A;  4O7C A;  4TU6 A;  4NRC A;  5EA1 A;  4CUT A;  5IGM A;  5BT3 A;  2YEM A;  3MB3 A;  3LJW A;  5D26 A;  4LZR A;  4ALG A;  4PTB A;  5CQ7 A;  5C87 A;  3P1D A;  4YAB A;  3Q2E A;  2YEK A;  4NR6 A;  5DW2 A;  5I83 A;  3U5N A;  2OO1 A;  4ZW1 A;  4YAX A;  4O75 A;  5CTL A;  5FFY A;  5A82 A;  2E7N A;  3O33 A;  2L85 A;  4LR6 A;  5D0C A;  5FE1 A;  5HQ5 A;  5J0D A;  5LKX A;  5HRW A;  5EQ1 A;  5DLX A;  3FKM X;  5D3P A;  3JVM A;  2DVV A;  4LYW A;  5FE3 A;  4QY4 A;  3IU6 A;  4J1P A;  5K29 A;  5HQ6 A;  4BW3 A;  3P1E A;  5CQ4 A;  5F36 A;  4TT2 A;  3G0L A;  2G4A A;  4PKL A;  4C66 A;  5L98 A;  4NR9 A;  4A9E A;  5L99 A;  5FFV A;  5ENF A;  4UIX A;  1WUM A;  5F1H A;  1F68 A;  3SVG A;  5CFW A;  5D3R A;  3DAI A;  4NQN A;  4QSV A;  2NXB A;  4YC9 A;  5KTU A;  2YW5 A;  3NXB A;  2YQD A;  4WHU A;  3P1C A;  3U5K A;  5I1Q A;  3MXF A;  4YYK A;  3LQH A;  5DYU A;  3QZT A;  2N9G A;  4CUP A;  5FH7 A;  4HBW A;  4YK0 A;  5EWC A;  4ZC9 A;  4QSP A;  5G4R A;  4O7F A;  4KCX A;  5IG6 A;  4QUU A;  4X2I A;  3U5M A;  5E9M A;  5EK9 A;  2I7K A;  4Q0O A;  2R10 A;  2RS9 B;  4LYI A;  4NUD A;  5I40 A;  4A9H A;  5E0R A;  4O7B A;  4QSX A;  5E3G A;  4Z1S A;  3UW9 A;  4O7A A;  4QSS A;  5HJC A;  3O34 A;  3AAD A;  5EIC A;  5EU1 A;  4Z93 A;  4YYN A;  4BW1 A;  3HMH A;  3IU5 A;  4HXL A;  5EWH A;  2DAT A;  3UVY A;  4QUT A;  3MQM A;  4BHW A;  4YYI A;  4RVR A;  5FE9 A;  4A9O A;  5H1U A;  5KTW A;  5ENC A;  5KTX A;  5KHM A;  4O78 A;  4YH3 A;  4QSQ A;  5A83 A;  4O71 A;  4J0R A;  4NYW A;  5E9L A;  5EGU A;  5TCM A;  5KO4 A;  5D24 A;  4HXK A;  4HXM A;  5DY7 A;  4QNS A;  4N4H A;  4LC2 A;  3P1F A;  5FE2 A;  4F3I A;  5JI8 A;  4O72 A;  4Q0N A;  5F2P A;  5CPE A;  3UV5 A;  5HRV A;  3UV4 A;  5BT5 A;  2OUO A;  5H85 A;  4YBT A;  4CUQ A;  4QC1 A;  5IGK A;  4QSW A;  2RNY A;  5E3D A;  5EPR A;  5ENG A;  5DKH A;  5FBX A;  5EPB A;  5A81 A;  5CQ8 A;  4N4F A;  1X0J A;  5E9K A;  2R0V A;  4NQM A;  5D3H A;  4E96 A;  5EV9 A;  4YAD A;  2RFJ A;  5CGP A;  5ENJ A;  2OSS A;  4LZ2 A;  5CUD A;  2RNX A;  1WUG A;  4J0S A;  4UYF B;  4UIW A;  5F61 A;  5AD3 A;  2E3K A;  5HFR A;  5CQ5 A;  2D9E A;  4HXS A;  5LKZ A;  4MR3 A;  5FG6 A;  5HM0 A;  5FB1 A;  4A9L A;  5HEN A;  3O37 A;  4A9K A;  5BT4 A;  3MUL A;  5FE7 A;  4O76 A;  5FE5 A;  4QST A;  5CUA A;  2RO1 A;  5DFD A;  3U5P A;  4MEQ A;  5CQ6 A;  5CRM A;  4IOR A;  5FFW A;  4O7E A;  4IOQ A;  5DX4 A;  4UIZ A;  3D7C A;  4CL9 A;  5FH8 A;  4QEV A;  1EQF A;  4IOO A;  4XUB A;  2YEL A;  4MR6 A;  4A9J A;  4O70 A;  4XUA A;  5DYC A;  5E9Y A;  5F62 A;  5I29 A;  4YBS A;  4BJX A;  2F6J A;  5LJ2 A;  5FE4 A;  4TZ8 A;  4OGJ A;  5I89 A;  5A5N A;  5I80 A;  4QSR A;  4GPJ A;  4TS8 A;  5C8G A;  5D25 A;  3P5O A;  5CP5 A;  4MR5 A;  4YYJ A;  4QBM A;  5D3T A;  4YH4 A;  4NR5 A;  4LDF A;  3UVX A;  1N72 A;  4MEN A;  5ENI A;  4UYG A;  4CUR A;  5AME A;  4QEW A;  3AQA A;  5DKD A;  5CQA A;  5E9V A;  4QZS A;  5FB0 A;  5HQ7 A;  4QYD A;  4TYL A;  5FG4 A;  4HBY A;  4N4I A;  1JM4 B;  5D3S A;  2MJV B;  5CUE A;  3ONI A;  5F3A A;  5ETD A;  4YYG A;  4ALH A;  4QR4 A;  4IR4 A;  5HLS A;  5AD2 A;  4NS5 A;  2DVR A;  4XY8 A;  4UIU A;  4Z1Q A;  4IR6 A;  4KV1 A;  5DFB A;  3LQJ A;  4BW4 A;  4HXR A;  4DON A;  3RCW A;  5EIS A;  4TQN A;  4O77 A;  4NUE A;  3HME A;  4TZ2 A;  5LUU A;  5C4Q A;  4N3W A;  4NR7 A;  4QEU A;  2WP2 A;  5F1L A;  2L5E A;  5FDZ A;  5CUG A;  5I7X A;  2E7O A;  5A5P A;  4CLB A;  4UIV A;  5DW1 A;  1JSP B;  5D3N A;  4PCE A;  4XYA A;  5C7N A;  2KTB B;  5L8U A;  5F63 A;  4NRB A;  4YBM A;  5CY9 A;  5EI4 A;  5A85 A;  5D3L A;  5I7Y A;  3UV2 A;  4MEP A;  4QB3 A;  5LJ1 A;  2L84 A;  4CUU A;  5DFC A;  5FH6 A;  5EVA A;  2DKW A;  5CUC A;  4NR4 A;  4FLP A;  4KV4 A;  4NR8 A;  4HXN A;  5CU8 A;  2R0S A;  5EPS A;  5ACY A;  3SVF A;  4MEO A;  1E6I A;  3U5L A;  5FE8 A;  5L97 A;  3MB4 A;  2F6N A;  4WIV A;  2LSP B;  5DYA A;  5ENH A;  2RNW A;  5EP7 A;  5AMF A;  2RI7 A;  4IR3 A;  3LXJ A;  4LYS A;  4CUS A;  5KU3 A;  3G0J A;  5LKT A;  5F25 A;  3GG3 A;  3QZS A;  4AKN A;  3UVW A; 
#chains in the Genus database with same CATH topology
 4HXO A;  4LZS A;  3O36 A;  3O35 A;  4HBX A;  5DYX A;  5E73 A;  4A9F A;  4C67 A;  5F5Z A;  4NUC A;  5L96 A;  4BW2 A;  5A5S A;  2GRC A;  4YYD A;  5HRX A;  2R0Y A;  5ETB A;  4Y03 A;  5EM3 A;  3U5O A;  5ENB A;  4UYH A;  5A5O A;  5LJ0 A;  5IGL A;  4TT4 A;  5CQT A;  5I88 A;  5D3J A;  5II2 A;  5IID A;  3TLP A;  4YY6 A;  2DVQ A;  4HXP A;  5E7D A;  5EWW A;  3K2J A;  4NYX A;  3Q2F A;  5FE6 A;  5DKC A;  3DWY A;  4UIT A;  5A7C A;  5II1 A;  2D82 A;  5C89 A;  2DVS A;  4UYD A;  3U5J A;  5CQ3 A;  4CFL A;  3MUK A;  4UYE A;  4PS5 A;  5E74 A;  5DLZ A;  5LKU A;  3UVD A;  5E9I A;  5CZG A;  2I8N A;  4CFK A;  5COI A;  3LQI A;  4QR3 A;  5FE0 A;  5L8T A;  3SVH A;  5CRZ A;  4A9I A;  5LVR A;  5ENE A;  3S92 A;  5HEL A;  4TTE A;  3JVK A;  4J3I A;  5D7X A;  5JWM A;  4TU4 A;  4IR5 A;  5A5Q A;  4OGI A;  4PCI A;  4OUF A;  4QYL A;  2DWW A;  5HFQ A;  4UYF A;  4YYH A;  5F60 A;  5C85 A;  5IBN A;  4YAT A;  5FG5 A;  4QC3 A;  2WP1 A;  4UIY A;  4Z6I A;  4A9M A;  4NXJ A;  2H60 A;  3ZYU A;  4NRA A;  5IGN A;  5TB6 A;  5EWD A;  5CS8 A;  3JVL A;  5LVQ A;  1ZS5 A;  4PY6 A;  5HCL A;  4HBV A;  3QZV A;  4LRG A;  2YDW A;  4ZQL A;  5DBM A;  4YYM A;  4YY4 A;  4TT6 A;  5A5R A;  4QR5 A;  2YYN A;  4MR4 A;  2FSA A;  4QSU A;  4NYV A;  5EWV A;  5G4S A;  5CUB A;  3HMF A;  3I3J A;  3S91 A;  4A9N A;  5H1T A;  4WHW A;  5I86 A;  3JVJ A;  5HEM A;  5H1V A;  4Z6H A;  4AI6 A;  4XY9 A;  4N4G A;  4O74 A;  4O7C A;  4TU6 A;  4NRC A;  5EA1 A;  4CUT A;  5IGM A;  5BT3 A;  2YEM A;  3MB3 A;  3LJW A;  5D26 A;  4LZR A;  4ALG A;  4PTB A;  5CQ7 A;  5C87 A;  3P1D A;  4YAB A;  3Q2E A;  2YEK A;  4NR6 A;  5DW2 A;  5I83 A;  3U5N A;  2OO1 A;  4ZW1 A;  4YAX A;  4O75 A;  5CTL A;  5FFY A;  5A82 A;  2E7N A;  3O33 A;  2L85 A;  4LR6 A;  5D0C A;  5FE1 A;  5HQ5 A;  5J0D A;  5LKX A;  5HRW A;  5EQ1 A;  5DLX A;  3FKM X;  5D3P A;  3JVM A;  2DVV A;  4LYW A;  5FE3 A;  4QY4 A;  3IU6 A;  4J1P A;  5K29 A;  5HQ6 A;  4BW3 A;  3P1E A;  5CQ4 A;  5F36 A;  4TT2 A;  3G0L A;  2G4A A;  4PKL A;  4C66 A;  5L98 A;  4NR9 A;  4A9E A;  5L99 A;  5FFV A;  5ENF A;  4UIX A;  1WUM A;  4AKI A;  5F1H A;  1F68 A;  3SVG A;  5CFW A;  5D3R A;  3DAI A;  4NQN A;  4QSV A;  2NXB A;  4YC9 A;  5KTU A;  2YW5 A;  3NXB A;  2YQD A;  4WHU A;  3D1B A;  3P1C A;  3U5K A;  5I1Q A;  3MXF A;  4YYK A;  3LQH A;  5DYU A;  3QZT A;  2N9G A;  4CUP A;  5FH7 A;  4HBW A;  4YK0 A;  5EWC A;  4ZC9 A;  4QSP A;  5G4R A;  4O7F A;  4KCX A;  5IG6 A;  4QUU A;  4X2I A;  3U5M A;  5E9M A;  5EK9 A;  2I7K A;  4Q0O A;  2R10 A;  2RS9 B;  4LYI A;  4NUD A;  5I40 A;  4A9H A;  5E0R A;  4O7B A;  4QSX A;  5E3G A;  4Z1S A;  3UW9 A;  4O7A A;  4QSS A;  5HJC A;  3O34 A;  3AAD A;  5EIC A;  5EU1 A;  4Z93 A;  4YYN A;  4BW1 A;  3HMH A;  3IU5 A;  4HXL A;  5EWH A;  2DAT A;  3UVY A;  4QUT A;  3MQM A;  4BHW A;  4YYI A;  4RVR A;  5FE9 A;  4A9O A;  5H1U A;  5KTW A;  5ENC A;  5KTX A;  5KHM A;  4O78 A;  4YH3 A;  4QSQ A;  5A83 A;  4O71 A;  4J0R A;  4NYW A;  5E9L A;  5EGU A;  5TCM A;  5KO4 A;  5D24 A;  4HXK A;  4HXM A;  5DY7 A;  4QNS A;  4N4H A;  4LC2 A;  3P1F A;  5FE2 A;  4F3I A;  5JI8 A;  4O72 A;  4Q0N A;  3ERR A;  5F2P A;  5CPE A;  3UV5 A;  5HRV A;  3UV4 A;  5BT5 A;  2OUO A;  5H85 A;  4YBT A;  4CUQ A;  4QC1 A;  5IGK A;  4QSW A;  2RNY A;  5E3D A;  4AKH A;  5EPR A;  5ENG A;  5DKH A;  5FBX A;  5EPB A;  5A81 A;  5CQ8 A;  4N4F A;  1X0J A;  5E9K A;  2R0V A;  4NQM A;  5D3H A;  4E96 A;  5EV9 A;  4YAD A;  2RFJ A;  5CGP A;  5ENJ A;  2OSS A;  4LZ2 A;  5CUD A;  2RNX A;  1WUG A;  4J0S A;  4UYF B;  4UIW A;  5F61 A;  5AD3 A;  2E3K A;  5HFR A;  5CQ5 A;  2D9E A;  4HXS A;  5LKZ A;  4MR3 A;  5FG6 A;  5HM0 A;  5FB1 A;  4A9L A;  5HEN A;  3O37 A;  4A9K A;  5BT4 A;  3MUL A;  5FE7 A;  4O76 A;  5FE5 A;  4QST A;  5CUA A;  2RO1 A;  5DFD A;  3U5P A;  2EJN A;  4MEQ A;  5CQ6 A;  5CRM A;  4IOR A;  5FFW A;  4O7E A;  4IOQ A;  5DX4 A;  4UIZ A;  3D7C A;  4CL9 A;  5FH8 A;  4QEV A;  1EQF A;  4IOO A;  4XUB A;  2YEL A;  4MR6 A;  4A9J A;  4O70 A;  4XUA A;  5DYC A;  5E9Y A;  1ZKR A;  5F62 A;  5I29 A;  4YBS A;  4BJX A;  2F6J A;  5LJ2 A;  5FE4 A;  4TZ8 A;  4OGJ A;  5I89 A;  5A5N A;  5I80 A;  4QSR A;  4GPJ A;  4TS8 A;  5C8G A;  5D25 A;  3P5O A;  5CP5 A;  4MR5 A;  3VKH A;  4YYJ A;  4QBM A;  5D3T A;  4YH4 A;  4NR5 A;  4LDF A;  3UVX A;  1N72 A;  4MEN A;  5ENI A;  4UYG A;  4CUR A;  5AME A;  4QEW A;  3AQA A;  5DKD A;  5CQA A;  5E9V A;  1PUO A;  4QZS A;  5FB0 A;  5HQ7 A;  4QYD A;  4TYL A;  5FG4 A;  4HBY A;  4N4I A;  1JM4 B;  5D3S A;  2MJV B;  5CUE A;  3ONI A;  5F3A A;  5ETD A;  4YYG A;  4ALH A;  4QR4 A;  4IR4 A;  5HLS A;  5AD2 A;  4NS5 A;  2DVR A;  4XY8 A;  4UIU A;  4AKG A;  4Z1Q A;  4IR6 A;  4KV1 A;  5DFB A;  3LQJ A;  4BW4 A;  4HXR A;  4DON A;  3RCW A;  5EIS A;  4TQN A;  4O77 A;  4NUE A;  3HME A;  4TZ2 A;  5LUU A;  5C4Q A;  4N3W A;  4NR7 A;  4QEU A;  2WP2 A;  5F1L A;  2L5E A;  5FDZ A;  5CUG A;  5I7X A;  2E7O A;  5A5P A;  4CLB A;  4UIV A;  5DW1 A;  1JSP B;  5D3N A;  4PCE A;  4XYA A;  5C7N A;  2KTB B;  5L8U A;  5F63 A;  4NRB A;  4YBM A;  5CY9 A;  5EI4 A;  5A85 A;  5D3L A;  5I7Y A;  3UV2 A;  4MEP A;  4QB3 A;  5LJ1 A;  2L84 A;  4CUU A;  5DFC A;  5FH6 A;  5EVA A;  3VKG A;  2DKW A;  5CUC A;  4NR4 A;  4FLP A;  4KV4 A;  4NR8 A;  4HXN A;  5CU8 A;  2R0S A;  5EPS A;  5ACY A;  3SVF A;  4MEO A;  1E6I A;  3U5L A;  5FE8 A;  5L97 A;  3MB4 A;  2F6N A;  4WIV A;  2LSP B;  5DYA A;  5ENH A;  2RNW A;  5EP7 A;  5AMF A;  2RI7 A;  4IR3 A;  3LXJ A;  4LYS A;  4CUS A;  5KU3 A;  3G0J A;  3D1D A;  5F25 A;  5LKT A;  3GG3 A;  3QZS A;  4AKN A;  3UVW A; 
#chains in the Genus database with same CATH homology
 4HXO A;  4LZS A;  3O36 A;  3O35 A;  4HBX A;  5DYX A;  5E73 A;  4A9F A;  4C67 A;  5F5Z A;  4NUC A;  5L96 A;  4BW2 A;  5A5S A;  2GRC A;  4YYD A;  5HRX A;  2R0Y A;  5ETB A;  4Y03 A;  5EM3 A;  3U5O A;  5ENB A;  4UYH A;  5A5O A;  5LJ0 A;  5IGL A;  4TT4 A;  5CQT A;  5I88 A;  5D3J A;  5II2 A;  5IID A;  3TLP A;  4YY6 A;  2DVQ A;  4HXP A;  5E7D A;  5EWW A;  3K2J A;  4NYX A;  3Q2F A;  5FE6 A;  5DKC A;  3DWY A;  4UIT A;  5A7C A;  5II1 A;  2D82 A;  5C89 A;  2DVS A;  4UYD A;  3U5J A;  5CQ3 A;  4CFL A;  3MUK A;  4UYE A;  4PS5 A;  5E74 A;  5DLZ A;  5LKU A;  3UVD A;  5E9I A;  5CZG A;  2I8N A;  4CFK A;  5COI A;  3LQI A;  4QR3 A;  5FE0 A;  5L8T A;  3SVH A;  5CRZ A;  4A9I A;  5LVR A;  5ENE A;  3S92 A;  5HEL A;  4TTE A;  3JVK A;  4J3I A;  5D7X A;  5JWM A;  4TU4 A;  4IR5 A;  5A5Q A;  4OGI A;  4PCI A;  4OUF A;  4QYL A;  2DWW A;  5HFQ A;  4UYF A;  4YYH A;  5F60 A;  5C85 A;  5IBN A;  4YAT A;  5FG5 A;  4QC3 A;  2WP1 A;  4UIY A;  4Z6I A;  4A9M A;  4NXJ A;  2H60 A;  3ZYU A;  4NRA A;  5IGN A;  5TB6 A;  5EWD A;  5CS8 A;  3JVL A;  5LVQ A;  1ZS5 A;  4PY6 A;  5HCL A;  4HBV A;  3QZV A;  4LRG A;  2YDW A;  4ZQL A;  5DBM A;  4YYM A;  4YY4 A;  4TT6 A;  5A5R A;  4QR5 A;  2YYN A;  4MR4 A;  2FSA A;  4QSU A;  4NYV A;  5EWV A;  5G4S A;  5CUB A;  3HMF A;  3I3J A;  3S91 A;  4A9N A;  5H1T A;  4WHW A;  5I86 A;  3JVJ A;  5HEM A;  5H1V A;  4Z6H A;  4XY9 A;  4N4G A;  4O74 A;  4O7C A;  4TU6 A;  4NRC A;  5EA1 A;  4CUT A;  5IGM A;  5BT3 A;  2YEM A;  3MB3 A;  3LJW A;  5D26 A;  4LZR A;  4ALG A;  4PTB A;  5CQ7 A;  5C87 A;  3P1D A;  4YAB A;  3Q2E A;  2YEK A;  4NR6 A;  5DW2 A;  5I83 A;  3U5N A;  2OO1 A;  4ZW1 A;  4YAX A;  4O75 A;  5CTL A;  5FFY A;  5A82 A;  2E7N A;  3O33 A;  2L85 A;  4LR6 A;  5D0C A;  5FE1 A;  5HQ5 A;  5J0D A;  5LKX A;  5HRW A;  5EQ1 A;  5DLX A;  3FKM X;  5D3P A;  3JVM A;  2DVV A;  4LYW A;  5FE3 A;  4QY4 A;  3IU6 A;  4J1P A;  5K29 A;  5HQ6 A;  4BW3 A;  3P1E A;  5CQ4 A;  5F36 A;  4TT2 A;  3G0L A;  2G4A A;  4PKL A;  4C66 A;  5L98 A;  4NR9 A;  4A9E A;  5L99 A;  5FFV A;  5ENF A;  4UIX A;  1WUM A;  5F1H A;  1F68 A;  3SVG A;  5CFW A;  5D3R A;  3DAI A;  4NQN A;  4QSV A;  2NXB A;  4YC9 A;  5KTU A;  2YW5 A;  3NXB A;  2YQD A;  4WHU A;  3P1C A;  3U5K A;  5I1Q A;  3MXF A;  4YYK A;  3LQH A;  5DYU A;  3QZT A;  2N9G A;  4CUP A;  5FH7 A;  4HBW A;  4YK0 A;  5EWC A;  4ZC9 A;  4QSP A;  5G4R A;  4O7F A;  4KCX A;  5IG6 A;  4QUU A;  4X2I A;  3U5M A;  5E9M A;  5EK9 A;  2I7K A;  4Q0O A;  2R10 A;  2RS9 B;  4LYI A;  4NUD A;  5I40 A;  4A9H A;  5E0R A;  4O7B A;  4QSX A;  5E3G A;  4Z1S A;  3UW9 A;  4O7A A;  4QSS A;  5HJC A;  3O34 A;  3AAD A;  5EIC A;  5EU1 A;  4Z93 A;  4YYN A;  4BW1 A;  3HMH A;  3IU5 A;  4HXL A;  5EWH A;  2DAT A;  3UVY A;  4QUT A;  3MQM A;  4BHW A;  4YYI A;  4RVR A;  5FE9 A;  4A9O A;  5H1U A;  5KTW A;  5ENC A;  5KTX A;  5KHM A;  4O78 A;  4YH3 A;  4QSQ A;  5A83 A;  4O71 A;  4J0R A;  4NYW A;  5E9L A;  5EGU A;  5TCM A;  5KO4 A;  5D24 A;  4HXK A;  4HXM A;  5DY7 A;  4QNS A;  4N4H A;  4LC2 A;  3P1F A;  5FE2 A;  4F3I A;  5JI8 A;  4O72 A;  4Q0N A;  5F2P A;  5CPE A;  3UV5 A;  5HRV A;  3UV4 A;  5BT5 A;  2OUO A;  5H85 A;  4YBT A;  4CUQ A;  4QC1 A;  5IGK A;  4QSW A;  2RNY A;  5E3D A;  5EPR A;  5ENG A;  5DKH A;  5FBX A;  5EPB A;  5A81 A;  5CQ8 A;  4N4F A;  1X0J A;  5E9K A;  2R0V A;  4NQM A;  5D3H A;  4E96 A;  5EV9 A;  4YAD A;  2RFJ A;  5CGP A;  5ENJ A;  2OSS A;  4LZ2 A;  5CUD A;  2RNX A;  1WUG A;  4J0S A;  4UYF B;  4UIW A;  5F61 A;  5AD3 A;  2E3K A;  5HFR A;  5CQ5 A;  2D9E A;  4HXS A;  5LKZ A;  4MR3 A;  5FG6 A;  5HM0 A;  5FB1 A;  4A9L A;  5HEN A;  3O37 A;  4A9K A;  5BT4 A;  3MUL A;  5FE7 A;  4O76 A;  5FE5 A;  4QST A;  5CUA A;  2RO1 A;  5DFD A;  3U5P A;  4MEQ A;  5CQ6 A;  5CRM A;  4IOR A;  5FFW A;  4O7E A;  4IOQ A;  5DX4 A;  4UIZ A;  3D7C A;  4CL9 A;  5FH8 A;  4QEV A;  1EQF A;  4IOO A;  4XUB A;  2YEL A;  4MR6 A;  4A9J A;  4O70 A;  4XUA A;  5DYC A;  5E9Y A;  5F62 A;  5I29 A;  4YBS A;  4BJX A;  2F6J A;  5LJ2 A;  5FE4 A;  4TZ8 A;  4OGJ A;  5I89 A;  5A5N A;  5I80 A;  4QSR A;  4GPJ A;  4TS8 A;  5C8G A;  5D25 A;  3P5O A;  5CP5 A;  4MR5 A;  4YYJ A;  4QBM A;  5D3T A;  4YH4 A;  4NR5 A;  4LDF A;  3UVX A;  1N72 A;  4MEN A;  5ENI A;  4UYG A;  4CUR A;  5AME A;  4QEW A;  3AQA A;  5DKD A;  5CQA A;  5E9V A;  4QZS A;  5FB0 A;  5HQ7 A;  4QYD A;  4TYL A;  5FG4 A;  4HBY A;  4N4I A;  1JM4 B;  5D3S A;  2MJV B;  5CUE A;  3ONI A;  5F3A A;  5ETD A;  4YYG A;  4ALH A;  4QR4 A;  4IR4 A;  5HLS A;  5AD2 A;  4NS5 A;  2DVR A;  4XY8 A;  4UIU A;  4Z1Q A;  4IR6 A;  4KV1 A;  5DFB A;  3LQJ A;  4BW4 A;  4HXR A;  4DON A;  3RCW A;  5EIS A;  4TQN A;  4O77 A;  4NUE A;  3HME A;  4TZ2 A;  5LUU A;  5C4Q A;  4N3W A;  4NR7 A;  4QEU A;  2WP2 A;  5F1L A;  2L5E A;  5FDZ A;  5CUG A;  5I7X A;  2E7O A;  5A5P A;  4CLB A;  4UIV A;  5DW1 A;  1JSP B;  5D3N A;  4PCE A;  4XYA A;  5C7N A;  2KTB B;  5L8U A;  5F63 A;  4NRB A;  4YBM A;  5CY9 A;  5EI4 A;  5A85 A;  5D3L A;  5I7Y A;  3UV2 A;  4MEP A;  4QB3 A;  5LJ1 A;  2L84 A;  4CUU A;  5DFC A;  5FH6 A;  5EVA A;  2DKW A;  5CUC A;  4NR4 A;  4FLP A;  4KV4 A;  4NR8 A;  4HXN A;  5CU8 A;  2R0S A;  5EPS A;  5ACY A;  3SVF A;  4MEO A;  1E6I A;  3U5L A;  5FE8 A;  5L97 A;  3MB4 A;  2F6N A;  4WIV A;  2LSP B;  5DYA A;  5ENH A;  2RNW A;  5EP7 A;  5AMF A;  2RI7 A;  4IR3 A;  3LXJ A;  4LYS A;  4CUS A;  5KU3 A;  3G0J A;  5LKT A;  5F25 A;  3GG3 A;  3QZS A;  4AKN A;  3UVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...