3P1FA

Crystal structure of the bromodomain of human crebbp in complex with a hydroquinazolin ligand
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
119
structure length
119
Chain Sequence
SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords CREB-binding protein
publication title Crystal structure of the bromodomain of human CREBBP in complex with a hydroquinazolin ligand
rcsb
source organism Homo sapiens
total genus 38
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3p1fA00
3UVYA 4YATA 5LVRA 5FH6A 5L99A 4CUUA 4O71A 1EQFA 5JWMA 3HMFA 4Z6IA 3U5PA 3P1EA 4LRGA 4BW2A 3DWYA 4ALGA 4LR6A 5EWVA 5HRVA 5A82A 2DVVA 5CZGA 3UVWA 4F3IA 2G4AA 4Z1QA 5A81A 4Z6HA 5DFBA 3P1FA 4HBWA 5BT4A 4HXPA 4Z93A 5IIDA 2RS9B 4UIXA 5IGLA 4A9KA 4O74A 4NUCA 5ENCA 4QR3A 5D3SA 5CQ8A 2MJVB 3MULA 5FB0A 5ETDA 5H85A 4NRBA 4ZQLA 5EV9A 3ZYUA 5I7XA 5E9VA 2NXBA 2I7KA 4NR6A 3SVGA 3O37A 2R0VA 2R10A 4CFKA 5E3GA 4O75A 5I88A 5D3PA 3ONIA 4XYAA 5EWHA 5EWWA 4YK0A 5AD2A 5F2PA 2YYNA 4QZSA 5CQAA 4QC1A 5FB1A 4YY4A 3Q2EA 4XUBA 3HMHA 5G4SA 4PKLA 5DYUA 5CQTA 4Y03A 4HXRA 5D0CA 2DVQA 4TT4A 2DWWA 4CUSA 5HCLA 5DFDA 5ACYA 5C4QA 2OO1A 4YYHA 4N4FA 5DFCA 3P5OA 4X2IA 5FE6A 4LZSA 4TTEA 5K29A 5D7XA 5LKXA 4YAXA 4QEVA 4NR7A 4NYXA 5E9IA 5FE9A 5DKHA 4O76A 4O7AA 5A5QA 5I83A 3MB4A 4O70A 4NQNA 5CFWA 3IU5A 4GPJA 5FE2A 5FE5A 4NR4A 2YEKA 5KO4A 4UIVA 4TT2A 5CQ5A 2LSPB 5EPSA 2RI7A 5F25A 5C89A 3NXBA 5E9YA 5KTUA 5A5PA 4KV1A 4WIVA 4A9NA 5LKZA 5F63A 3QZTA 4FLPA 5DW1A 5F60A 5JI8A 5EM3A 5II1A 4NR9A 4YC9A 5F61A 4DONA 5H1TA 5DLXA 5EA1A 4CUPA 5FE0A 3G0JA 5IBNA 4HXMA 5LUUA 5DLZA 3Q2FA 4MENA 4Z1SA 5D3LA 2OSSA 4QSQA 4UIUA 1JM4B 5F3AA 4ZC9A 4LZRA 4IOOA 4BW4A 4IR3A 4UYDA 4LYWA 3U5NA 4BHWA 4O7FA 4XY8A 5LJ1A 2D9EA 1N72A 5H1VA 5J0DA 5CY9A 5FBXA 4PTBA 5CPEA 5DYXA 4YADA 5FH7A 4QNSA 3TLPA 4TT6A 5D25A 4N4HA 4ZW1A 4BW3A 5I1QA 4A9HA 5A5NA 5FE1A 5HM0A 5LVQA 5CRZA 5FDZA 5I7YA 4XY9A 3SVFA 5EWDA 4IOQA 4UYFA 4QSXA 4IR6A 2OUOA 5CUDA 5A5RA 5D26A 4NRAA 5CQ6A 5AMFA 5IGNA 3MB3A 4TYLA 5D3JA 4IR4A 4UYHA 4PS5A 5D3NA 4XUAA 5ENGA 4QEUA 5IG6A 2DKWA 3IU6A 4QSRA 5F5ZA 5E3DA 4UYEA 2YEMA 5CTLA 5IGKA 4HBXA 5CGPA 2RNYA 4KCXA 5CP5A 5EVAA 4CURA 5EICA 5HEMA 4QSWA 4C66A 1JSPB 4IR5A 5EK9A 4NYWA 4MEQA 3UV5A 2L84A 4O7EA 4HBVA 4YY6A 4QY4A 4UITA 4QSSA 4QSPA 4WHUA 5EPBA 5I80A 5EISA 2YDWA 5DYCA 1WUMA 5ENJA 3D7CA 4QEWA 5CQ3A 4CL9A 3O34A 4QYDA 5CQ7A 5CRMA 2DVRA 4YBSA 2D82A 5L8UA 4Q0OA 4YH3A 5F62A 4TU4A 3HMEA 5D3TA 5LJ2A 3P1CA 4QR4A 5FE7A 4NQMA 3U5JA 5HLSA 4OGIA 5FE3A 5E7DA 4NXJA 4HXKA 4QSVA 3JVMA 5HFRA 3U5MA 2E7OA 4O7BA 5CUGA 4YYNA 4MR4A 5KU3A 4J0SA 5II2A 5I86A 4YH4A 5CUEA 4A9IA 4QYLA 2WP1A 5D24A 1E6IA 2L85A 3I3JA 4UYGA 4LYIA 5AMEA 4NRCA 4A9JA 5HQ5A 4ALHA 4UIYA 1F68A 5ENBA 5C8GA 5A5SA 3DAIA 2I8NA 1WUGA 3LQIA 5DW2A 5FG4A 3K2JA 5CUBA 4J1PA 3MUKA 5HRXA 5F36A 4TZ8A 2KTBB 2YW5A 5HJCA 5ENIA 4CUQA 5LKTA 5FG5A 5DBMA 4A9MA 4CFLA 5EQ1A 3UV4A 3G0LA 5C85A 5FFWA 3O35A 4O78A 4YABA 5DX4A 2FSAA 5HFQA 5LJ0A 3UVXA 5D3HA 5D3RA 4QSTA 5L8TA 4UIWA 5CUCA 3AADA 4RVRA 5FH8A 4TS8A 4CLBA 4HXOA 2WP2A 3UVDA 3AQAA 4LZ2A 5E9LA 4TQNA 5DKCA 4MEPA 1X0JA 2YELA 5H1UA 2L5EA 3LQHA 4C67A 2F6NA 4NS5A 5DKDA 4MEOA 5AD3A 3LXJA 4BJXA 4QUUA 5F1HA 3UW9A 3RCWA 4AKNA 5E0RA 4N4IA 4PCEA 4LDFA 4MR5A 4QSUA 4UIZA 4LYSA 5E73A 2RO1A 2GRCA 5A5OA 5FG6A 5TCMA 4PCIA 4YYKA 3S91A 4O7CA 4E96A 4BW1A 5HELA 5EI4A 5L97A 4YBTA 5ENEA 4A9FA 4N4GA 3JVJA 4HXSA 3LJWA 3SVHA 4PY6A 5EP7A 4HBYA 4KV4A 3JVKA 5E74A 5L98A 5HQ6A 5FFYA 5A85A 5A7CA 4A9LA 4LC2A 3U5LA 3O33A 5HRWA 3GG3A 2RFJA 4YYGA 4YYDA 5E9KA 4NUDA 5L96A 5EPRA 5C7NA 4NYVA 3P1DA 5EWCA 2E3KA 2R0SA 4TZ2A 5EU1A 4MR6A 5F1LA 3QZSA 4MR3A 3FKMX 4O77A 3QZVA 5ETBA 4CUTA 5A83A 5TB6A 2F6JA 5FFVA 5CS8A 5HQ7A 2N9GA 5C87A 5FE4A 5HENA 5CQ4A 5G4RA 4QB3A 1ZS5A 4HXLA 4J0RA 5DY7A 5DYAA 5E9MA 5IGMA 4A9EA 4QUTA 4QR5A 3UV2A 4HXNA 4N3WA 3JVLA 3MXFA 4O72A 5KTWA 2YQDA 5COIA 5I29A 4Q0NA 5ENFA 5CU8A 4IORA 4YBMA 5I40A 3O36A 3MQMA 4OUFA 2RNXA 4QBMA 4NR5A 5ENHA 5I89A 5BT5A 5KHMA 5FE8A 5KTXA 2H60A 4YYIA 3U5KA 2DATA 4NR8A 3S92A 4UYFB 2RNWA 3LQJA 4TU6A 5EGUA 2DVSA 2R0YA 5BT3A 3U5OA 4NUEA 4J3IA 4QC3A 5LKUA 4OGJA 4A9OA 2E7NA 4YYJA 5CUAA 4YYMA 4WHWA
chains in the Genus database with same CATH superfamily
3UVYA 4YATA 5LVRA 5FH6A 5L99A 4CUUA 4O71A 1EQFA 5JWMA 3HMFA 4Z6IA 1PUOA 3U5PA 3P1EA 4LRGA 4BW2A 3DWYA 4ALGA 4LR6A 5EWVA 5HRVA 5A82A 2DVVA 5CZGA 3UVWA 4F3IA 2G4AA 4Z1QA 5A81A 4Z6HA 5DFBA 3P1FA 4HBWA 2EJNA 3VKHA 5BT4A 4HXPA 4Z93A 5IIDA 2RS9B 4UIXA 5IGLA 4A9KA 4O74A 4NUCA 5ENCA 4QR3A 5D3SA 5CQ8A 2MJVB 3MULA 5FB0A 5ETDA 5H85A 4NRBA 4ZQLA 5EV9A 3ZYUA 5I7XA 5E9VA 2NXBA 2I7KA 4NR6A 3SVGA 3O37A 2R0VA 2R10A 4CFKA 5E3GA 4O75A 5I88A 5D3PA 3ONIA 4XYAA 5EWHA 5EWWA 4YK0A 5AD2A 5F2PA 2YYNA 4QZSA 5CQAA 4QC1A 5FB1A 4YY4A 3Q2EA 4XUBA 3HMHA 5G4SA 4PKLA 5DYUA 5CQTA 4Y03A 4HXRA 5D0CA 2DVQA 4TT4A 2DWWA 4CUSA 5HCLA 5DFDA 5ACYA 5C4QA 2OO1A 4YYHA 4N4FA 5DFCA 3P5OA 4X2IA 5FE6A 4LZSA 4TTEA 5K29A 5D7XA 5LKXA 4YAXA 4QEVA 4NR7A 4NYXA 5E9IA 5FE9A 5DKHA 4O76A 4O7AA 5A5QA 5I83A 3MB4A 4O70A 4NQNA 5CFWA 3IU5A 4GPJA 5FE2A 5FE5A 4NR4A 2YEKA 5KO4A 4UIVA 4TT2A 5CQ5A 2LSPB 5EPSA 2RI7A 5F25A 5C89A 3NXBA 5E9YA 5KTUA 5A5PA 4KV1A 1ZKRA 4WIVA 4A9NA 5LKZA 5F63A 3QZTA 4FLPA 5DW1A 5F60A 5JI8A 4AKIA 5EM3A 5II1A 4NR9A 4YC9A 5F61A 4DONA 5H1TA 5DLXA 5EA1A 4CUPA 5FE0A 3G0JA 5IBNA 4HXMA 5LUUA 5DLZA 3Q2FA 4MENA 4Z1SA 5D3LA 2OSSA 4QSQA 4UIUA 1JM4B 5F3AA 4ZC9A 4LZRA 4IOOA 4BW4A 4IR3A 4UYDA 4LYWA 3U5NA 4BHWA 4O7FA 4XY8A 5LJ1A 2D9EA 1N72A 5H1VA 5J0DA 5CY9A 5FBXA 4PTBA 5CPEA 5DYXA 4YADA 5FH7A 4QNSA 3TLPA 4TT6A 5D25A 4N4HA 4ZW1A 4BW3A 5I1QA 4A9HA 5A5NA 5FE1A 5HM0A 5LVQA 5CRZA 3VKGA 5FDZA 5I7YA 4XY9A 3SVFA 5EWDA 4IOQA 4UYFA 4QSXA 4IR6A 2OUOA 5CUDA 5A5RA 5D26A 4NRAA 5CQ6A 5AMFA 5IGNA 3MB3A 4TYLA 5D3JA 4IR4A 4UYHA 4PS5A 5D3NA 4XUAA 5ENGA 4QEUA 5IG6A 2DKWA 3IU6A 4QSRA 5F5ZA 5E3DA 4UYEA 2YEMA 5CTLA 5IGKA 4HBXA 5CGPA 2RNYA 4KCXA 5CP5A 5EVAA 4CURA 5EICA 5HEMA 4QSWA 4C66A 1JSPB 4IR5A 5EK9A 4NYWA 3D1DA 4MEQA 3UV5A 2L84A 4O7EA 4HBVA 4YY6A 4QY4A 4UITA 4QSSA 3ERRA 4QSPA 4WHUA 5EPBA 5I80A 5EISA 2YDWA 5DYCA 1WUMA 5ENJA 3D7CA 4QEWA 5CQ3A 4CL9A 3O34A 4QYDA 5CQ7A 5CRMA 2DVRA 4YBSA 2D82A 5L8UA 4Q0OA 4YH3A 5F62A 4TU4A 3HMEA 5D3TA 5LJ2A 3P1CA 4QR4A 5FE7A 4NQMA 3U5JA 5HLSA 4OGIA 5FE3A 5E7DA 4NXJA 4HXKA 4QSVA 3JVMA 5HFRA 3U5MA 2E7OA 4O7BA 5CUGA 4YYNA 4MR4A 5KU3A 4J0SA 5II2A 5I86A 4YH4A 4AI6A 5CUEA 4A9IA 4QYLA 2WP1A 5D24A 1E6IA 2L85A 3I3JA 4UYGA 4LYIA 5AMEA 4NRCA 4A9JA 5HQ5A 4ALHA 4UIYA 1F68A 5ENBA 5C8GA 5A5SA 3DAIA 2I8NA 1WUGA 3LQIA 5DW2A 5FG4A 3K2JA 5CUBA 4J1PA 3MUKA 5HRXA 5F36A 4TZ8A 2KTBB 2YW5A 5HJCA 5ENIA 4CUQA 5LKTA 5FG5A 5DBMA 4A9MA 4CFLA 5EQ1A 3UV4A 3G0LA 5C85A 5FFWA 3O35A 4O78A 4YABA 5DX4A 2FSAA 5HFQA 5LJ0A 3UVXA 5D3HA 5D3RA 4QSTA 5L8TA 4UIWA 5CUCA 3AADA 4RVRA 5FH8A 4TS8A 4CLBA 4HXOA 2WP2A 3UVDA 3AQAA 4LZ2A 5E9LA 4TQNA 5DKCA 4MEPA 4AKGA 1X0JA 2YELA 5H1UA 2L5EA 3LQHA 4C67A 2F6NA 4NS5A 5DKDA 4MEOA 5AD3A 3LXJA 4BJXA 4QUUA 5F1HA 3UW9A 3RCWA 4AKNA 5E0RA 4N4IA 4PCEA 4LDFA 4MR5A 4QSUA 4UIZA 4LYSA 5E73A 2RO1A 2GRCA 5A5OA 5FG6A 5TCMA 4PCIA 4YYKA 3S91A 4O7CA 4E96A 4BW1A 5HELA 5EI4A 5L97A 4YBTA 5ENEA 4A9FA 4N4GA 3JVJA 4HXSA 3LJWA 3SVHA 4PY6A 5EP7A 4HBYA 4KV4A 3JVKA 5E74A 5L98A 5HQ6A 5FFYA 5A85A 5A7CA 4A9LA 4LC2A 3U5LA 3O33A 5HRWA 3GG3A 2RFJA 4YYGA 4YYDA 5E9KA 4NUDA 5L96A 5EPRA 5C7NA 4NYVA 3P1DA 5EWCA 2E3KA 2R0SA 4TZ2A 5EU1A 4MR6A 5F1LA 3QZSA 4MR3A 3FKMX 4O77A 3QZVA 5ETBA 4CUTA 5A83A 5TB6A 2F6JA 5FFVA 5CS8A 5HQ7A 3D1BA 2N9GA 5C87A 5FE4A 5HENA 5CQ4A 5G4RA 4QB3A 4AKHA 1ZS5A 4HXLA 4J0RA 5DY7A 5DYAA 5E9MA 5IGMA 4A9EA 4QUTA 4QR5A 3UV2A 4HXNA 4N3WA 3JVLA 3MXFA 4O72A 5KTWA 2YQDA 5COIA 5I29A 4Q0NA 5ENFA 5CU8A 4IORA 4YBMA 5I40A 3O36A 3MQMA 4OUFA 2RNXA 4QBMA 4NR5A 5ENHA 5I89A 5BT5A 5KHMA 5FE8A 5KTXA 2H60A 4YYIA 3U5KA 2DATA 4NR8A 3S92A 4UYFB 2RNWA 3LQJA 4TU6A 5EGUA 2DVSA 2R0YA 5BT3A 3U5OA 4NUEA 4J3IA 4QC3A 5LKUA 4OGJA 4A9OA 2E7NA 4YYJA 5CUAA 4YYMA 4WHWA
chains in the Genus database with same CATH topology
3UVYA 4YATA 5LVRA 5FH6A 5L99A 4CUUA 4O71A 1EQFA 5JWMA 3HMFA 4Z6IA 3U5PA 3P1EA 4LRGA 4BW2A 3DWYA 4ALGA 4LR6A 5EWVA 5HRVA 5A82A 2DVVA 5CZGA 3UVWA 4F3IA 2G4AA 4Z1QA 5A81A 4Z6HA 5DFBA 3P1FA 4HBWA 5BT4A 4HXPA 4Z93A 5IIDA 2RS9B 4UIXA 5IGLA 4A9KA 4O74A 4NUCA 5ENCA 4QR3A 5D3SA 5CQ8A 2MJVB 3MULA 5FB0A 5ETDA 5H85A 4NRBA 4ZQLA 5EV9A 3ZYUA 5I7XA 5E9VA 2NXBA 2I7KA 4NR6A 3SVGA 3O37A 2R0VA 2R10A 4CFKA 5E3GA 4O75A 5I88A 5D3PA 3ONIA 4XYAA 5EWHA 5EWWA 4YK0A 5AD2A 5F2PA 2YYNA 4QZSA 5CQAA 4QC1A 5FB1A 4YY4A 3Q2EA 4XUBA 3HMHA 5G4SA 4PKLA 5DYUA 5CQTA 4Y03A 4HXRA 5D0CA 2DVQA 4TT4A 2DWWA 4CUSA 5HCLA 5DFDA 5ACYA 5C4QA 2OO1A 4YYHA 4N4FA 5DFCA 3P5OA 4X2IA 5FE6A 4LZSA 4TTEA 5K29A 5D7XA 5LKXA 4YAXA 4QEVA 4NR7A 4NYXA 5E9IA 5FE9A 5DKHA 4O76A 4O7AA 5A5QA 5I83A 3MB4A 4O70A 4NQNA 5CFWA 3IU5A 4GPJA 5FE2A 5FE5A 4NR4A 2YEKA 5KO4A 4UIVA 4TT2A 5CQ5A 2LSPB 5EPSA 2RI7A 5F25A 5C89A 3NXBA 5E9YA 5KTUA 5A5PA 4KV1A 4WIVA 4A9NA 5LKZA 5F63A 3QZTA 4FLPA 5DW1A 5F60A 5JI8A 5EM3A 5II1A 4NR9A 4YC9A 5F61A 4DONA 5H1TA 5DLXA 5EA1A 4CUPA 5FE0A 3G0JA 5IBNA 4HXMA 5LUUA 5DLZA 3Q2FA 4MENA 4Z1SA 5D3LA 2OSSA 4QSQA 4UIUA 1JM4B 5F3AA 4ZC9A 4LZRA 4IOOA 4BW4A 4IR3A 4UYDA 4LYWA 3U5NA 4BHWA 4O7FA 4XY8A 5LJ1A 2D9EA 1N72A 5H1VA 5J0DA 5CY9A 5FBXA 4PTBA 5CPEA 5DYXA 4YADA 5FH7A 4QNSA 3TLPA 4TT6A 5D25A 4N4HA 4ZW1A 4BW3A 5I1QA 4A9HA 5A5NA 5FE1A 5HM0A 5LVQA 5CRZA 5FDZA 5I7YA 4XY9A 3SVFA 5EWDA 4IOQA 4UYFA 4QSXA 4IR6A 2OUOA 5CUDA 5A5RA 5D26A 4NRAA 5CQ6A 5AMFA 5IGNA 3MB3A 4TYLA 5D3JA 4IR4A 4UYHA 4PS5A 5D3NA 4XUAA 5ENGA 4QEUA 5IG6A 2DKWA 3IU6A 4QSRA 5F5ZA 5E3DA 4UYEA 2YEMA 5CTLA 5IGKA 4HBXA 5CGPA 2RNYA 4KCXA 5CP5A 5EVAA 4CURA 5EICA 5HEMA 4QSWA 4C66A 1JSPB 4IR5A 5EK9A 4NYWA 4MEQA 3UV5A 2L84A 4O7EA 4HBVA 4YY6A 4QY4A 4UITA 4QSSA 4QSPA 4WHUA 5EPBA 5I80A 5EISA 2YDWA 5DYCA 1WUMA 5ENJA 3D7CA 4QEWA 5CQ3A 4CL9A 3O34A 4QYDA 5CQ7A 5CRMA 2DVRA 4YBSA 2D82A 5L8UA 4Q0OA 4YH3A 5F62A 4TU4A 3HMEA 5D3TA 5LJ2A 3P1CA 4QR4A 5FE7A 4NQMA 3U5JA 5HLSA 4OGIA 5FE3A 5E7DA 4NXJA 4HXKA 4QSVA 3JVMA 5HFRA 3U5MA 2E7OA 4O7BA 5CUGA 4YYNA 4MR4A 5KU3A 4J0SA 5II2A 5I86A 4YH4A 5CUEA 4A9IA 4QYLA 2WP1A 5D24A 1E6IA 2L85A 3I3JA 4UYGA 4LYIA 5AMEA 4NRCA 4A9JA 5HQ5A 4ALHA 4UIYA 1F68A 5ENBA 5C8GA 5A5SA 3DAIA 2I8NA 1WUGA 3LQIA 5DW2A 5FG4A 3K2JA 5CUBA 4J1PA 3MUKA 5HRXA 5F36A 4TZ8A 2KTBB 2YW5A 5HJCA 5ENIA 4CUQA 5LKTA 5FG5A 5DBMA 4A9MA 4CFLA 5EQ1A 3UV4A 3G0LA 5C85A 5FFWA 3O35A 4O78A 4YABA 5DX4A 2FSAA 5HFQA 5LJ0A 3UVXA 5D3HA 5D3RA 4QSTA 5L8TA 4UIWA 5CUCA 3AADA 4RVRA 5FH8A 4TS8A 4CLBA 4HXOA 2WP2A 3UVDA 3AQAA 4LZ2A 5E9LA 4TQNA 5DKCA 4MEPA 1X0JA 2YELA 5H1UA 2L5EA 3LQHA 4C67A 2F6NA 4NS5A 5DKDA 4MEOA 5AD3A 3LXJA 4BJXA 4QUUA 5F1HA 3UW9A 3RCWA 4AKNA 5E0RA 4N4IA 4PCEA 4LDFA 4MR5A 4QSUA 4UIZA 4LYSA 5E73A 2RO1A 2GRCA 5A5OA 5FG6A 5TCMA 4PCIA 4YYKA 3S91A 4O7CA 4E96A 4BW1A 5HELA 5EI4A 5L97A 4YBTA 5ENEA 4A9FA 4N4GA 3JVJA 4HXSA 3LJWA 3SVHA 4PY6A 5EP7A 4HBYA 4KV4A 3JVKA 5E74A 5L98A 5HQ6A 5FFYA 5A85A 5A7CA 4A9LA 4LC2A 3U5LA 3O33A 5HRWA 3GG3A 2RFJA 4YYGA 4YYDA 5E9KA 4NUDA 5L96A 5EPRA 5C7NA 4NYVA 3P1DA 5EWCA 2E3KA 2R0SA 4TZ2A 5EU1A 4MR6A 5F1LA 3QZSA 4MR3A 3FKMX 4O77A 3QZVA 5ETBA 4CUTA 5A83A 5TB6A 2F6JA 5FFVA 5CS8A 5HQ7A 2N9GA 5C87A 5FE4A 5HENA 5CQ4A 5G4RA 4QB3A 1ZS5A 4HXLA 4J0RA 5DY7A 5DYAA 5E9MA 5IGMA 4A9EA 4QUTA 4QR5A 3UV2A 4HXNA 4N3WA 3JVLA 3MXFA 4O72A 5KTWA 2YQDA 5COIA 5I29A 4Q0NA 5ENFA 5CU8A 4IORA 4YBMA 5I40A 3O36A 3MQMA 4OUFA 2RNXA 4QBMA 4NR5A 5ENHA 5I89A 5BT5A 5KHMA 5FE8A 5KTXA 2H60A 4YYIA 3U5KA 2DATA 4NR8A 3S92A 4UYFB 2RNWA 3LQJA 4TU6A 5EGUA 2DVSA 2R0YA 5BT3A 3U5OA 4NUEA 4J3IA 4QC3A 5LKUA 4OGJA 4A9OA 2E7NA 4YYJA 5CUAA 4YYMA 4WHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UVY A;  4YAT A;  5LVR A;  5FH6 A;  5L99 A;  4CUU A;  4O71 A;  1EQF A;  5JWM A;  3HMF A;  4Z6I A;  3U5P A;  3P1E A;  4LRG A;  4BW2 A;  3DWY A;  4ALG A;  4LR6 A;  5EWV A;  5HRV A;  5A82 A;  2DVV A;  5CZG A;  3UVW A;  4F3I A;  2G4A A;  4Z1Q A;  5A81 A;  4Z6H A;  5DFB A;  3P1F A;  4HBW A;  5BT4 A;  4HXP A;  4Z93 A;  5IID A;  2RS9 B;  4UIX A;  5IGL A;  4A9K A;  4O74 A;  4NUC A;  5ENC A;  4QR3 A;  5D3S A;  5CQ8 A;  2MJV B;  3MUL A;  5FB0 A;  5ETD A;  5H85 A;  4NRB A;  4ZQL A;  5EV9 A;  3ZYU A;  5I7X A;  5E9V A;  2NXB A;  2I7K A;  4NR6 A;  3SVG A;  3O37 A;  2R0V A;  2R10 A;  4CFK A;  5E3G A;  4O75 A;  5I88 A;  5D3P A;  3ONI A;  4XYA A;  5EWH A;  5EWW A;  4YK0 A;  5AD2 A;  5F2P A;  2YYN A;  4QZS A;  5CQA A;  4QC1 A;  5FB1 A;  4YY4 A;  3Q2E A;  4XUB A;  3HMH A;  5G4S A;  4PKL A;  5DYU A;  5CQT A;  4Y03 A;  4HXR A;  5D0C A;  2DVQ A;  4TT4 A;  2DWW A;  4CUS A;  5HCL A;  5DFD A;  5ACY A;  5C4Q A;  2OO1 A;  4YYH A;  4N4F A;  5DFC A;  3P5O A;  4X2I A;  5FE6 A;  4LZS A;  4TTE A;  5K29 A;  5D7X A;  5LKX A;  4YAX A;  4QEV A;  4NR7 A;  4NYX A;  5E9I A;  5FE9 A;  5DKH A;  4O76 A;  4O7A A;  5A5Q A;  5I83 A;  3MB4 A;  4O70 A;  4NQN A;  5CFW A;  3IU5 A;  4GPJ A;  5FE2 A;  5FE5 A;  4NR4 A;  2YEK A;  5KO4 A;  4UIV A;  4TT2 A;  5CQ5 A;  2LSP B;  5EPS A;  2RI7 A;  5F25 A;  5C89 A;  3NXB A;  5E9Y A;  5KTU A;  5A5P A;  4KV1 A;  4WIV A;  4A9N A;  5LKZ A;  5F63 A;  3QZT A;  4FLP A;  5DW1 A;  5F60 A;  5JI8 A;  5EM3 A;  5II1 A;  4NR9 A;  4YC9 A;  5F61 A;  4DON A;  5H1T A;  5DLX A;  5EA1 A;  4CUP A;  5FE0 A;  3G0J A;  5IBN A;  4HXM A;  5LUU A;  5DLZ A;  3Q2F A;  4MEN A;  4Z1S A;  5D3L A;  2OSS A;  4QSQ A;  4UIU A;  1JM4 B;  5F3A A;  4ZC9 A;  4LZR A;  4IOO A;  4BW4 A;  4IR3 A;  4UYD A;  4LYW A;  3U5N A;  4BHW A;  4O7F A;  4XY8 A;  5LJ1 A;  2D9E A;  1N72 A;  5H1V A;  5J0D A;  5CY9 A;  5FBX A;  4PTB A;  5CPE A;  5DYX A;  4YAD A;  5FH7 A;  4QNS A;  3TLP A;  4TT6 A;  5D25 A;  4N4H A;  4ZW1 A;  4BW3 A;  5I1Q A;  4A9H A;  5A5N A;  5FE1 A;  5HM0 A;  5LVQ A;  5CRZ A;  5FDZ A;  5I7Y A;  4XY9 A;  3SVF A;  5EWD A;  4IOQ A;  4UYF A;  4QSX A;  4IR6 A;  2OUO A;  5CUD A;  5A5R A;  5D26 A;  4NRA A;  5CQ6 A;  5AMF A;  5IGN A;  3MB3 A;  4TYL A;  5D3J A;  4IR4 A;  4UYH A;  4PS5 A;  5D3N A;  4XUA A;  5ENG A;  4QEU A;  5IG6 A;  2DKW A;  3IU6 A;  4QSR A;  5F5Z A;  5E3D A;  4UYE A;  2YEM A;  5CTL A;  5IGK A;  4HBX A;  5CGP A;  2RNY A;  4KCX A;  5CP5 A;  5EVA A;  4CUR A;  5EIC A;  5HEM A;  4QSW A;  4C66 A;  1JSP B;  4IR5 A;  5EK9 A;  4NYW A;  4MEQ A;  3UV5 A;  2L84 A;  4O7E A;  4HBV A;  4YY6 A;  4QY4 A;  4UIT A;  4QSS A;  4QSP A;  4WHU A;  5EPB A;  5I80 A;  5EIS A;  2YDW A;  5DYC A;  1WUM A;  5ENJ A;  3D7C A;  4QEW A;  5CQ3 A;  4CL9 A;  3O34 A;  4QYD A;  5CQ7 A;  5CRM A;  2DVR A;  4YBS A;  2D82 A;  5L8U A;  4Q0O A;  4YH3 A;  5F62 A;  4TU4 A;  3HME A;  5D3T A;  5LJ2 A;  3P1C A;  4QR4 A;  5FE7 A;  4NQM A;  3U5J A;  5HLS A;  4OGI A;  5FE3 A;  5E7D A;  4NXJ A;  4HXK A;  4QSV A;  3JVM A;  5HFR A;  3U5M A;  2E7O A;  4O7B A;  5CUG A;  4YYN A;  4MR4 A;  5KU3 A;  4J0S A;  5II2 A;  5I86 A;  4YH4 A;  5CUE A;  4A9I A;  4QYL A;  2WP1 A;  5D24 A;  1E6I A;  2L85 A;  3I3J A;  4UYG A;  4LYI A;  5AME A;  4NRC A;  4A9J A;  5HQ5 A;  4ALH A;  4UIY A;  1F68 A;  5ENB A;  5C8G A;  5A5S A;  3DAI A;  2I8N A;  1WUG A;  3LQI A;  5DW2 A;  5FG4 A;  3K2J A;  5CUB A;  4J1P A;  3MUK A;  5HRX A;  5F36 A;  4TZ8 A;  2KTB B;  2YW5 A;  5HJC A;  5ENI A;  4CUQ A;  5LKT A;  5FG5 A;  5DBM A;  4A9M A;  4CFL A;  5EQ1 A;  3UV4 A;  3G0L A;  5C85 A;  5FFW A;  3O35 A;  4O78 A;  4YAB A;  5DX4 A;  2FSA A;  5HFQ A;  5LJ0 A;  3UVX A;  5D3H A;  5D3R A;  4QST A;  5L8T A;  4UIW A;  5CUC A;  3AAD A;  4RVR A;  5FH8 A;  4TS8 A;  4CLB A;  4HXO A;  2WP2 A;  3UVD A;  3AQA A;  4LZ2 A;  5E9L A;  4TQN A;  5DKC A;  4MEP A;  1X0J A;  2YEL A;  5H1U A;  2L5E A;  3LQH A;  4C67 A;  2F6N A;  4NS5 A;  5DKD A;  4MEO A;  5AD3 A;  3LXJ A;  4BJX A;  4QUU A;  5F1H A;  3UW9 A;  3RCW A;  4AKN A;  5E0R A;  4N4I A;  4PCE A;  4LDF A;  4MR5 A;  4QSU A;  4UIZ A;  4LYS A;  5E73 A;  2RO1 A;  2GRC A;  5A5O A;  5FG6 A;  5TCM A;  4PCI A;  4YYK A;  3S91 A;  4O7C A;  4E96 A;  4BW1 A;  5HEL A;  5EI4 A;  5L97 A;  4YBT A;  5ENE A;  4A9F A;  4N4G A;  3JVJ A;  4HXS A;  3LJW A;  3SVH A;  4PY6 A;  5EP7 A;  4HBY A;  4KV4 A;  3JVK A;  5E74 A;  5L98 A;  5HQ6 A;  5FFY A;  5A85 A;  5A7C A;  4A9L A;  4LC2 A;  3U5L A;  3O33 A;  5HRW A;  3GG3 A;  2RFJ A;  4YYG A;  4YYD A;  5E9K A;  4NUD A;  5L96 A;  5EPR A;  5C7N A;  4NYV A;  3P1D A;  5EWC A;  2E3K A;  2R0S A;  4TZ2 A;  5EU1 A;  4MR6 A;  5F1L A;  3QZS A;  4MR3 A;  3FKM X;  4O77 A;  3QZV A;  5ETB A;  4CUT A;  5A83 A;  5TB6 A;  2F6J A;  5FFV A;  5CS8 A;  5HQ7 A;  2N9G A;  5C87 A;  5FE4 A;  5HEN A;  5CQ4 A;  5G4R A;  4QB3 A;  1ZS5 A;  4HXL A;  4J0R A;  5DY7 A;  5DYA A;  5E9M A;  5IGM A;  4A9E A;  4QUT A;  4QR5 A;  3UV2 A;  4HXN A;  4N3W A;  3JVL A;  3MXF A;  4O72 A;  5KTW A;  2YQD A;  5COI A;  5I29 A;  4Q0N A;  5ENF A;  5CU8 A;  4IOR A;  4YBM A;  5I40 A;  3O36 A;  3MQM A;  4OUF A;  2RNX A;  4QBM A;  4NR5 A;  5ENH A;  5I89 A;  5BT5 A;  5KHM A;  5FE8 A;  5KTX A;  2H60 A;  4YYI A;  3U5K A;  2DAT A;  4NR8 A;  3S92 A;  4UYF B;  2RNW A;  3LQJ A;  4TU6 A;  5EGU A;  2DVS A;  2R0Y A;  5BT3 A;  3U5O A;  4NUE A;  4J3I A;  4QC3 A;  5LKU A;  4OGJ A;  4A9O A;  2E7N A;  4YYJ A;  5CUA A;  4YYM A;  4WHW A; 
#chains in the Genus database with same CATH topology
 3UVY A;  4YAT A;  5LVR A;  5FH6 A;  5L99 A;  4CUU A;  4O71 A;  1EQF A;  5JWM A;  3HMF A;  4Z6I A;  1PUO A;  3U5P A;  3P1E A;  4LRG A;  4BW2 A;  3DWY A;  4ALG A;  4LR6 A;  5EWV A;  5HRV A;  5A82 A;  2DVV A;  5CZG A;  3UVW A;  4F3I A;  2G4A A;  4Z1Q A;  5A81 A;  4Z6H A;  5DFB A;  3P1F A;  4HBW A;  2EJN A;  3VKH A;  5BT4 A;  4HXP A;  4Z93 A;  5IID A;  2RS9 B;  4UIX A;  5IGL A;  4A9K A;  4O74 A;  4NUC A;  5ENC A;  4QR3 A;  5D3S A;  5CQ8 A;  2MJV B;  3MUL A;  5FB0 A;  5ETD A;  5H85 A;  4NRB A;  4ZQL A;  5EV9 A;  3ZYU A;  5I7X A;  5E9V A;  2NXB A;  2I7K A;  4NR6 A;  3SVG A;  3O37 A;  2R0V A;  2R10 A;  4CFK A;  5E3G A;  4O75 A;  5I88 A;  5D3P A;  3ONI A;  4XYA A;  5EWH A;  5EWW A;  4YK0 A;  5AD2 A;  5F2P A;  2YYN A;  4QZS A;  5CQA A;  4QC1 A;  5FB1 A;  4YY4 A;  3Q2E A;  4XUB A;  3HMH A;  5G4S A;  4PKL A;  5DYU A;  5CQT A;  4Y03 A;  4HXR A;  5D0C A;  2DVQ A;  4TT4 A;  2DWW A;  4CUS A;  5HCL A;  5DFD A;  5ACY A;  5C4Q A;  2OO1 A;  4YYH A;  4N4F A;  5DFC A;  3P5O A;  4X2I A;  5FE6 A;  4LZS A;  4TTE A;  5K29 A;  5D7X A;  5LKX A;  4YAX A;  4QEV A;  4NR7 A;  4NYX A;  5E9I A;  5FE9 A;  5DKH A;  4O76 A;  4O7A A;  5A5Q A;  5I83 A;  3MB4 A;  4O70 A;  4NQN A;  5CFW A;  3IU5 A;  4GPJ A;  5FE2 A;  5FE5 A;  4NR4 A;  2YEK A;  5KO4 A;  4UIV A;  4TT2 A;  5CQ5 A;  2LSP B;  5EPS A;  2RI7 A;  5F25 A;  5C89 A;  3NXB A;  5E9Y A;  5KTU A;  5A5P A;  4KV1 A;  1ZKR A;  4WIV A;  4A9N A;  5LKZ A;  5F63 A;  3QZT A;  4FLP A;  5DW1 A;  5F60 A;  5JI8 A;  4AKI A;  5EM3 A;  5II1 A;  4NR9 A;  4YC9 A;  5F61 A;  4DON A;  5H1T A;  5DLX A;  5EA1 A;  4CUP A;  5FE0 A;  3G0J A;  5IBN A;  4HXM A;  5LUU A;  5DLZ A;  3Q2F A;  4MEN A;  4Z1S A;  5D3L A;  2OSS A;  4QSQ A;  4UIU A;  1JM4 B;  5F3A A;  4ZC9 A;  4LZR A;  4IOO A;  4BW4 A;  4IR3 A;  4UYD A;  4LYW A;  3U5N A;  4BHW A;  4O7F A;  4XY8 A;  5LJ1 A;  2D9E A;  1N72 A;  5H1V A;  5J0D A;  5CY9 A;  5FBX A;  4PTB A;  5CPE A;  5DYX A;  4YAD A;  5FH7 A;  4QNS A;  3TLP A;  4TT6 A;  5D25 A;  4N4H A;  4ZW1 A;  4BW3 A;  5I1Q A;  4A9H A;  5A5N A;  5FE1 A;  5HM0 A;  5LVQ A;  5CRZ A;  3VKG A;  5FDZ A;  5I7Y A;  4XY9 A;  3SVF A;  5EWD A;  4IOQ A;  4UYF A;  4QSX A;  4IR6 A;  2OUO A;  5CUD A;  5A5R A;  5D26 A;  4NRA A;  5CQ6 A;  5AMF A;  5IGN A;  3MB3 A;  4TYL A;  5D3J A;  4IR4 A;  4UYH A;  4PS5 A;  5D3N A;  4XUA A;  5ENG A;  4QEU A;  5IG6 A;  2DKW A;  3IU6 A;  4QSR A;  5F5Z A;  5E3D A;  4UYE A;  2YEM A;  5CTL A;  5IGK A;  4HBX A;  5CGP A;  2RNY A;  4KCX A;  5CP5 A;  5EVA A;  4CUR A;  5EIC A;  5HEM A;  4QSW A;  4C66 A;  1JSP B;  4IR5 A;  5EK9 A;  4NYW A;  3D1D A;  4MEQ A;  3UV5 A;  2L84 A;  4O7E A;  4HBV A;  4YY6 A;  4QY4 A;  4UIT A;  4QSS A;  3ERR A;  4QSP A;  4WHU A;  5EPB A;  5I80 A;  5EIS A;  2YDW A;  5DYC A;  1WUM A;  5ENJ A;  3D7C A;  4QEW A;  5CQ3 A;  4CL9 A;  3O34 A;  4QYD A;  5CQ7 A;  5CRM A;  2DVR A;  4YBS A;  2D82 A;  5L8U A;  4Q0O A;  4YH3 A;  5F62 A;  4TU4 A;  3HME A;  5D3T A;  5LJ2 A;  3P1C A;  4QR4 A;  5FE7 A;  4NQM A;  3U5J A;  5HLS A;  4OGI A;  5FE3 A;  5E7D A;  4NXJ A;  4HXK A;  4QSV A;  3JVM A;  5HFR A;  3U5M A;  2E7O A;  4O7B A;  5CUG A;  4YYN A;  4MR4 A;  5KU3 A;  4J0S A;  5II2 A;  5I86 A;  4YH4 A;  4AI6 A;  5CUE A;  4A9I A;  4QYL A;  2WP1 A;  5D24 A;  1E6I A;  2L85 A;  3I3J A;  4UYG A;  4LYI A;  5AME A;  4NRC A;  4A9J A;  5HQ5 A;  4ALH A;  4UIY A;  1F68 A;  5ENB A;  5C8G A;  5A5S A;  3DAI A;  2I8N A;  1WUG A;  3LQI A;  5DW2 A;  5FG4 A;  3K2J A;  5CUB A;  4J1P A;  3MUK A;  5HRX A;  5F36 A;  4TZ8 A;  2KTB B;  2YW5 A;  5HJC A;  5ENI A;  4CUQ A;  5LKT A;  5FG5 A;  5DBM A;  4A9M A;  4CFL A;  5EQ1 A;  3UV4 A;  3G0L A;  5C85 A;  5FFW A;  3O35 A;  4O78 A;  4YAB A;  5DX4 A;  2FSA A;  5HFQ A;  5LJ0 A;  3UVX A;  5D3H A;  5D3R A;  4QST A;  5L8T A;  4UIW A;  5CUC A;  3AAD A;  4RVR A;  5FH8 A;  4TS8 A;  4CLB A;  4HXO A;  2WP2 A;  3UVD A;  3AQA A;  4LZ2 A;  5E9L A;  4TQN A;  5DKC A;  4MEP A;  4AKG A;  1X0J A;  2YEL A;  5H1U A;  2L5E A;  3LQH A;  4C67 A;  2F6N A;  4NS5 A;  5DKD A;  4MEO A;  5AD3 A;  3LXJ A;  4BJX A;  4QUU A;  5F1H A;  3UW9 A;  3RCW A;  4AKN A;  5E0R A;  4N4I A;  4PCE A;  4LDF A;  4MR5 A;  4QSU A;  4UIZ A;  4LYS A;  5E73 A;  2RO1 A;  2GRC A;  5A5O A;  5FG6 A;  5TCM A;  4PCI A;  4YYK A;  3S91 A;  4O7C A;  4E96 A;  4BW1 A;  5HEL A;  5EI4 A;  5L97 A;  4YBT A;  5ENE A;  4A9F A;  4N4G A;  3JVJ A;  4HXS A;  3LJW A;  3SVH A;  4PY6 A;  5EP7 A;  4HBY A;  4KV4 A;  3JVK A;  5E74 A;  5L98 A;  5HQ6 A;  5FFY A;  5A85 A;  5A7C A;  4A9L A;  4LC2 A;  3U5L A;  3O33 A;  5HRW A;  3GG3 A;  2RFJ A;  4YYG A;  4YYD A;  5E9K A;  4NUD A;  5L96 A;  5EPR A;  5C7N A;  4NYV A;  3P1D A;  5EWC A;  2E3K A;  2R0S A;  4TZ2 A;  5EU1 A;  4MR6 A;  5F1L A;  3QZS A;  4MR3 A;  3FKM X;  4O77 A;  3QZV A;  5ETB A;  4CUT A;  5A83 A;  5TB6 A;  2F6J A;  5FFV A;  5CS8 A;  5HQ7 A;  3D1B A;  2N9G A;  5C87 A;  5FE4 A;  5HEN A;  5CQ4 A;  5G4R A;  4QB3 A;  4AKH A;  1ZS5 A;  4HXL A;  4J0R A;  5DY7 A;  5DYA A;  5E9M A;  5IGM A;  4A9E A;  4QUT A;  4QR5 A;  3UV2 A;  4HXN A;  4N3W A;  3JVL A;  3MXF A;  4O72 A;  5KTW A;  2YQD A;  5COI A;  5I29 A;  4Q0N A;  5ENF A;  5CU8 A;  4IOR A;  4YBM A;  5I40 A;  3O36 A;  3MQM A;  4OUF A;  2RNX A;  4QBM A;  4NR5 A;  5ENH A;  5I89 A;  5BT5 A;  5KHM A;  5FE8 A;  5KTX A;  2H60 A;  4YYI A;  3U5K A;  2DAT A;  4NR8 A;  3S92 A;  4UYF B;  2RNW A;  3LQJ A;  4TU6 A;  5EGU A;  2DVS A;  2R0Y A;  5BT3 A;  3U5O A;  4NUE A;  4J3I A;  4QC3 A;  5LKU A;  4OGJ A;  4A9O A;  2E7N A;  4YYJ A;  5CUA A;  4YYM A;  4WHW A; 
#chains in the Genus database with same CATH homology
 3UVY A;  4YAT A;  5LVR A;  5FH6 A;  5L99 A;  4CUU A;  4O71 A;  1EQF A;  5JWM A;  3HMF A;  4Z6I A;  3U5P A;  3P1E A;  4LRG A;  4BW2 A;  3DWY A;  4ALG A;  4LR6 A;  5EWV A;  5HRV A;  5A82 A;  2DVV A;  5CZG A;  3UVW A;  4F3I A;  2G4A A;  4Z1Q A;  5A81 A;  4Z6H A;  5DFB A;  3P1F A;  4HBW A;  5BT4 A;  4HXP A;  4Z93 A;  5IID A;  2RS9 B;  4UIX A;  5IGL A;  4A9K A;  4O74 A;  4NUC A;  5ENC A;  4QR3 A;  5D3S A;  5CQ8 A;  2MJV B;  3MUL A;  5FB0 A;  5ETD A;  5H85 A;  4NRB A;  4ZQL A;  5EV9 A;  3ZYU A;  5I7X A;  5E9V A;  2NXB A;  2I7K A;  4NR6 A;  3SVG A;  3O37 A;  2R0V A;  2R10 A;  4CFK A;  5E3G A;  4O75 A;  5I88 A;  5D3P A;  3ONI A;  4XYA A;  5EWH A;  5EWW A;  4YK0 A;  5AD2 A;  5F2P A;  2YYN A;  4QZS A;  5CQA A;  4QC1 A;  5FB1 A;  4YY4 A;  3Q2E A;  4XUB A;  3HMH A;  5G4S A;  4PKL A;  5DYU A;  5CQT A;  4Y03 A;  4HXR A;  5D0C A;  2DVQ A;  4TT4 A;  2DWW A;  4CUS A;  5HCL A;  5DFD A;  5ACY A;  5C4Q A;  2OO1 A;  4YYH A;  4N4F A;  5DFC A;  3P5O A;  4X2I A;  5FE6 A;  4LZS A;  4TTE A;  5K29 A;  5D7X A;  5LKX A;  4YAX A;  4QEV A;  4NR7 A;  4NYX A;  5E9I A;  5FE9 A;  5DKH A;  4O76 A;  4O7A A;  5A5Q A;  5I83 A;  3MB4 A;  4O70 A;  4NQN A;  5CFW A;  3IU5 A;  4GPJ A;  5FE2 A;  5FE5 A;  4NR4 A;  2YEK A;  5KO4 A;  4UIV A;  4TT2 A;  5CQ5 A;  2LSP B;  5EPS A;  2RI7 A;  5F25 A;  5C89 A;  3NXB A;  5E9Y A;  5KTU A;  5A5P A;  4KV1 A;  4WIV A;  4A9N A;  5LKZ A;  5F63 A;  3QZT A;  4FLP A;  5DW1 A;  5F60 A;  5JI8 A;  5EM3 A;  5II1 A;  4NR9 A;  4YC9 A;  5F61 A;  4DON A;  5H1T A;  5DLX A;  5EA1 A;  4CUP A;  5FE0 A;  3G0J A;  5IBN A;  4HXM A;  5LUU A;  5DLZ A;  3Q2F A;  4MEN A;  4Z1S A;  5D3L A;  2OSS A;  4QSQ A;  4UIU A;  1JM4 B;  5F3A A;  4ZC9 A;  4LZR A;  4IOO A;  4BW4 A;  4IR3 A;  4UYD A;  4LYW A;  3U5N A;  4BHW A;  4O7F A;  4XY8 A;  5LJ1 A;  2D9E A;  1N72 A;  5H1V A;  5J0D A;  5CY9 A;  5FBX A;  4PTB A;  5CPE A;  5DYX A;  4YAD A;  5FH7 A;  4QNS A;  3TLP A;  4TT6 A;  5D25 A;  4N4H A;  4ZW1 A;  4BW3 A;  5I1Q A;  4A9H A;  5A5N A;  5FE1 A;  5HM0 A;  5LVQ A;  5CRZ A;  5FDZ A;  5I7Y A;  4XY9 A;  3SVF A;  5EWD A;  4IOQ A;  4UYF A;  4QSX A;  4IR6 A;  2OUO A;  5CUD A;  5A5R A;  5D26 A;  4NRA A;  5CQ6 A;  5AMF A;  5IGN A;  3MB3 A;  4TYL A;  5D3J A;  4IR4 A;  4UYH A;  4PS5 A;  5D3N A;  4XUA A;  5ENG A;  4QEU A;  5IG6 A;  2DKW A;  3IU6 A;  4QSR A;  5F5Z A;  5E3D A;  4UYE A;  2YEM A;  5CTL A;  5IGK A;  4HBX A;  5CGP A;  2RNY A;  4KCX A;  5CP5 A;  5EVA A;  4CUR A;  5EIC A;  5HEM A;  4QSW A;  4C66 A;  1JSP B;  4IR5 A;  5EK9 A;  4NYW A;  4MEQ A;  3UV5 A;  2L84 A;  4O7E A;  4HBV A;  4YY6 A;  4QY4 A;  4UIT A;  4QSS A;  4QSP A;  4WHU A;  5EPB A;  5I80 A;  5EIS A;  2YDW A;  5DYC A;  1WUM A;  5ENJ A;  3D7C A;  4QEW A;  5CQ3 A;  4CL9 A;  3O34 A;  4QYD A;  5CQ7 A;  5CRM A;  2DVR A;  4YBS A;  2D82 A;  5L8U A;  4Q0O A;  4YH3 A;  5F62 A;  4TU4 A;  3HME A;  5D3T A;  5LJ2 A;  3P1C A;  4QR4 A;  5FE7 A;  4NQM A;  3U5J A;  5HLS A;  4OGI A;  5FE3 A;  5E7D A;  4NXJ A;  4HXK A;  4QSV A;  3JVM A;  5HFR A;  3U5M A;  2E7O A;  4O7B A;  5CUG A;  4YYN A;  4MR4 A;  5KU3 A;  4J0S A;  5II2 A;  5I86 A;  4YH4 A;  5CUE A;  4A9I A;  4QYL A;  2WP1 A;  5D24 A;  1E6I A;  2L85 A;  3I3J A;  4UYG A;  4LYI A;  5AME A;  4NRC A;  4A9J A;  5HQ5 A;  4ALH A;  4UIY A;  1F68 A;  5ENB A;  5C8G A;  5A5S A;  3DAI A;  2I8N A;  1WUG A;  3LQI A;  5DW2 A;  5FG4 A;  3K2J A;  5CUB A;  4J1P A;  3MUK A;  5HRX A;  5F36 A;  4TZ8 A;  2KTB B;  2YW5 A;  5HJC A;  5ENI A;  4CUQ A;  5LKT A;  5FG5 A;  5DBM A;  4A9M A;  4CFL A;  5EQ1 A;  3UV4 A;  3G0L A;  5C85 A;  5FFW A;  3O35 A;  4O78 A;  4YAB A;  5DX4 A;  2FSA A;  5HFQ A;  5LJ0 A;  3UVX A;  5D3H A;  5D3R A;  4QST A;  5L8T A;  4UIW A;  5CUC A;  3AAD A;  4RVR A;  5FH8 A;  4TS8 A;  4CLB A;  4HXO A;  2WP2 A;  3UVD A;  3AQA A;  4LZ2 A;  5E9L A;  4TQN A;  5DKC A;  4MEP A;  1X0J A;  2YEL A;  5H1U A;  2L5E A;  3LQH A;  4C67 A;  2F6N A;  4NS5 A;  5DKD A;  4MEO A;  5AD3 A;  3LXJ A;  4BJX A;  4QUU A;  5F1H A;  3UW9 A;  3RCW A;  4AKN A;  5E0R A;  4N4I A;  4PCE A;  4LDF A;  4MR5 A;  4QSU A;  4UIZ A;  4LYS A;  5E73 A;  2RO1 A;  2GRC A;  5A5O A;  5FG6 A;  5TCM A;  4PCI A;  4YYK A;  3S91 A;  4O7C A;  4E96 A;  4BW1 A;  5HEL A;  5EI4 A;  5L97 A;  4YBT A;  5ENE A;  4A9F A;  4N4G A;  3JVJ A;  4HXS A;  3LJW A;  3SVH A;  4PY6 A;  5EP7 A;  4HBY A;  4KV4 A;  3JVK A;  5E74 A;  5L98 A;  5HQ6 A;  5FFY A;  5A85 A;  5A7C A;  4A9L A;  4LC2 A;  3U5L A;  3O33 A;  5HRW A;  3GG3 A;  2RFJ A;  4YYG A;  4YYD A;  5E9K A;  4NUD A;  5L96 A;  5EPR A;  5C7N A;  4NYV A;  3P1D A;  5EWC A;  2E3K A;  2R0S A;  4TZ2 A;  5EU1 A;  4MR6 A;  5F1L A;  3QZS A;  4MR3 A;  3FKM X;  4O77 A;  3QZV A;  5ETB A;  4CUT A;  5A83 A;  5TB6 A;  2F6J A;  5FFV A;  5CS8 A;  5HQ7 A;  2N9G A;  5C87 A;  5FE4 A;  5HEN A;  5CQ4 A;  5G4R A;  4QB3 A;  1ZS5 A;  4HXL A;  4J0R A;  5DY7 A;  5DYA A;  5E9M A;  5IGM A;  4A9E A;  4QUT A;  4QR5 A;  3UV2 A;  4HXN A;  4N3W A;  3JVL A;  3MXF A;  4O72 A;  5KTW A;  2YQD A;  5COI A;  5I29 A;  4Q0N A;  5ENF A;  5CU8 A;  4IOR A;  4YBM A;  5I40 A;  3O36 A;  3MQM A;  4OUF A;  2RNX A;  4QBM A;  4NR5 A;  5ENH A;  5I89 A;  5BT5 A;  5KHM A;  5FE8 A;  5KTX A;  2H60 A;  4YYI A;  3U5K A;  2DAT A;  4NR8 A;  3S92 A;  4UYF B;  2RNW A;  3LQJ A;  4TU6 A;  5EGU A;  2DVS A;  2R0Y A;  5BT3 A;  3U5O A;  4NUE A;  4J3I A;  4QC3 A;  5LKU A;  4OGJ A;  4A9O A;  2E7N A;  4YYJ A;  5CUA A;  4YYM A;  4WHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...