3P1FA

Crystal structure of the bromodomain of human crebbp in complex with a hydroquinazolin ligand
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
119
structure length
119
Chain Sequence
SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Crystal structure of the bromodomain of human CREBBP in complex with a hydroquinazolin ligand
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 38
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3p1fA00
5KO4A 5DKCA 3S91A 5I89A 3HMFA 3UVXA 4O75A 5DBMA 5I7YA 5EWWA 4E96A 4YYGA 5C85A 2YEMA 4QSPA 4CFKA 2I7KA 5CUBA 3UW9A 4J1PA 4YC9A 3G0LA 4CURA 5DKDA 4NQNA 1WUMA 4QSWA 4TU4A 5A5PA 4MR3A 5LKZA 4QSXA 4A9OA 4Z1QA 5HFQA 4HXPA 2DVSA 4TT2A 1JSPB 2KTBB 3P1EA 1F68A 5A83A 5D25A 5F3AA 4MENA 5LJ0A 4HXNA 5CY9A 4PCEA 5G4RA 5CS8A 4UYHA 5LJ1A 3IU6A 5FG4A 5KHMA 4YYKA 5IGKA 4MR5A 5AD2A 1E6IA 4WHUA 5CRMA 3D7CA 3SVHA 5DKHA 5I40A 5G4SA 4CL9A 2N9GA 4NS5A 4QYLA 5FE0A 4HXMA 5CQ3A 5TCMA 5EPRA 5ACYA 4YBTA 4Q0OA 3MULA 4QR3A 2DVQA 5FFVA 4UYFA 5DY7A 4RVRA 5ENCA 4CUPA 2DATA 5CUGA 4YBMA 2YELA 5DW1A 5E9LA 5DLXA 4J0SA 1N72A 4O7BA 4TQNA 5ENGA 5I80A 5FG5A 4QUTA 2R0VA 5JI8A 5EISA 4A9LA 4ZW1A 2OO1A 4NRCA 4OUFA 4F3IA 4MEQA 4NQMA 2DKWA 4X2IA 5EWVA 4NYVA 4LZ2A 4NXJA 4A9KA 4QNSA 4AKNA 4IR6A 2NXBA 4J0RA 4QR4A 5EWCA 5CRZA 3DWYA 2R0SA 3MUKA 4TYLA 5ENIA 5H85A 5D26A 5C4QA 5EPBA 3U5PA 4XY9A 5CQ7A 5FH6A 5EGUA 5E3GA 4NR4A 2F6JA 4NR8A 3UVDA 3JVLA 5F25A 5FH7A 5CQTA 4HXLA 4BW2A 4N4FA 5TB6A 5I88A 5ETBA 4YYMA 3JVKA 5FE4A 5D3LA 5LJ2A 5L8UA 4LZSA 3Q2EA 4ZC9A 4NR6A 5LVRA 3QZVA 5A7CA 4TU6A 5DFDA 5E9KA 5D3RA 5H1TA 2L5EA 2OSSA 3MQMA 4UYDA 2E7NA 5AMEA 4NR7A 3GG3A 4MR6A 5DW2A 4HXSA 4YYNA 3JVJA 5I7XA 5HELA 4UYEA 4QY4A 3S92A 2RNYA 5CQ6A 4A9FA 3UV4A 4XUAA 4QEWA 5FE6A 4O71A 2RI7A 5E7DA 4QSTA 5CQAA 3SVGA 5EM3A 5HEMA 3U5JA 5IGMA 5A5RA 4NR9A 5CUEA 5I29A 4NR5A 2H60A 3LQHA 5CQ4A 4QSQA 4J3IA 4CUQA 3AADA 4BW4A 1WUGA 5F60A 5CGPA 5II2A 5KU3A 4TZ2A 5BT4A 5F62A 3IU5A 3TLPA 5F1LA 5E0RA 4O70A 3SVFA 4PY6A 2DVVA 4QEUA 5CZGA 4TT6A 2L85A 3QZSA 4NRAA 5CUDA 5EA1A 5D3TA 4YK0A 5HM0A 2I8NA 2YQDA 5FE3A 5L96A 4HBYA 2WP1A 4C67A 5L97A 4A9EA 4KV1A 5F36A 5HRWA 4MR4A 5CFWA 5FE8A 4LC2A 4BHWA 4YYJA 3LJWA 4HBVA 4BW1A 5FFYA 5IGLA 4Z6HA 4LRGA 5D0CA 5E9MA 4QBMA 5HCLA 2DVRA 3U5LA 4PKLA 4IOOA 3UVWA 4BJXA 5HENA 5KTUA 4KCXA 4O7CA 5E73A 4HBXA 2R0YA 3P1CA 2MJVB 5A82A 4HXRA 5E9YA 3ZYUA 4KV4A 2F6NA 1X0JA 2D82A 2YDWA 5FDZA 5L98A 5DYXA 2E7OA 5EPSA 4Z6IA 3LXJA 3LQIA 5DLZA 3HMEA 4UIXA 4ALGA 5DFBA 3AQAA 4LR6A 4QB3A 5D3JA 5EI4A 4N3WA 3O36A 4CFLA 4TTEA 5K29A 3G0JA 5D24A 4BW3A 5CPEA 5L99A 3DAIA 5HRXA 3I3JA 5BT5A 5IG6A 4CUTA 3O34A 4IORA 3LQJA 4TS8A 4N4HA 4A9JA 5A5OA 4XY8A 5FB0A 4OGIA 4CLBA 5A5NA 5D3HA 5DYAA 4IR3A 4NUCA 3U5NA 4XUBA 5F1HA 5FBXA 4YY6A 2YW5A 4IOQA 5HQ7A 5IGNA 5EICA 5LKTA 5II1A 4UIZA 5D3SA 3P1FA 5DYUA 5F63A 3JVMA 4YADA 4A9MA 5F5ZA 1ZS5A 4DONA 4YYHA 5DX4A 2GRCA 5C8GA 5KTXA 4O7FA 4QSUA 4NYWA 4UYFB 5H1UA 4UYGA 3MXFA 4NRBA 4YY4A 4QEVA 4NUEA 2G4AA 3U5KA 3MB3A 4YAXA 4GPJA 4ZQLA 5EP7A 4HXOA 5LUUA 2LSPB 4Q0NA 3HMHA 5C87A 4CUUA 4IR5A 5CUAA 3P1DA 5I83A 5ENFA 3QZTA 3UVYA 2RNWA 5A81A 4A9IA 1EQFA 5I86A 1JM4B 4UIYA 4QR5A 4A9NA 5LKUA 3UV5A 5IBNA 4YBSA 4Z93A 5EK9A 5H1VA 5EU1A 3O35A 5CQ8A 5ENJA 4QSRA 5ENBA 2RFJA 4N4IA 5EWDA 5FE1A 4A9HA 3RCWA 5C7NA 4Y03A 5HJCA 5FE2A 5CTLA 4QZSA 5FE9A 5FE5A 5COIA 5EWHA 4QSSA 4UIUA 5F2PA 5LKXA 2RO1A 4PCIA 5EQ1A 5A5SA 5E9IA 5CQ5A 2OUOA 4YH3A 5EVAA 4O74A 4MEOA 4PTBA 5AMFA 4YATA 2YEKA 4FLPA 5HQ5A 5E9VA 2D9EA 5ENEA 4QUUA 4QYDA 4YABA 5L8TA 4O72A 4XYAA 3MB4A 4YH4A 3UV2A 4OGJA 2YYNA 4QSVA 4YYIA 3NXBA 4UITA 5FE7A 4LDFA 4Z1SA 4TT4A 3K2JA 5D3PA 5D3NA 5DFCA 2RNXA 3O33A 4C66A 4LYSA 5FG6A 4QC1A 3FKMX 4O78A 4NUDA 4O7EA 5DYCA 5J0DA 5HRVA 5HLSA 5HQ6A 4MEPA 5C89A 4NYXA 4WIVA 5HFRA 4O7AA 3ONIA 4CUSA 5IIDA 4O77A 5F61A 5A5QA 5LVQA 4O76A 4QC3A 5EV9A 5CUCA 3U5OA 4HBWA 3O37A 2R10A 4IR4A 5I1QA 5FH8A 3U5MA 2L84A 5CP5A 4ALHA 4TZ8A 4WHWA 2RS9B 5ETDA 2DWWA 5KTWA 2WP2A 2E3KA 3P5OA 5E74A 5FFWA 2FSAA 5BT3A 5E3DA 3Q2FA 5FB1A 4HXKA 5AD3A 5JWMA 4UIWA 5D7XA 5A85A 4YYDA 4LYWA 5CU8A 5ENHA 4N4GA 4LYIA 4PS5A 4LZRA 4UIVA
chains in the Genus database with same CATH superfamily
5KO4A 5DKCA 3S91A 5I89A 3HMFA 3UVXA 4O75A 5DBMA 5I7YA 5EWWA 4E96A 4YYGA 5C85A 2YEMA 4QSPA 4CFKA 2I7KA 5CUBA 3UW9A 4J1PA 4YC9A 3G0LA 4CURA 5DKDA 4NQNA 1WUMA 4QSWA 4TU4A 5A5PA 4MR3A 5LKZA 4QSXA 4A9OA 4Z1QA 5HFQA 4HXPA 2DVSA 4TT2A 1JSPB 2KTBB 3P1EA 1F68A 5A83A 5D25A 5F3AA 4MENA 5LJ0A 4HXNA 5CY9A 4PCEA 5G4RA 5CS8A 4UYHA 5LJ1A 3IU6A 5FG4A 5KHMA 4YYKA 5IGKA 4MR5A 5AD2A 1E6IA 4WHUA 5CRMA 3D7CA 3SVHA 5DKHA 5I40A 5G4SA 3VKGA 4CL9A 2N9GA 4NS5A 4QYLA 5FE0A 4HXMA 5CQ3A 5TCMA 1ZKRA 5EPRA 5ACYA 4YBTA 4Q0OA 3MULA 4QR3A 2DVQA 5FFVA 4UYFA 5DY7A 4RVRA 5ENCA 4CUPA 2DATA 5CUGA 4YBMA 2YELA 5DW1A 5E9LA 5DLXA 4J0SA 1N72A 4O7BA 4TQNA 5ENGA 5I80A 5FG5A 4QUTA 2R0VA 5JI8A 5EISA 4A9LA 4ZW1A 2OO1A 4NRCA 4OUFA 4F3IA 4MEQA 4NQMA 2DKWA 4X2IA 5EWVA 4NYVA 4LZ2A 4NXJA 4A9KA 4QNSA 4AKNA 4IR6A 2NXBA 4J0RA 4QR4A 5EWCA 5CRZA 3D1BA 2R0SA 3DWYA 3MUKA 4TYLA 5ENIA 5H85A 5D26A 5C4QA 5EPBA 3U5PA 4XY9A 5CQ7A 5FH6A 5EGUA 5E3GA 4NR4A 2F6JA 4NR8A 3UVDA 3JVLA 5F25A 5FH7A 5CQTA 4HXLA 4BW2A 4N4FA 5TB6A 5I88A 5ETBA 4YYMA 3JVKA 5FE4A 5D3LA 5LJ2A 5L8UA 4LZSA 3Q2EA 4ZC9A 4NR6A 5LVRA 3QZVA 5A7CA 4TU6A 5DFDA 5E9KA 5D3RA 5H1TA 2L5EA 2OSSA 3MQMA 4UYDA 2E7NA 5AMEA 4NR7A 3GG3A 4MR6A 5DW2A 4HXSA 4YYNA 3JVJA 5I7XA 5HELA 4UYEA 4QY4A 3S92A 2RNYA 5CQ6A 4A9FA 3UV4A 4XUAA 4QEWA 5FE6A 4O71A 2RI7A 5E7DA 4QSTA 5CQAA 3SVGA 5EM3A 5HEMA 3U5JA 5IGMA 5A5RA 4NR9A 5CUEA 5I29A 4NR5A 2H60A 3LQHA 5CQ4A 4QSQA 4J3IA 4CUQA 3AADA 4BW4A 1WUGA 5F60A 5CGPA 5II2A 5KU3A 4TZ2A 5BT4A 5F62A 3IU5A 3TLPA 5F1LA 5E0RA 4O70A 3SVFA 4PY6A 2DVVA 4QEUA 5CZGA 4TT6A 2L85A 3QZSA 4NRAA 5CUDA 5EA1A 5D3TA 4YK0A 5HM0A 2I8NA 2YQDA 5FE3A 5L96A 4AKIA 4HBYA 2WP1A 4C67A 5L97A 4A9EA 4KV1A 5F36A 5HRWA 4MR4A 5CFWA 5FE8A 4LC2A 4BHWA 4YYJA 3LJWA 4HBVA 4BW1A 5FFYA 5IGLA 4Z6HA 4LRGA 5D0CA 5E9MA 4QBMA 5HCLA 2DVRA 3U5LA 4PKLA 4IOOA 3UVWA 4BJXA 5HENA 5KTUA 4KCXA 4O7CA 5E73A 4HBXA 2R0YA 3P1CA 2MJVB 5A82A 4HXRA 5E9YA 3ZYUA 4KV4A 2F6NA 1X0JA 2D82A 2YDWA 5FDZA 5L98A 5DYXA 2E7OA 5EPSA 4Z6IA 3LXJA 3LQIA 5DLZA 3HMEA 4UIXA 4ALGA 5DFBA 3AQAA 4LR6A 4QB3A 5D3JA 5EI4A 4N3WA 3O36A 4CFLA 4TTEA 5K29A 3G0JA 5D24A 4BW3A 5CPEA 2EJNA 3DAIA 5HRXA 3I3JA 5BT5A 5L99A 5IG6A 4CUTA 3O34A 4IORA 3LQJA 4TS8A 4N4HA 4A9JA 5A5OA 4XY8A 5FB0A 4OGIA 4CLBA 5A5NA 5D3HA 5DYAA 4IR3A 4NUCA 3U5NA 4XUBA 5F1HA 5FBXA 4YY6A 2YW5A 4IOQA 5HQ7A 5IGNA 5EICA 5LKTA 5II1A 4UIZA 5D3SA 3P1FA 5DYUA 5F63A 3JVMA 4YADA 4A9MA 5F5ZA 1ZS5A 4DONA 4YYHA 5DX4A 2GRCA 5C8GA 5KTXA 4O7FA 4QSUA 4NYWA 1PUOA 4UYFB 5H1UA 4UYGA 3MXFA 4NRBA 4YY4A 4QEVA 4NUEA 2G4AA 3U5KA 3MB3A 4YAXA 4GPJA 4ZQLA 5EP7A 4HXOA 5LUUA 2LSPB 4Q0NA 3HMHA 5C87A 4CUUA 4IR5A 5CUAA 3P1DA 5I83A 5ENFA 3QZTA 3UVYA 2RNWA 5A81A 4A9IA 1EQFA 5I86A 1JM4B 4UIYA 4QR5A 4A9NA 5LKUA 3UV5A 5IBNA 4YBSA 4Z93A 5EK9A 5H1VA 5EU1A 3O35A 5CQ8A 5ENJA 4QSRA 5ENBA 2RFJA 4N4IA 5EWDA 5FE1A 4A9HA 3ERRA 3RCWA 5C7NA 4Y03A 5HJCA 5FE2A 5CTLA 4QZSA 5FE9A 5FE5A 5COIA 4AI6A 5EWHA 4QSSA 4UIUA 3D1DA 5F2PA 5LKXA 2RO1A 4PCIA 5EQ1A 5A5SA 5E9IA 5CQ5A 2OUOA 4YH3A 5EVAA 4O74A 4MEOA 4PTBA 5AMFA 4YATA 2YEKA 4FLPA 5HQ5A 5E9VA 2D9EA 5ENEA 4QUUA 4QYDA 4YABA 5L8TA 4O72A 4XYAA 3MB4A 4YH4A 3VKHA 3UV2A 4OGJA 2YYNA 4QSVA 4YYIA 3NXBA 4UITA 5FE7A 4LDFA 4Z1SA 4TT4A 3K2JA 5D3PA 5D3NA 5DFCA 2RNXA 3O33A 4C66A 4AKGA 4LYSA 4AKHA 5FG6A 4QC1A 3FKMX 4O78A 4NUDA 4O7EA 5DYCA 5J0DA 5HRVA 5HLSA 5HQ6A 4MEPA 5C89A 4NYXA 4WIVA 5HFRA 4O7AA 3ONIA 4CUSA 5IIDA 4O77A 5F61A 5A5QA 5LVQA 4O76A 4QC3A 5EV9A 5CUCA 3U5OA 4HBWA 3O37A 2R10A 4IR4A 5I1QA 5FH8A 3U5MA 2L84A 5CP5A 4ALHA 4TZ8A 4WHWA 2RS9B 5ETDA 2DWWA 5KTWA 2WP2A 2E3KA 3P5OA 5E74A 5FFWA 2FSAA 5BT3A 5E3DA 3Q2FA 5FB1A 4HXKA 5AD3A 5JWMA 4UIWA 5D7XA 5A85A 4YYDA 4LYWA 5CU8A 5ENHA 4N4GA 4LYIA 4PS5A 4LZRA 4UIVA
chains in the Genus database with same CATH topology
5KO4A 5DKCA 3S91A 5I89A 3HMFA 3UVXA 4O75A 5DBMA 5I7YA 5EWWA 4E96A 4YYGA 5C85A 2YEMA 4QSPA 4CFKA 2I7KA 5CUBA 3UW9A 4J1PA 4YC9A 3G0LA 4CURA 5DKDA 4NQNA 1WUMA 4QSWA 4TU4A 5A5PA 4MR3A 5LKZA 4QSXA 4A9OA 4Z1QA 5HFQA 4HXPA 2DVSA 4TT2A 1JSPB 2KTBB 3P1EA 1F68A 5A83A 5D25A 5F3AA 4MENA 5LJ0A 4HXNA 5CY9A 4PCEA 5G4RA 5CS8A 4UYHA 5LJ1A 3IU6A 5FG4A 5KHMA 4YYKA 5IGKA 4MR5A 5AD2A 1E6IA 4WHUA 5CRMA 3D7CA 3SVHA 5DKHA 5I40A 5G4SA 4CL9A 2N9GA 4NS5A 4QYLA 5FE0A 4HXMA 5CQ3A 5TCMA 5EPRA 5ACYA 4YBTA 4Q0OA 3MULA 4QR3A 2DVQA 5FFVA 4UYFA 5DY7A 4RVRA 5ENCA 4CUPA 2DATA 5CUGA 4YBMA 2YELA 5DW1A 5E9LA 5DLXA 4J0SA 1N72A 4O7BA 4TQNA 5ENGA 5I80A 5FG5A 4QUTA 2R0VA 5JI8A 5EISA 4A9LA 4ZW1A 2OO1A 4NRCA 4OUFA 4F3IA 4MEQA 4NQMA 2DKWA 4X2IA 5EWVA 4NYVA 4LZ2A 4NXJA 4A9KA 4QNSA 4AKNA 4IR6A 2NXBA 4J0RA 4QR4A 5EWCA 5CRZA 3DWYA 2R0SA 3MUKA 4TYLA 5ENIA 5H85A 5D26A 5C4QA 5EPBA 3U5PA 4XY9A 5CQ7A 5FH6A 5EGUA 5E3GA 4NR4A 2F6JA 4NR8A 3UVDA 3JVLA 5F25A 5FH7A 5CQTA 4HXLA 4BW2A 4N4FA 5TB6A 5I88A 5ETBA 4YYMA 3JVKA 5FE4A 5D3LA 5LJ2A 5L8UA 4LZSA 3Q2EA 4ZC9A 4NR6A 5LVRA 3QZVA 5A7CA 4TU6A 5DFDA 5E9KA 5D3RA 5H1TA 2L5EA 2OSSA 3MQMA 4UYDA 2E7NA 5AMEA 4NR7A 3GG3A 4MR6A 5DW2A 4HXSA 4YYNA 3JVJA 5I7XA 5HELA 4UYEA 4QY4A 3S92A 2RNYA 5CQ6A 4A9FA 3UV4A 4XUAA 4QEWA 5FE6A 4O71A 2RI7A 5E7DA 4QSTA 5CQAA 3SVGA 5EM3A 5HEMA 3U5JA 5IGMA 5A5RA 4NR9A 5CUEA 5I29A 4NR5A 2H60A 3LQHA 5CQ4A 4QSQA 4J3IA 4CUQA 3AADA 4BW4A 1WUGA 5F60A 5CGPA 5II2A 5KU3A 4TZ2A 5BT4A 5F62A 3IU5A 3TLPA 5F1LA 5E0RA 4O70A 3SVFA 4PY6A 2DVVA 4QEUA 5CZGA 4TT6A 2L85A 3QZSA 4NRAA 5CUDA 5EA1A 5D3TA 4YK0A 5HM0A 2I8NA 2YQDA 5FE3A 5L96A 4HBYA 2WP1A 4C67A 5L97A 4A9EA 4KV1A 5F36A 5HRWA 4MR4A 5CFWA 5FE8A 4LC2A 4BHWA 4YYJA 3LJWA 4HBVA 4BW1A 5FFYA 5IGLA 4Z6HA 4LRGA 5D0CA 5E9MA 4QBMA 5HCLA 2DVRA 3U5LA 4PKLA 4IOOA 3UVWA 4BJXA 5HENA 5KTUA 4KCXA 4O7CA 5E73A 4HBXA 2R0YA 3P1CA 2MJVB 5A82A 4HXRA 5E9YA 3ZYUA 4KV4A 2F6NA 1X0JA 2D82A 2YDWA 5FDZA 5L98A 5DYXA 2E7OA 5EPSA 4Z6IA 3LXJA 3LQIA 5DLZA 3HMEA 4UIXA 4ALGA 5DFBA 3AQAA 4LR6A 4QB3A 5D3JA 5EI4A 4N3WA 3O36A 4CFLA 4TTEA 5K29A 3G0JA 5D24A 4BW3A 5CPEA 5L99A 3DAIA 5HRXA 3I3JA 5BT5A 5IG6A 4CUTA 3O34A 4IORA 3LQJA 4TS8A 4N4HA 4A9JA 5A5OA 4XY8A 5FB0A 4OGIA 4CLBA 5A5NA 5D3HA 5DYAA 4IR3A 4NUCA 3U5NA 4XUBA 5F1HA 5FBXA 4YY6A 2YW5A 4IOQA 5HQ7A 5IGNA 5EICA 5LKTA 5II1A 4UIZA 5D3SA 3P1FA 5DYUA 5F63A 3JVMA 4YADA 4A9MA 5F5ZA 1ZS5A 4DONA 4YYHA 5DX4A 2GRCA 5C8GA 5KTXA 4O7FA 4QSUA 4NYWA 4UYFB 5H1UA 4UYGA 3MXFA 4NRBA 4YY4A 4QEVA 4NUEA 2G4AA 3U5KA 3MB3A 4YAXA 4GPJA 4ZQLA 5EP7A 4HXOA 5LUUA 2LSPB 4Q0NA 3HMHA 5C87A 4CUUA 4IR5A 5CUAA 3P1DA 5I83A 5ENFA 3QZTA 3UVYA 2RNWA 5A81A 4A9IA 1EQFA 5I86A 1JM4B 4UIYA 4QR5A 4A9NA 5LKUA 3UV5A 5IBNA 4YBSA 4Z93A 5EK9A 5H1VA 5EU1A 3O35A 5CQ8A 5ENJA 4QSRA 5ENBA 2RFJA 4N4IA 5EWDA 5FE1A 4A9HA 3RCWA 5C7NA 4Y03A 5HJCA 5FE2A 5CTLA 4QZSA 5FE9A 5FE5A 5COIA 5EWHA 4QSSA 4UIUA 5F2PA 5LKXA 2RO1A 4PCIA 5EQ1A 5A5SA 5E9IA 5CQ5A 2OUOA 4YH3A 5EVAA 4O74A 4MEOA 4PTBA 5AMFA 4YATA 2YEKA 4FLPA 5HQ5A 5E9VA 2D9EA 5ENEA 4QUUA 4QYDA 4YABA 5L8TA 4O72A 4XYAA 3MB4A 4YH4A 3UV2A 4OGJA 2YYNA 4QSVA 4YYIA 3NXBA 4UITA 5FE7A 4LDFA 4Z1SA 4TT4A 3K2JA 5D3PA 5D3NA 5DFCA 2RNXA 3O33A 4C66A 4LYSA 5FG6A 4QC1A 3FKMX 4O78A 4NUDA 4O7EA 5DYCA 5J0DA 5HRVA 5HLSA 5HQ6A 4MEPA 5C89A 4NYXA 4WIVA 5HFRA 4O7AA 3ONIA 4CUSA 5IIDA 4O77A 5F61A 5A5QA 5LVQA 4O76A 4QC3A 5EV9A 5CUCA 3U5OA 4HBWA 3O37A 2R10A 4IR4A 5I1QA 5FH8A 3U5MA 2L84A 5CP5A 4ALHA 4TZ8A 4WHWA 2RS9B 5ETDA 2DWWA 5KTWA 2WP2A 2E3KA 3P5OA 5E74A 5FFWA 2FSAA 5BT3A 5E3DA 3Q2FA 5FB1A 4HXKA 5AD3A 5JWMA 4UIWA 5D7XA 5A85A 4YYDA 4LYWA 5CU8A 5ENHA 4N4GA 4LYIA 4PS5A 4LZRA 4UIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KO4 A;  5DKC A;  3S91 A;  5I89 A;  3HMF A;  3UVX A;  4O75 A;  5DBM A;  5I7Y A;  5EWW A;  4E96 A;  4YYG A;  5C85 A;  2YEM A;  4QSP A;  4CFK A;  2I7K A;  5CUB A;  3UW9 A;  4J1P A;  4YC9 A;  3G0L A;  4CUR A;  5DKD A;  4NQN A;  1WUM A;  4QSW A;  4TU4 A;  5A5P A;  4MR3 A;  5LKZ A;  4QSX A;  4A9O A;  4Z1Q A;  5HFQ A;  4HXP A;  2DVS A;  4TT2 A;  1JSP B;  2KTB B;  3P1E A;  1F68 A;  5A83 A;  5D25 A;  5F3A A;  4MEN A;  5LJ0 A;  4HXN A;  5CY9 A;  4PCE A;  5G4R A;  5CS8 A;  4UYH A;  5LJ1 A;  3IU6 A;  5FG4 A;  5KHM A;  4YYK A;  5IGK A;  4MR5 A;  5AD2 A;  1E6I A;  4WHU A;  5CRM A;  3D7C A;  3SVH A;  5DKH A;  5I40 A;  5G4S A;  4CL9 A;  2N9G A;  4NS5 A;  4QYL A;  5FE0 A;  4HXM A;  5CQ3 A;  5TCM A;  5EPR A;  5ACY A;  4YBT A;  4Q0O A;  3MUL A;  4QR3 A;  2DVQ A;  5FFV A;  4UYF A;  5DY7 A;  4RVR A;  5ENC A;  4CUP A;  2DAT A;  5CUG A;  4YBM A;  2YEL A;  5DW1 A;  5E9L A;  5DLX A;  4J0S A;  1N72 A;  4O7B A;  4TQN A;  5ENG A;  5I80 A;  5FG5 A;  4QUT A;  2R0V A;  5JI8 A;  5EIS A;  4A9L A;  4ZW1 A;  2OO1 A;  4NRC A;  4OUF A;  4F3I A;  4MEQ A;  4NQM A;  2DKW A;  4X2I A;  5EWV A;  4NYV A;  4LZ2 A;  4NXJ A;  4A9K A;  4QNS A;  4AKN A;  4IR6 A;  2NXB A;  4J0R A;  4QR4 A;  5EWC A;  5CRZ A;  3DWY A;  2R0S A;  3MUK A;  4TYL A;  5ENI A;  5H85 A;  5D26 A;  5C4Q A;  5EPB A;  3U5P A;  4XY9 A;  5CQ7 A;  5FH6 A;  5EGU A;  5E3G A;  4NR4 A;  2F6J A;  4NR8 A;  3UVD A;  3JVL A;  5F25 A;  5FH7 A;  5CQT A;  4HXL A;  4BW2 A;  4N4F A;  5TB6 A;  5I88 A;  5ETB A;  4YYM A;  3JVK A;  5FE4 A;  5D3L A;  5LJ2 A;  5L8U A;  4LZS A;  3Q2E A;  4ZC9 A;  4NR6 A;  5LVR A;  3QZV A;  5A7C A;  4TU6 A;  5DFD A;  5E9K A;  5D3R A;  5H1T A;  2L5E A;  2OSS A;  3MQM A;  4UYD A;  2E7N A;  5AME A;  4NR7 A;  3GG3 A;  4MR6 A;  5DW2 A;  4HXS A;  4YYN A;  3JVJ A;  5I7X A;  5HEL A;  4UYE A;  4QY4 A;  3S92 A;  2RNY A;  5CQ6 A;  4A9F A;  3UV4 A;  4XUA A;  4QEW A;  5FE6 A;  4O71 A;  2RI7 A;  5E7D A;  4QST A;  5CQA A;  3SVG A;  5EM3 A;  5HEM A;  3U5J A;  5IGM A;  5A5R A;  4NR9 A;  5CUE A;  5I29 A;  4NR5 A;  2H60 A;  3LQH A;  5CQ4 A;  4QSQ A;  4J3I A;  4CUQ A;  3AAD A;  4BW4 A;  1WUG A;  5F60 A;  5CGP A;  5II2 A;  5KU3 A;  4TZ2 A;  5BT4 A;  5F62 A;  3IU5 A;  3TLP A;  5F1L A;  5E0R A;  4O70 A;  3SVF A;  4PY6 A;  2DVV A;  4QEU A;  5CZG A;  4TT6 A;  2L85 A;  3QZS A;  4NRA A;  5CUD A;  5EA1 A;  5D3T A;  4YK0 A;  5HM0 A;  2I8N A;  2YQD A;  5FE3 A;  5L96 A;  4HBY A;  2WP1 A;  4C67 A;  5L97 A;  4A9E A;  4KV1 A;  5F36 A;  5HRW A;  4MR4 A;  5CFW A;  5FE8 A;  4LC2 A;  4BHW A;  4YYJ A;  3LJW A;  4HBV A;  4BW1 A;  5FFY A;  5IGL A;  4Z6H A;  4LRG A;  5D0C A;  5E9M A;  4QBM A;  5HCL A;  2DVR A;  3U5L A;  4PKL A;  4IOO A;  3UVW A;  4BJX A;  5HEN A;  5KTU A;  4KCX A;  4O7C A;  5E73 A;  4HBX A;  2R0Y A;  3P1C A;  2MJV B;  5A82 A;  4HXR A;  5E9Y A;  3ZYU A;  4KV4 A;  2F6N A;  1X0J A;  2D82 A;  2YDW A;  5FDZ A;  5L98 A;  5DYX A;  2E7O A;  5EPS A;  4Z6I A;  3LXJ A;  3LQI A;  5DLZ A;  3HME A;  4UIX A;  4ALG A;  5DFB A;  3AQA A;  4LR6 A;  4QB3 A;  5D3J A;  5EI4 A;  4N3W A;  3O36 A;  4CFL A;  4TTE A;  5K29 A;  3G0J A;  5D24 A;  4BW3 A;  5CPE A;  5L99 A;  3DAI A;  5HRX A;  3I3J A;  5BT5 A;  5IG6 A;  4CUT A;  3O34 A;  4IOR A;  3LQJ A;  4TS8 A;  4N4H A;  4A9J A;  5A5O A;  4XY8 A;  5FB0 A;  4OGI A;  4CLB A;  5A5N A;  5D3H A;  5DYA A;  4IR3 A;  4NUC A;  3U5N A;  4XUB A;  5F1H A;  5FBX A;  4YY6 A;  2YW5 A;  4IOQ A;  5HQ7 A;  5IGN A;  5EIC A;  5LKT A;  5II1 A;  4UIZ A;  5D3S A;  3P1F A;  5DYU A;  5F63 A;  3JVM A;  4YAD A;  4A9M A;  5F5Z A;  1ZS5 A;  4DON A;  4YYH A;  5DX4 A;  2GRC A;  5C8G A;  5KTX A;  4O7F A;  4QSU A;  4NYW A;  4UYF B;  5H1U A;  4UYG A;  3MXF A;  4NRB A;  4YY4 A;  4QEV A;  4NUE A;  2G4A A;  3U5K A;  3MB3 A;  4YAX A;  4GPJ A;  4ZQL A;  5EP7 A;  4HXO A;  5LUU A;  2LSP B;  4Q0N A;  3HMH A;  5C87 A;  4CUU A;  4IR5 A;  5CUA A;  3P1D A;  5I83 A;  5ENF A;  3QZT A;  3UVY A;  2RNW A;  5A81 A;  4A9I A;  1EQF A;  5I86 A;  1JM4 B;  4UIY A;  4QR5 A;  4A9N A;  5LKU A;  3UV5 A;  5IBN A;  4YBS A;  4Z93 A;  5EK9 A;  5H1V A;  5EU1 A;  3O35 A;  5CQ8 A;  5ENJ A;  4QSR A;  5ENB A;  2RFJ A;  4N4I A;  5EWD A;  5FE1 A;  4A9H A;  3RCW A;  5C7N A;  4Y03 A;  5HJC A;  5FE2 A;  5CTL A;  4QZS A;  5FE9 A;  5FE5 A;  5COI A;  5EWH A;  4QSS A;  4UIU A;  5F2P A;  5LKX A;  2RO1 A;  4PCI A;  5EQ1 A;  5A5S A;  5E9I A;  5CQ5 A;  2OUO A;  4YH3 A;  5EVA A;  4O74 A;  4MEO A;  4PTB A;  5AMF A;  4YAT A;  2YEK A;  4FLP A;  5HQ5 A;  5E9V A;  2D9E A;  5ENE A;  4QUU A;  4QYD A;  4YAB A;  5L8T A;  4O72 A;  4XYA A;  3MB4 A;  4YH4 A;  3UV2 A;  4OGJ A;  2YYN A;  4QSV A;  4YYI A;  3NXB A;  4UIT A;  5FE7 A;  4LDF A;  4Z1S A;  4TT4 A;  3K2J A;  5D3P A;  5D3N A;  5DFC A;  2RNX A;  3O33 A;  4C66 A;  4LYS A;  5FG6 A;  4QC1 A;  3FKM X;  4O78 A;  4NUD A;  4O7E A;  5DYC A;  5J0D A;  5HRV A;  5HLS A;  5HQ6 A;  4MEP A;  5C89 A;  4NYX A;  4WIV A;  5HFR A;  4O7A A;  3ONI A;  4CUS A;  5IID A;  4O77 A;  5F61 A;  5A5Q A;  5LVQ A;  4O76 A;  4QC3 A;  5EV9 A;  5CUC A;  3U5O A;  4HBW A;  3O37 A;  2R10 A;  4IR4 A;  5I1Q A;  5FH8 A;  3U5M A;  2L84 A;  5CP5 A;  4ALH A;  4TZ8 A;  4WHW A;  2RS9 B;  5ETD A;  2DWW A;  5KTW A;  2WP2 A;  2E3K A;  3P5O A;  5E74 A;  5FFW A;  2FSA A;  5BT3 A;  5E3D A;  3Q2F A;  5FB1 A;  4HXK A;  5AD3 A;  5JWM A;  4UIW A;  5D7X A;  5A85 A;  4YYD A;  4LYW A;  5CU8 A;  5ENH A;  4N4G A;  4LYI A;  4PS5 A;  4LZR A;  4UIV A; 
#chains in the Genus database with same CATH topology
 5KO4 A;  5DKC A;  3S91 A;  5I89 A;  3HMF A;  3UVX A;  4O75 A;  5DBM A;  5I7Y A;  5EWW A;  4E96 A;  4YYG A;  5C85 A;  2YEM A;  4QSP A;  4CFK A;  2I7K A;  5CUB A;  3UW9 A;  4J1P A;  4YC9 A;  3G0L A;  4CUR A;  5DKD A;  4NQN A;  1WUM A;  4QSW A;  4TU4 A;  5A5P A;  4MR3 A;  5LKZ A;  4QSX A;  4A9O A;  4Z1Q A;  5HFQ A;  4HXP A;  2DVS A;  4TT2 A;  1JSP B;  2KTB B;  3P1E A;  1F68 A;  5A83 A;  5D25 A;  5F3A A;  4MEN A;  5LJ0 A;  4HXN A;  5CY9 A;  4PCE A;  5G4R A;  5CS8 A;  4UYH A;  5LJ1 A;  3IU6 A;  5FG4 A;  5KHM A;  4YYK A;  5IGK A;  4MR5 A;  5AD2 A;  1E6I A;  4WHU A;  5CRM A;  3D7C A;  3SVH A;  5DKH A;  5I40 A;  5G4S A;  3VKG A;  4CL9 A;  2N9G A;  4NS5 A;  4QYL A;  5FE0 A;  4HXM A;  5CQ3 A;  5TCM A;  1ZKR A;  5EPR A;  5ACY A;  4YBT A;  4Q0O A;  3MUL A;  4QR3 A;  2DVQ A;  5FFV A;  4UYF A;  5DY7 A;  4RVR A;  5ENC A;  4CUP A;  2DAT A;  5CUG A;  4YBM A;  2YEL A;  5DW1 A;  5E9L A;  5DLX A;  4J0S A;  1N72 A;  4O7B A;  4TQN A;  5ENG A;  5I80 A;  5FG5 A;  4QUT A;  2R0V A;  5JI8 A;  5EIS A;  4A9L A;  4ZW1 A;  2OO1 A;  4NRC A;  4OUF A;  4F3I A;  4MEQ A;  4NQM A;  2DKW A;  4X2I A;  5EWV A;  4NYV A;  4LZ2 A;  4NXJ A;  4A9K A;  4QNS A;  4AKN A;  4IR6 A;  2NXB A;  4J0R A;  4QR4 A;  5EWC A;  5CRZ A;  3D1B A;  2R0S A;  3DWY A;  3MUK A;  4TYL A;  5ENI A;  5H85 A;  5D26 A;  5C4Q A;  5EPB A;  3U5P A;  4XY9 A;  5CQ7 A;  5FH6 A;  5EGU A;  5E3G A;  4NR4 A;  2F6J A;  4NR8 A;  3UVD A;  3JVL A;  5F25 A;  5FH7 A;  5CQT A;  4HXL A;  4BW2 A;  4N4F A;  5TB6 A;  5I88 A;  5ETB A;  4YYM A;  3JVK A;  5FE4 A;  5D3L A;  5LJ2 A;  5L8U A;  4LZS A;  3Q2E A;  4ZC9 A;  4NR6 A;  5LVR A;  3QZV A;  5A7C A;  4TU6 A;  5DFD A;  5E9K A;  5D3R A;  5H1T A;  2L5E A;  2OSS A;  3MQM A;  4UYD A;  2E7N A;  5AME A;  4NR7 A;  3GG3 A;  4MR6 A;  5DW2 A;  4HXS A;  4YYN A;  3JVJ A;  5I7X A;  5HEL A;  4UYE A;  4QY4 A;  3S92 A;  2RNY A;  5CQ6 A;  4A9F A;  3UV4 A;  4XUA A;  4QEW A;  5FE6 A;  4O71 A;  2RI7 A;  5E7D A;  4QST A;  5CQA A;  3SVG A;  5EM3 A;  5HEM A;  3U5J A;  5IGM A;  5A5R A;  4NR9 A;  5CUE A;  5I29 A;  4NR5 A;  2H60 A;  3LQH A;  5CQ4 A;  4QSQ A;  4J3I A;  4CUQ A;  3AAD A;  4BW4 A;  1WUG A;  5F60 A;  5CGP A;  5II2 A;  5KU3 A;  4TZ2 A;  5BT4 A;  5F62 A;  3IU5 A;  3TLP A;  5F1L A;  5E0R A;  4O70 A;  3SVF A;  4PY6 A;  2DVV A;  4QEU A;  5CZG A;  4TT6 A;  2L85 A;  3QZS A;  4NRA A;  5CUD A;  5EA1 A;  5D3T A;  4YK0 A;  5HM0 A;  2I8N A;  2YQD A;  5FE3 A;  5L96 A;  4AKI A;  4HBY A;  2WP1 A;  4C67 A;  5L97 A;  4A9E A;  4KV1 A;  5F36 A;  5HRW A;  4MR4 A;  5CFW A;  5FE8 A;  4LC2 A;  4BHW A;  4YYJ A;  3LJW A;  4HBV A;  4BW1 A;  5FFY A;  5IGL A;  4Z6H A;  4LRG A;  5D0C A;  5E9M A;  4QBM A;  5HCL A;  2DVR A;  3U5L A;  4PKL A;  4IOO A;  3UVW A;  4BJX A;  5HEN A;  5KTU A;  4KCX A;  4O7C A;  5E73 A;  4HBX A;  2R0Y A;  3P1C A;  2MJV B;  5A82 A;  4HXR A;  5E9Y A;  3ZYU A;  4KV4 A;  2F6N A;  1X0J A;  2D82 A;  2YDW A;  5FDZ A;  5L98 A;  5DYX A;  2E7O A;  5EPS A;  4Z6I A;  3LXJ A;  3LQI A;  5DLZ A;  3HME A;  4UIX A;  4ALG A;  5DFB A;  3AQA A;  4LR6 A;  4QB3 A;  5D3J A;  5EI4 A;  4N3W A;  3O36 A;  4CFL A;  4TTE A;  5K29 A;  3G0J A;  5D24 A;  4BW3 A;  5CPE A;  2EJN A;  3DAI A;  5HRX A;  3I3J A;  5BT5 A;  5L99 A;  5IG6 A;  4CUT A;  3O34 A;  4IOR A;  3LQJ A;  4TS8 A;  4N4H A;  4A9J A;  5A5O A;  4XY8 A;  5FB0 A;  4OGI A;  4CLB A;  5A5N A;  5D3H A;  5DYA A;  4IR3 A;  4NUC A;  3U5N A;  4XUB A;  5F1H A;  5FBX A;  4YY6 A;  2YW5 A;  4IOQ A;  5HQ7 A;  5IGN A;  5EIC A;  5LKT A;  5II1 A;  4UIZ A;  5D3S A;  3P1F A;  5DYU A;  5F63 A;  3JVM A;  4YAD A;  4A9M A;  5F5Z A;  1ZS5 A;  4DON A;  4YYH A;  5DX4 A;  2GRC A;  5C8G A;  5KTX A;  4O7F A;  4QSU A;  4NYW A;  1PUO A;  4UYF B;  5H1U A;  4UYG A;  3MXF A;  4NRB A;  4YY4 A;  4QEV A;  4NUE A;  2G4A A;  3U5K A;  3MB3 A;  4YAX A;  4GPJ A;  4ZQL A;  5EP7 A;  4HXO A;  5LUU A;  2LSP B;  4Q0N A;  3HMH A;  5C87 A;  4CUU A;  4IR5 A;  5CUA A;  3P1D A;  5I83 A;  5ENF A;  3QZT A;  3UVY A;  2RNW A;  5A81 A;  4A9I A;  1EQF A;  5I86 A;  1JM4 B;  4UIY A;  4QR5 A;  4A9N A;  5LKU A;  3UV5 A;  5IBN A;  4YBS A;  4Z93 A;  5EK9 A;  5H1V A;  5EU1 A;  3O35 A;  5CQ8 A;  5ENJ A;  4QSR A;  5ENB A;  2RFJ A;  4N4I A;  5EWD A;  5FE1 A;  4A9H A;  3ERR A;  3RCW A;  5C7N A;  4Y03 A;  5HJC A;  5FE2 A;  5CTL A;  4QZS A;  5FE9 A;  5FE5 A;  5COI A;  4AI6 A;  5EWH A;  4QSS A;  4UIU A;  3D1D A;  5F2P A;  5LKX A;  2RO1 A;  4PCI A;  5EQ1 A;  5A5S A;  5E9I A;  5CQ5 A;  2OUO A;  4YH3 A;  5EVA A;  4O74 A;  4MEO A;  4PTB A;  5AMF A;  4YAT A;  2YEK A;  4FLP A;  5HQ5 A;  5E9V A;  2D9E A;  5ENE A;  4QUU A;  4QYD A;  4YAB A;  5L8T A;  4O72 A;  4XYA A;  3MB4 A;  4YH4 A;  3VKH A;  3UV2 A;  4OGJ A;  2YYN A;  4QSV A;  4YYI A;  3NXB A;  4UIT A;  5FE7 A;  4LDF A;  4Z1S A;  4TT4 A;  3K2J A;  5D3P A;  5D3N A;  5DFC A;  2RNX A;  3O33 A;  4C66 A;  4AKG A;  4LYS A;  4AKH A;  5FG6 A;  4QC1 A;  3FKM X;  4O78 A;  4NUD A;  4O7E A;  5DYC A;  5J0D A;  5HRV A;  5HLS A;  5HQ6 A;  4MEP A;  5C89 A;  4NYX A;  4WIV A;  5HFR A;  4O7A A;  3ONI A;  4CUS A;  5IID A;  4O77 A;  5F61 A;  5A5Q A;  5LVQ A;  4O76 A;  4QC3 A;  5EV9 A;  5CUC A;  3U5O A;  4HBW A;  3O37 A;  2R10 A;  4IR4 A;  5I1Q A;  5FH8 A;  3U5M A;  2L84 A;  5CP5 A;  4ALH A;  4TZ8 A;  4WHW A;  2RS9 B;  5ETD A;  2DWW A;  5KTW A;  2WP2 A;  2E3K A;  3P5O A;  5E74 A;  5FFW A;  2FSA A;  5BT3 A;  5E3D A;  3Q2F A;  5FB1 A;  4HXK A;  5AD3 A;  5JWM A;  4UIW A;  5D7X A;  5A85 A;  4YYD A;  4LYW A;  5CU8 A;  5ENH A;  4N4G A;  4LYI A;  4PS5 A;  4LZR A;  4UIV A; 
#chains in the Genus database with same CATH homology
 5KO4 A;  5DKC A;  3S91 A;  5I89 A;  3HMF A;  3UVX A;  4O75 A;  5DBM A;  5I7Y A;  5EWW A;  4E96 A;  4YYG A;  5C85 A;  2YEM A;  4QSP A;  4CFK A;  2I7K A;  5CUB A;  3UW9 A;  4J1P A;  4YC9 A;  3G0L A;  4CUR A;  5DKD A;  4NQN A;  1WUM A;  4QSW A;  4TU4 A;  5A5P A;  4MR3 A;  5LKZ A;  4QSX A;  4A9O A;  4Z1Q A;  5HFQ A;  4HXP A;  2DVS A;  4TT2 A;  1JSP B;  2KTB B;  3P1E A;  1F68 A;  5A83 A;  5D25 A;  5F3A A;  4MEN A;  5LJ0 A;  4HXN A;  5CY9 A;  4PCE A;  5G4R A;  5CS8 A;  4UYH A;  5LJ1 A;  3IU6 A;  5FG4 A;  5KHM A;  4YYK A;  5IGK A;  4MR5 A;  5AD2 A;  1E6I A;  4WHU A;  5CRM A;  3D7C A;  3SVH A;  5DKH A;  5I40 A;  5G4S A;  4CL9 A;  2N9G A;  4NS5 A;  4QYL A;  5FE0 A;  4HXM A;  5CQ3 A;  5TCM A;  5EPR A;  5ACY A;  4YBT A;  4Q0O A;  3MUL A;  4QR3 A;  2DVQ A;  5FFV A;  4UYF A;  5DY7 A;  4RVR A;  5ENC A;  4CUP A;  2DAT A;  5CUG A;  4YBM A;  2YEL A;  5DW1 A;  5E9L A;  5DLX A;  4J0S A;  1N72 A;  4O7B A;  4TQN A;  5ENG A;  5I80 A;  5FG5 A;  4QUT A;  2R0V A;  5JI8 A;  5EIS A;  4A9L A;  4ZW1 A;  2OO1 A;  4NRC A;  4OUF A;  4F3I A;  4MEQ A;  4NQM A;  2DKW A;  4X2I A;  5EWV A;  4NYV A;  4LZ2 A;  4NXJ A;  4A9K A;  4QNS A;  4AKN A;  4IR6 A;  2NXB A;  4J0R A;  4QR4 A;  5EWC A;  5CRZ A;  3DWY A;  2R0S A;  3MUK A;  4TYL A;  5ENI A;  5H85 A;  5D26 A;  5C4Q A;  5EPB A;  3U5P A;  4XY9 A;  5CQ7 A;  5FH6 A;  5EGU A;  5E3G A;  4NR4 A;  2F6J A;  4NR8 A;  3UVD A;  3JVL A;  5F25 A;  5FH7 A;  5CQT A;  4HXL A;  4BW2 A;  4N4F A;  5TB6 A;  5I88 A;  5ETB A;  4YYM A;  3JVK A;  5FE4 A;  5D3L A;  5LJ2 A;  5L8U A;  4LZS A;  3Q2E A;  4ZC9 A;  4NR6 A;  5LVR A;  3QZV A;  5A7C A;  4TU6 A;  5DFD A;  5E9K A;  5D3R A;  5H1T A;  2L5E A;  2OSS A;  3MQM A;  4UYD A;  2E7N A;  5AME A;  4NR7 A;  3GG3 A;  4MR6 A;  5DW2 A;  4HXS A;  4YYN A;  3JVJ A;  5I7X A;  5HEL A;  4UYE A;  4QY4 A;  3S92 A;  2RNY A;  5CQ6 A;  4A9F A;  3UV4 A;  4XUA A;  4QEW A;  5FE6 A;  4O71 A;  2RI7 A;  5E7D A;  4QST A;  5CQA A;  3SVG A;  5EM3 A;  5HEM A;  3U5J A;  5IGM A;  5A5R A;  4NR9 A;  5CUE A;  5I29 A;  4NR5 A;  2H60 A;  3LQH A;  5CQ4 A;  4QSQ A;  4J3I A;  4CUQ A;  3AAD A;  4BW4 A;  1WUG A;  5F60 A;  5CGP A;  5II2 A;  5KU3 A;  4TZ2 A;  5BT4 A;  5F62 A;  3IU5 A;  3TLP A;  5F1L A;  5E0R A;  4O70 A;  3SVF A;  4PY6 A;  2DVV A;  4QEU A;  5CZG A;  4TT6 A;  2L85 A;  3QZS A;  4NRA A;  5CUD A;  5EA1 A;  5D3T A;  4YK0 A;  5HM0 A;  2I8N A;  2YQD A;  5FE3 A;  5L96 A;  4HBY A;  2WP1 A;  4C67 A;  5L97 A;  4A9E A;  4KV1 A;  5F36 A;  5HRW A;  4MR4 A;  5CFW A;  5FE8 A;  4LC2 A;  4BHW A;  4YYJ A;  3LJW A;  4HBV A;  4BW1 A;  5FFY A;  5IGL A;  4Z6H A;  4LRG A;  5D0C A;  5E9M A;  4QBM A;  5HCL A;  2DVR A;  3U5L A;  4PKL A;  4IOO A;  3UVW A;  4BJX A;  5HEN A;  5KTU A;  4KCX A;  4O7C A;  5E73 A;  4HBX A;  2R0Y A;  3P1C A;  2MJV B;  5A82 A;  4HXR A;  5E9Y A;  3ZYU A;  4KV4 A;  2F6N A;  1X0J A;  2D82 A;  2YDW A;  5FDZ A;  5L98 A;  5DYX A;  2E7O A;  5EPS A;  4Z6I A;  3LXJ A;  3LQI A;  5DLZ A;  3HME A;  4UIX A;  4ALG A;  5DFB A;  3AQA A;  4LR6 A;  4QB3 A;  5D3J A;  5EI4 A;  4N3W A;  3O36 A;  4CFL A;  4TTE A;  5K29 A;  3G0J A;  5D24 A;  4BW3 A;  5CPE A;  5L99 A;  3DAI A;  5HRX A;  3I3J A;  5BT5 A;  5IG6 A;  4CUT A;  3O34 A;  4IOR A;  3LQJ A;  4TS8 A;  4N4H A;  4A9J A;  5A5O A;  4XY8 A;  5FB0 A;  4OGI A;  4CLB A;  5A5N A;  5D3H A;  5DYA A;  4IR3 A;  4NUC A;  3U5N A;  4XUB A;  5F1H A;  5FBX A;  4YY6 A;  2YW5 A;  4IOQ A;  5HQ7 A;  5IGN A;  5EIC A;  5LKT A;  5II1 A;  4UIZ A;  5D3S A;  3P1F A;  5DYU A;  5F63 A;  3JVM A;  4YAD A;  4A9M A;  5F5Z A;  1ZS5 A;  4DON A;  4YYH A;  5DX4 A;  2GRC A;  5C8G A;  5KTX A;  4O7F A;  4QSU A;  4NYW A;  4UYF B;  5H1U A;  4UYG A;  3MXF A;  4NRB A;  4YY4 A;  4QEV A;  4NUE A;  2G4A A;  3U5K A;  3MB3 A;  4YAX A;  4GPJ A;  4ZQL A;  5EP7 A;  4HXO A;  5LUU A;  2LSP B;  4Q0N A;  3HMH A;  5C87 A;  4CUU A;  4IR5 A;  5CUA A;  3P1D A;  5I83 A;  5ENF A;  3QZT A;  3UVY A;  2RNW A;  5A81 A;  4A9I A;  1EQF A;  5I86 A;  1JM4 B;  4UIY A;  4QR5 A;  4A9N A;  5LKU A;  3UV5 A;  5IBN A;  4YBS A;  4Z93 A;  5EK9 A;  5H1V A;  5EU1 A;  3O35 A;  5CQ8 A;  5ENJ A;  4QSR A;  5ENB A;  2RFJ A;  4N4I A;  5EWD A;  5FE1 A;  4A9H A;  3RCW A;  5C7N A;  4Y03 A;  5HJC A;  5FE2 A;  5CTL A;  4QZS A;  5FE9 A;  5FE5 A;  5COI A;  5EWH A;  4QSS A;  4UIU A;  5F2P A;  5LKX A;  2RO1 A;  4PCI A;  5EQ1 A;  5A5S A;  5E9I A;  5CQ5 A;  2OUO A;  4YH3 A;  5EVA A;  4O74 A;  4MEO A;  4PTB A;  5AMF A;  4YAT A;  2YEK A;  4FLP A;  5HQ5 A;  5E9V A;  2D9E A;  5ENE A;  4QUU A;  4QYD A;  4YAB A;  5L8T A;  4O72 A;  4XYA A;  3MB4 A;  4YH4 A;  3UV2 A;  4OGJ A;  2YYN A;  4QSV A;  4YYI A;  3NXB A;  4UIT A;  5FE7 A;  4LDF A;  4Z1S A;  4TT4 A;  3K2J A;  5D3P A;  5D3N A;  5DFC A;  2RNX A;  3O33 A;  4C66 A;  4LYS A;  5FG6 A;  4QC1 A;  3FKM X;  4O78 A;  4NUD A;  4O7E A;  5DYC A;  5J0D A;  5HRV A;  5HLS A;  5HQ6 A;  4MEP A;  5C89 A;  4NYX A;  4WIV A;  5HFR A;  4O7A A;  3ONI A;  4CUS A;  5IID A;  4O77 A;  5F61 A;  5A5Q A;  5LVQ A;  4O76 A;  4QC3 A;  5EV9 A;  5CUC A;  3U5O A;  4HBW A;  3O37 A;  2R10 A;  4IR4 A;  5I1Q A;  5FH8 A;  3U5M A;  2L84 A;  5CP5 A;  4ALH A;  4TZ8 A;  4WHW A;  2RS9 B;  5ETD A;  2DWW A;  5KTW A;  2WP2 A;  2E3K A;  3P5O A;  5E74 A;  5FFW A;  2FSA A;  5BT3 A;  5E3D A;  3Q2F A;  5FB1 A;  4HXK A;  5AD3 A;  5JWM A;  4UIW A;  5D7X A;  5A85 A;  4YYD A;  4LYW A;  5CU8 A;  5ENH A;  4N4G A;  4LYI A;  4PS5 A;  4LZR A;  4UIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...