2RNWA

The structural basis for site-specific lysine-acetylated histone recognition by the bromodomains of the human transcriptional co-activators pcaf and cbp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
GSHMSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase PCAF
publication title Structural Basis of Site-Specific Histone Recognition by the Bromodomains of Human Coactivators PCAF and CBP/p300
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/nuclear protein
total genus 31
structure length 118
sequence length 118
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2008-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2rnwA00
3MB3A 4J3IA 4ZQLA 4UYGA 4TZ8A 4YYGA 3Q2EA 3LJWA 4TYLA 5L8TA 5C4QA 4TT2A 4PS5A 5FE0A 4O77A 2R10A 4GPJA 4CUTA 5CQ8A 5LUUA 4MEOA 4QBMA 5ETDA 2G4AA 5LKZA 2R0SA 5ENEA 3P1FA 4TT6A 2NXBA 4MR5A 4Z93A 4CURA 4MR6A 4N4HA 4A9NA 5COIA 5K29A 5BT5A 1EQFA 5D24A 5I1QA 2OSSA 5TB6A 3SVFA 5FDZA 5FB0A 1X0JA 5ENJA 5ENFA 5AMEA 4CUUA 5BT3A 2YQDA 2H60A 4NYVA 4QEVA 5FBXA 4TTEA 3DAIA 5AMFA 2DVSA 5C85A 4O72A 4QNSA 4HXSA 2D82A 4YAXA 5FH7A 5I80A 5ENHA 3FKMX 5DW1A 5EI4A 4TS8A 4NR8A 5DLXA 2YW5A 4IR4A 2MJVB 2DATA 4F3IA 4YYDA 5D3LA 3P1CA 5CQ5A 4TU6A 5L96A 5D3NA 4IR6A 4UYDA 3K2JA 4O7FA 5FG6A 5KHMA 4O7CA 4RVRA 4QSXA 5DKDA 5G4SA 5D3RA 5CUDA 5L98A 4C66A 4MEQA 1JM4B 3MULA 5EVAA 5DKHA 5FE9A 4A9HA 4BW4A 4QSTA 5ACYA 5HQ5A 5IG6A 5KTWA 4YADA 4X2IA 4NRCA 4PCIA 4A9JA 5F36A 5C7NA 5D26A 4LRGA 4FLPA 2RO1A 5LVQA 5E0RA 3ZYUA 2R0YA 2DKWA 5EPBA 4UIXA 4QSUA 4UIVA 5A5NA 4YYJA 5A5OA 5FE1A 3TLPA 4PTBA 5DBMA 5HELA 2GRCA 1WUGA 5DYAA 3SVHA 3MUKA 5A5PA 3G0LA 4LR6A 5E74A 2YDWA 4WIVA 4E96A 5CP5A 4YBTA 5CQ4A 5HFRA 3GG3A 3MQMA 4NYXA 5D3PA 4UYFA 4A9FA 4TU4A 3U5PA 5AD2A 5E9VA 4NUDA 4NR9A 3U5NA 5A5QA 5E3GA 5ENGA 4YABA 5HJCA 5A81A 2L5EA 4QEWA 5DYUA 5F1LA 4Q0NA 5CUBA 2YYNA 5FG5A 4YY6A 4PCEA 4YYKA 5L8UA 5C89A 4PKLA 5I29A 4YYHA 5LJ0A 5II2A 4LYSA 5IBNA 2F6NA 4XUBA 4HXPA 3G0JA 4QSWA 4O76A 4OUFA 5CUGA 3U5OA 3UW9A 4Z6HA 3UV5A 1F68A 3DWYA 5CQAA 5D3HA 5FH8A 4BW3A 4YC9A 5HRWA 4UIWA 4HBWA 5F61A 4O70A 4XUAA 5HRVA 4UYEA 5HEMA 3LQHA 4YH3A 5EK9A 5EQ1A 4CUSA 5A7CA 5A5SA 5I40A 5HCLA 4UIYA 5L97A 1JSPB 4O78A 4NRBA 5E3DA 2D9EA 4ZW1A 5A5RA 3UV2A 5EWDA 5CRZA 4CL9A 4NR6A 5FE7A 5CFWA 5LVRA 3JVLA 4QSVA 4NYWA 4XYAA 4MENA 4QSSA 5EU1A 4YYNA 4WHWA 3JVJA 4QYLA 4QSRA 5LJ1A 3JVKA 2WP2A 4QR4A 2RNYA 2RI7A 2F6JA 3UVDA 2DVVA 5EV9A 4BHWA 4O74A 2OO1A 4N4FA 3S91A 5D0CA 4HXLA 5L99A 5F3AA 5F25A 5DW2A 4ALHA 4A9LA 5F60A 3LQJA 4Q0OA 5EM3A 5CUEA 1ZS5A 3P5OA 4YY4A 4YK0A 4Z1SA 5J0DA 3UV4A 5I83A 5TCMA 5E9KA 3O34A 3P1EA 4J0SA 4BJXA 2YELA 5KO4A 5CTLA 4PY6A 5JWMA 5D3SA 4NR4A 4KCXA 5DYXA 2YEMA 4C67A 3O37A 3O35A 5CZGA 1WUMA 4XY9A 3MB4A 3HMEA 4MR4A 5D3TA 4YYMA 5CGPA 5CUAA 3I3JA 4Y03A 5BT4A 4LZ2A 3UVXA 4HBYA 5CQ6A 2RS9B 5D25A 4ALGA 2LSPB 4WHUA 5AD3A 3U5MA 4UIUA 5FE5A 3Q2FA 5IGMA 5FE6A 3S92A 2RNWA 4NUEA 4O71A 4HXRA 4HBXA 5C87A 4QZSA 5H1VA 5KTUA 2E3KA 2KTBB 4J0RA 4KV1A 5I7XA 5F1HA 5LKUA 4NQNA 3UVWA 5LKTA 4J1PA 4CLBA 3AQAA 4XY8A 3HMHA 4NUCA 4CUQA 5DFCA 4O7AA 4A9EA 5CQ3A 4OGIA 4YATA 5A85A 5E9YA 5E9IA 2RFJA 5DYCA 5DKCA 4ZC9A 5I89A 3RCWA 4O7BA 5C8GA 3JVMA 4A9KA 4NRAA 2OUOA 4MR3A 2I7KA 5DY7A 1N72A 2I8NA 2R0VA 4A9MA 5EGUA 3HMFA 3D7CA 4HXKA 3QZVA 4BW1A 3U5LA 5KU3A 3NXBA 2WP1A 4MEPA 4UITA 3LXJA 4HXOA 4IR3A 5DX4A 3QZTA 3UVYA 3P1DA 5F2PA 4YBSA 5HM0A 4QR3A 5CPEA 4O75A 5CQ7A 5ENCA 4KV4A 5LKXA 5EWHA 5FG4A 5DLZA 4IOQA 2RNXA 4AKNA 4CFLA 3U5KA 5FH6A 5H1UA 4TZ2A 5E9LA 4DONA 2L85A 3SVGA 5I7YA 5IGLA 5IIDA 5CUCA 5DFBA 4NS5A 4QSPA 2FSAA 4LYWA 5EPSA 4A9IA 3O36A 5FFVA 5HENA 5CS8A 5F62A 5A82A 4IORA 4QY4A 5FB1A 5EWWA 4N3WA 4YH4A 4A9OA 4TT4A 5ETBA 5HQ7A 5LJ2A 4NXJA 5A83A 3AADA 5E7DA 4LZSA 4N4IA 4QB3A 3IU6A 5EA1A 5F63A 5EPRA 2YEKA 5FE8A 4LDFA 5E73A 5FFYA 4LZRA 5D3JA 5FE2A 1E6IA 4HBVA 5FE4A 5KTXA 4O7EA 3O33A 4TQNA 5E9MA 5EP7A 3MXFA 4LYIA 5ENIA 5I86A 4N4GA 2DWWA 5JI8A 5ENBA 4IOOA 4QSQA 2L84A 3LQIA 2DVQA 4HXMA 5EWCA 4NR5A 5HFQA 2E7OA 4OGJA 3U5JA 2E7NA 5EICA 5CQTA 4CUPA 4IR5A 4NQMA 4QYDA 5EWVA 2DVRA 4YYIA 3QZSA 5H1TA 5DFDA 5HQ6A 4QC1A 4UIZA 4BW2A 5FFWA 5CY9A 2N9GA 5H85A 4Z6IA 5I88A 5EISA 5G4RA 5HRXA 5IGNA 5II1A 5CU8A 5HLSA 4UYHA 4HXNA 5IGKA 4QEUA 3ONIA 4NR7A 4QUTA 4YBMA 4LC2A 4Z1QA 3IU5A 4QUUA 4QC3A 4QR5A 5F5ZA 5CRMA 5FE3A 4CFKA 5D7XA 4UYFB
chains in the Genus database with same CATH superfamily
3MB3A 4J3IA 4ZQLA 4UYGA 4TZ8A 4YYGA 3Q2EA 3LJWA 4TYLA 5L8TA 5C4QA 4TT2A 4PS5A 2EJNA 5FE0A 4O77A 2R10A 4GPJA 4CUTA 5CQ8A 5LUUA 4MEOA 4QBMA 5ETDA 2G4AA 5LKZA 2R0SA 5ENEA 3P1FA 4TT6A 2NXBA 4MR5A 4Z93A 4CURA 4MR6A 1ZKRA 4N4HA 4A9NA 5COIA 5K29A 5BT5A 1EQFA 5D24A 5I1QA 2OSSA 5TB6A 3SVFA 5FDZA 5FB0A 1X0JA 5ENJA 5ENFA 5AMEA 4CUUA 5BT3A 2YQDA 2H60A 4NYVA 4QEVA 5FBXA 4TTEA 3DAIA 5AMFA 2DVSA 5C85A 4O72A 4QNSA 4HXSA 2D82A 4YAXA 5FH7A 5I80A 5ENHA 3FKMX 5DW1A 5EI4A 4TS8A 4NR8A 5DLXA 2YW5A 4IR4A 2MJVB 2DATA 4F3IA 4YYDA 5D3LA 3P1CA 5CQ5A 4TU6A 5L96A 5D3NA 4IR6A 4UYDA 3K2JA 4O7FA 5FG6A 5KHMA 4O7CA 4RVRA 4QSXA 5DKDA 5G4SA 5D3RA 5CUDA 5L98A 4C66A 4MEQA 1JM4B 3MULA 5EVAA 5DKHA 5FE9A 4A9HA 4BW4A 4QSTA 5ACYA 5HQ5A 5IG6A 5KTWA 4YADA 4X2IA 4NRCA 4PCIA 4A9JA 5F36A 5C7NA 5D26A 4LRGA 4FLPA 2RO1A 5LVQA 5E0RA 3ZYUA 2R0YA 2DKWA 5EPBA 4UIXA 4QSUA 4UIVA 5A5NA 4YYJA 5A5OA 5FE1A 3TLPA 4PTBA 5DBMA 5HELA 2GRCA 1WUGA 5DYAA 3SVHA 3MUKA 5A5PA 3G0LA 4LR6A 5E74A 2YDWA 4WIVA 4E96A 5CP5A 4YBTA 5CQ4A 5HFRA 3GG3A 3MQMA 4NYXA 5D3PA 4UYFA 4A9FA 4TU4A 3U5PA 5AD2A 5E9VA 4NUDA 4NR9A 3U5NA 5A5QA 5E3GA 5ENGA 4YABA 5HJCA 5A81A 2L5EA 4QEWA 5DYUA 5F1LA 4Q0NA 5CUBA 2YYNA 5FG5A 4YY6A 4PCEA 4YYKA 5L8UA 5C89A 4PKLA 5I29A 4YYHA 5LJ0A 5II2A 4LYSA 5IBNA 2F6NA 4XUBA 4HXPA 3G0JA 4QSWA 4O76A 4OUFA 5CUGA 3U5OA 3UW9A 4Z6HA 3UV5A 1F68A 3DWYA 5CQAA 5D3HA 5FH8A 4BW3A 4YC9A 5HRWA 4UIWA 4HBWA 5F61A 4AKHA 4O70A 4XUAA 5HRVA 4UYEA 5HEMA 3LQHA 3VKHA 4YH3A 5EK9A 5EQ1A 4CUSA 5A7CA 5A5SA 5I40A 5HCLA 4UIYA 5L97A 1JSPB 4O78A 4NRBA 5E3DA 2D9EA 4ZW1A 5A5RA 3UV2A 5EWDA 5CRZA 4CL9A 4NR6A 5FE7A 5CFWA 5LVRA 3JVLA 4QSVA 4NYWA 4XYAA 4MENA 4QSSA 5EU1A 4YYNA 3D1DA 4WHWA 3JVJA 4QYLA 4QSRA 5LJ1A 3JVKA 2WP2A 4QR4A 2RNYA 2RI7A 2F6JA 3UVDA 2DVVA 5EV9A 4BHWA 4O74A 2OO1A 4N4FA 3S91A 5D0CA 4HXLA 5L99A 5F3AA 5F25A 5DW2A 4ALHA 4A9LA 5F60A 3LQJA 4Q0OA 5EM3A 5CUEA 1ZS5A 3P5OA 4YY4A 4YK0A 4Z1SA 5J0DA 3UV4A 5I83A 5TCMA 5E9KA 3O34A 3P1EA 4J0SA 4BJXA 2YELA 5KO4A 5CTLA 4PY6A 5JWMA 5D3SA 4NR4A 4KCXA 5DYXA 2YEMA 4C67A 3O37A 3O35A 5CZGA 1WUMA 4XY9A 3MB4A 3HMEA 4MR4A 5D3TA 4YYMA 5CGPA 5CUAA 3I3JA 4Y03A 5BT4A 4LZ2A 3UVXA 4HBYA 5CQ6A 2RS9B 5D25A 4ALGA 2LSPB 4WHUA 5AD3A 3U5MA 4UIUA 5FE5A 3Q2FA 5IGMA 5FE6A 3S92A 2RNWA 4NUEA 4O71A 4HXRA 4HBXA 5C87A 4QZSA 5H1VA 5KTUA 2E3KA 2KTBB 4J0RA 4KV1A 5I7XA 5F1HA 5LKUA 4NQNA 3UVWA 5LKTA 4J1PA 4CLBA 3AQAA 4XY8A 3HMHA 4NUCA 4CUQA 5DFCA 4O7AA 4A9EA 5CQ3A 4OGIA 4YATA 5A85A 5E9YA 5E9IA 2RFJA 5DYCA 5DKCA 4ZC9A 5I89A 3RCWA 4O7BA 5C8GA 3JVMA 4A9KA 4NRAA 2OUOA 4MR3A 2I7KA 5DY7A 1N72A 2I8NA 2R0VA 4A9MA 5EGUA 3HMFA 3D7CA 4HXKA 3QZVA 4BW1A 3U5LA 5KU3A 3NXBA 2WP1A 4MEPA 4UITA 3LXJA 4HXOA 4IR3A 5DX4A 3QZTA 3UVYA 3P1DA 5F2PA 4YBSA 5HM0A 4QR3A 5CPEA 4O75A 5CQ7A 5ENCA 4KV4A 5LKXA 5EWHA 5FG4A 5DLZA 4IOQA 2RNXA 4AKNA 4CFLA 3U5KA 5FH6A 5H1UA 4TZ2A 5E9LA 4DONA 2L85A 3SVGA 5I7YA 5IGLA 5IIDA 5CUCA 4AKIA 5DFBA 4NS5A 4QSPA 2FSAA 4LYWA 5EPSA 4A9IA 3O36A 5FFVA 5HENA 5CS8A 5F62A 5A82A 4IORA 4QY4A 5FB1A 5EWWA 4N3WA 4YH4A 4A9OA 4TT4A 5ETBA 5HQ7A 5LJ2A 4NXJA 5A83A 3AADA 5E7DA 4LZSA 4N4IA 4QB3A 3IU6A 5EA1A 5F63A 5EPRA 2YEKA 1PUOA 5FE8A 4LDFA 3D1BA 5E73A 5FFYA 4LZRA 5D3JA 5FE2A 1E6IA 4HBVA 5FE4A 5KTXA 4O7EA 3O33A 3VKGA 4TQNA 5E9MA 5EP7A 3MXFA 4LYIA 5ENIA 5I86A 4N4GA 2DWWA 5JI8A 5ENBA 4IOOA 4QSQA 2L84A 3LQIA 2DVQA 3ERRA 4HXMA 5EWCA 4NR5A 5HFQA 2E7OA 4OGJA 3U5JA 2E7NA 5EICA 5CQTA 4CUPA 4IR5A 4NQMA 4QYDA 5EWVA 2DVRA 4YYIA 3QZSA 5H1TA 5DFDA 5HQ6A 4QC1A 4UIZA 4BW2A 5FFWA 5CY9A 2N9GA 5H85A 4AKGA 4Z6IA 5I88A 5EISA 5G4RA 5HRXA 5IGNA 5II1A 5CU8A 5HLSA 4UYHA 4HXNA 5IGKA 4QEUA 3ONIA 4NR7A 4QUTA 4YBMA 4LC2A 4Z1QA 3IU5A 4QUUA 4QC3A 4QR5A 5F5ZA 5CRMA 5FE3A 4CFKA 4AI6A 5D7XA 4UYFB
chains in the Genus database with same CATH topology
3MB3A 4J3IA 4ZQLA 4UYGA 4TZ8A 4YYGA 3Q2EA 3LJWA 4TYLA 5L8TA 5C4QA 4TT2A 4PS5A 5FE0A 4O77A 2R10A 4GPJA 4CUTA 5CQ8A 5LUUA 4MEOA 4QBMA 5ETDA 2G4AA 5LKZA 2R0SA 5ENEA 3P1FA 4TT6A 2NXBA 4MR5A 4Z93A 4CURA 4MR6A 4N4HA 4A9NA 5COIA 5K29A 5BT5A 1EQFA 5D24A 5I1QA 2OSSA 5TB6A 3SVFA 5FDZA 5FB0A 1X0JA 5ENJA 5ENFA 5AMEA 4CUUA 5BT3A 2YQDA 2H60A 4NYVA 4QEVA 5FBXA 4TTEA 3DAIA 5AMFA 2DVSA 5C85A 4O72A 4QNSA 4HXSA 2D82A 4YAXA 5FH7A 5I80A 5ENHA 3FKMX 5DW1A 5EI4A 4TS8A 4NR8A 5DLXA 2YW5A 4IR4A 2MJVB 2DATA 4F3IA 4YYDA 5D3LA 3P1CA 5CQ5A 4TU6A 5L96A 5D3NA 4IR6A 4UYDA 3K2JA 4O7FA 5FG6A 5KHMA 4O7CA 4RVRA 4QSXA 5DKDA 5G4SA 5D3RA 5CUDA 5L98A 4C66A 4MEQA 1JM4B 3MULA 5EVAA 5DKHA 5FE9A 4A9HA 4BW4A 4QSTA 5ACYA 5HQ5A 5IG6A 5KTWA 4YADA 4X2IA 4NRCA 4PCIA 4A9JA 5F36A 5C7NA 5D26A 4LRGA 4FLPA 2RO1A 5LVQA 5E0RA 3ZYUA 2R0YA 2DKWA 5EPBA 4UIXA 4QSUA 4UIVA 5A5NA 4YYJA 5A5OA 5FE1A 3TLPA 4PTBA 5DBMA 5HELA 2GRCA 1WUGA 5DYAA 3SVHA 3MUKA 5A5PA 3G0LA 4LR6A 5E74A 2YDWA 4WIVA 4E96A 5CP5A 4YBTA 5CQ4A 5HFRA 3GG3A 3MQMA 4NYXA 5D3PA 4UYFA 4A9FA 4TU4A 3U5PA 5AD2A 5E9VA 4NUDA 4NR9A 3U5NA 5A5QA 5E3GA 5ENGA 4YABA 5HJCA 5A81A 2L5EA 4QEWA 5DYUA 5F1LA 4Q0NA 5CUBA 2YYNA 5FG5A 4YY6A 4PCEA 4YYKA 5L8UA 5C89A 4PKLA 5I29A 4YYHA 5LJ0A 5II2A 4LYSA 5IBNA 2F6NA 4XUBA 4HXPA 3G0JA 4QSWA 4O76A 4OUFA 5CUGA 3U5OA 3UW9A 4Z6HA 3UV5A 1F68A 3DWYA 5CQAA 5D3HA 5FH8A 4BW3A 4YC9A 5HRWA 4UIWA 4HBWA 5F61A 4O70A 4XUAA 5HRVA 4UYEA 5HEMA 3LQHA 4YH3A 5EK9A 5EQ1A 4CUSA 5A7CA 5A5SA 5I40A 5HCLA 4UIYA 5L97A 1JSPB 4O78A 4NRBA 5E3DA 2D9EA 4ZW1A 5A5RA 3UV2A 5EWDA 5CRZA 4CL9A 4NR6A 5FE7A 5CFWA 5LVRA 3JVLA 4QSVA 4NYWA 4XYAA 4MENA 4QSSA 5EU1A 4YYNA 4WHWA 3JVJA 4QYLA 4QSRA 5LJ1A 3JVKA 2WP2A 4QR4A 2RNYA 2RI7A 2F6JA 3UVDA 2DVVA 5EV9A 4BHWA 4O74A 2OO1A 4N4FA 3S91A 5D0CA 4HXLA 5L99A 5F3AA 5F25A 5DW2A 4ALHA 4A9LA 5F60A 3LQJA 4Q0OA 5EM3A 5CUEA 1ZS5A 3P5OA 4YY4A 4YK0A 4Z1SA 5J0DA 3UV4A 5I83A 5TCMA 5E9KA 3O34A 3P1EA 4J0SA 4BJXA 2YELA 5KO4A 5CTLA 4PY6A 5JWMA 5D3SA 4NR4A 4KCXA 5DYXA 2YEMA 4C67A 3O37A 3O35A 5CZGA 1WUMA 4XY9A 3MB4A 3HMEA 4MR4A 5D3TA 4YYMA 5CGPA 5CUAA 3I3JA 4Y03A 5BT4A 4LZ2A 3UVXA 4HBYA 5CQ6A 2RS9B 5D25A 4ALGA 2LSPB 4WHUA 5AD3A 3U5MA 4UIUA 5FE5A 3Q2FA 5IGMA 5FE6A 3S92A 2RNWA 4NUEA 4O71A 4HXRA 4HBXA 5C87A 4QZSA 5H1VA 5KTUA 2E3KA 2KTBB 4J0RA 4KV1A 5I7XA 5F1HA 5LKUA 4NQNA 3UVWA 5LKTA 4J1PA 4CLBA 3AQAA 4XY8A 3HMHA 4NUCA 4CUQA 5DFCA 4O7AA 4A9EA 5CQ3A 4OGIA 4YATA 5A85A 5E9YA 5E9IA 2RFJA 5DYCA 5DKCA 4ZC9A 5I89A 3RCWA 4O7BA 5C8GA 3JVMA 4A9KA 4NRAA 2OUOA 4MR3A 2I7KA 5DY7A 1N72A 2I8NA 2R0VA 4A9MA 5EGUA 3HMFA 3D7CA 4HXKA 3QZVA 4BW1A 3U5LA 5KU3A 3NXBA 2WP1A 4MEPA 4UITA 3LXJA 4HXOA 4IR3A 5DX4A 3QZTA 3UVYA 3P1DA 5F2PA 4YBSA 5HM0A 4QR3A 5CPEA 4O75A 5CQ7A 5ENCA 4KV4A 5LKXA 5EWHA 5FG4A 5DLZA 4IOQA 2RNXA 4AKNA 4CFLA 3U5KA 5FH6A 5H1UA 4TZ2A 5E9LA 4DONA 2L85A 3SVGA 5I7YA 5IGLA 5IIDA 5CUCA 5DFBA 4NS5A 4QSPA 2FSAA 4LYWA 5EPSA 4A9IA 3O36A 5FFVA 5HENA 5CS8A 5F62A 5A82A 4IORA 4QY4A 5FB1A 5EWWA 4N3WA 4YH4A 4A9OA 4TT4A 5ETBA 5HQ7A 5LJ2A 4NXJA 5A83A 3AADA 5E7DA 4LZSA 4N4IA 4QB3A 3IU6A 5EA1A 5F63A 5EPRA 2YEKA 5FE8A 4LDFA 5E73A 5FFYA 4LZRA 5D3JA 5FE2A 1E6IA 4HBVA 5FE4A 5KTXA 4O7EA 3O33A 4TQNA 5E9MA 5EP7A 3MXFA 4LYIA 5ENIA 5I86A 4N4GA 2DWWA 5JI8A 5ENBA 4IOOA 4QSQA 2L84A 3LQIA 2DVQA 4HXMA 5EWCA 4NR5A 5HFQA 2E7OA 4OGJA 3U5JA 2E7NA 5EICA 5CQTA 4CUPA 4IR5A 4NQMA 4QYDA 5EWVA 2DVRA 4YYIA 3QZSA 5H1TA 5DFDA 5HQ6A 4QC1A 4UIZA 4BW2A 5FFWA 5CY9A 2N9GA 5H85A 4Z6IA 5I88A 5EISA 5G4RA 5HRXA 5IGNA 5II1A 5CU8A 5HLSA 4UYHA 4HXNA 5IGKA 4QEUA 3ONIA 4NR7A 4QUTA 4YBMA 4LC2A 4Z1QA 3IU5A 4QUUA 4QC3A 4QR5A 5F5ZA 5CRMA 5FE3A 4CFKA 5D7XA 4UYFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MB3 A;  4J3I A;  4ZQL A;  4UYG A;  4TZ8 A;  4YYG A;  3Q2E A;  3LJW A;  4TYL A;  5L8T A;  5C4Q A;  4TT2 A;  4PS5 A;  5FE0 A;  4O77 A;  2R10 A;  4GPJ A;  4CUT A;  5CQ8 A;  5LUU A;  4MEO A;  4QBM A;  5ETD A;  2G4A A;  5LKZ A;  2R0S A;  5ENE A;  3P1F A;  4TT6 A;  2NXB A;  4MR5 A;  4Z93 A;  4CUR A;  4MR6 A;  4N4H A;  4A9N A;  5COI A;  5K29 A;  5BT5 A;  1EQF A;  5D24 A;  5I1Q A;  2OSS A;  5TB6 A;  3SVF A;  5FDZ A;  5FB0 A;  1X0J A;  5ENJ A;  5ENF A;  5AME A;  4CUU A;  5BT3 A;  2YQD A;  2H60 A;  4NYV A;  4QEV A;  5FBX A;  4TTE A;  3DAI A;  5AMF A;  2DVS A;  5C85 A;  4O72 A;  4QNS A;  4HXS A;  2D82 A;  4YAX A;  5FH7 A;  5I80 A;  5ENH A;  3FKM X;  5DW1 A;  5EI4 A;  4TS8 A;  4NR8 A;  5DLX A;  2YW5 A;  4IR4 A;  2MJV B;  2DAT A;  4F3I A;  4YYD A;  5D3L A;  3P1C A;  5CQ5 A;  4TU6 A;  5L96 A;  5D3N A;  4IR6 A;  4UYD A;  3K2J A;  4O7F A;  5FG6 A;  5KHM A;  4O7C A;  4RVR A;  4QSX A;  5DKD A;  5G4S A;  5D3R A;  5CUD A;  5L98 A;  4C66 A;  4MEQ A;  1JM4 B;  3MUL A;  5EVA A;  5DKH A;  5FE9 A;  4A9H A;  4BW4 A;  4QST A;  5ACY A;  5HQ5 A;  5IG6 A;  5KTW A;  4YAD A;  4X2I A;  4NRC A;  4PCI A;  4A9J A;  5F36 A;  5C7N A;  5D26 A;  4LRG A;  4FLP A;  2RO1 A;  5LVQ A;  5E0R A;  3ZYU A;  2R0Y A;  2DKW A;  5EPB A;  4UIX A;  4QSU A;  4UIV A;  5A5N A;  4YYJ A;  5A5O A;  5FE1 A;  3TLP A;  4PTB A;  5DBM A;  5HEL A;  2GRC A;  1WUG A;  5DYA A;  3SVH A;  3MUK A;  5A5P A;  3G0L A;  4LR6 A;  5E74 A;  2YDW A;  4WIV A;  4E96 A;  5CP5 A;  4YBT A;  5CQ4 A;  5HFR A;  3GG3 A;  3MQM A;  4NYX A;  5D3P A;  4UYF A;  4A9F A;  4TU4 A;  3U5P A;  5AD2 A;  5E9V A;  4NUD A;  4NR9 A;  3U5N A;  5A5Q A;  5E3G A;  5ENG A;  4YAB A;  5HJC A;  5A81 A;  2L5E A;  4QEW A;  5DYU A;  5F1L A;  4Q0N A;  5CUB A;  2YYN A;  5FG5 A;  4YY6 A;  4PCE A;  4YYK A;  5L8U A;  5C89 A;  4PKL A;  5I29 A;  4YYH A;  5LJ0 A;  5II2 A;  4LYS A;  5IBN A;  2F6N A;  4XUB A;  4HXP A;  3G0J A;  4QSW A;  4O76 A;  4OUF A;  5CUG A;  3U5O A;  3UW9 A;  4Z6H A;  3UV5 A;  1F68 A;  3DWY A;  5CQA A;  5D3H A;  5FH8 A;  4BW3 A;  4YC9 A;  5HRW A;  4UIW A;  4HBW A;  5F61 A;  4O70 A;  4XUA A;  5HRV A;  4UYE A;  5HEM A;  3LQH A;  4YH3 A;  5EK9 A;  5EQ1 A;  4CUS A;  5A7C A;  5A5S A;  5I40 A;  5HCL A;  4UIY A;  5L97 A;  1JSP B;  4O78 A;  4NRB A;  5E3D A;  2D9E A;  4ZW1 A;  5A5R A;  3UV2 A;  5EWD A;  5CRZ A;  4CL9 A;  4NR6 A;  5FE7 A;  5CFW A;  5LVR A;  3JVL A;  4QSV A;  4NYW A;  4XYA A;  4MEN A;  4QSS A;  5EU1 A;  4YYN A;  4WHW A;  3JVJ A;  4QYL A;  4QSR A;  5LJ1 A;  3JVK A;  2WP2 A;  4QR4 A;  2RNY A;  2RI7 A;  2F6J A;  3UVD A;  2DVV A;  5EV9 A;  4BHW A;  4O74 A;  2OO1 A;  4N4F A;  3S91 A;  5D0C A;  4HXL A;  5L99 A;  5F3A A;  5F25 A;  5DW2 A;  4ALH A;  4A9L A;  5F60 A;  3LQJ A;  4Q0O A;  5EM3 A;  5CUE A;  1ZS5 A;  3P5O A;  4YY4 A;  4YK0 A;  4Z1S A;  5J0D A;  3UV4 A;  5I83 A;  5TCM A;  5E9K A;  3O34 A;  3P1E A;  4J0S A;  4BJX A;  2YEL A;  5KO4 A;  5CTL A;  4PY6 A;  5JWM A;  5D3S A;  4NR4 A;  4KCX A;  5DYX A;  2YEM A;  4C67 A;  3O37 A;  3O35 A;  5CZG A;  1WUM A;  4XY9 A;  3MB4 A;  3HME A;  4MR4 A;  5D3T A;  4YYM A;  5CGP A;  5CUA A;  3I3J A;  4Y03 A;  5BT4 A;  4LZ2 A;  3UVX A;  4HBY A;  5CQ6 A;  2RS9 B;  5D25 A;  4ALG A;  2LSP B;  4WHU A;  5AD3 A;  3U5M A;  4UIU A;  5FE5 A;  3Q2F A;  5IGM A;  5FE6 A;  3S92 A;  2RNW A;  4NUE A;  4O71 A;  4HXR A;  4HBX A;  5C87 A;  4QZS A;  5H1V A;  5KTU A;  2E3K A;  2KTB B;  4J0R A;  4KV1 A;  5I7X A;  5F1H A;  5LKU A;  4NQN A;  3UVW A;  5LKT A;  4J1P A;  4CLB A;  3AQA A;  4XY8 A;  3HMH A;  4NUC A;  4CUQ A;  5DFC A;  4O7A A;  4A9E A;  5CQ3 A;  4OGI A;  4YAT A;  5A85 A;  5E9Y A;  5E9I A;  2RFJ A;  5DYC A;  5DKC A;  4ZC9 A;  5I89 A;  3RCW A;  4O7B A;  5C8G A;  3JVM A;  4A9K A;  4NRA A;  2OUO A;  4MR3 A;  2I7K A;  5DY7 A;  1N72 A;  2I8N A;  2R0V A;  4A9M A;  5EGU A;  3HMF A;  3D7C A;  4HXK A;  3QZV A;  4BW1 A;  3U5L A;  5KU3 A;  3NXB A;  2WP1 A;  4MEP A;  4UIT A;  3LXJ A;  4HXO A;  4IR3 A;  5DX4 A;  3QZT A;  3UVY A;  3P1D A;  5F2P A;  4YBS A;  5HM0 A;  4QR3 A;  5CPE A;  4O75 A;  5CQ7 A;  5ENC A;  4KV4 A;  5LKX A;  5EWH A;  5FG4 A;  5DLZ A;  4IOQ A;  2RNX A;  4AKN A;  4CFL A;  3U5K A;  5FH6 A;  5H1U A;  4TZ2 A;  5E9L A;  4DON A;  2L85 A;  3SVG A;  5I7Y A;  5IGL A;  5IID A;  5CUC A;  5DFB A;  4NS5 A;  4QSP A;  2FSA A;  4LYW A;  5EPS A;  4A9I A;  3O36 A;  5FFV A;  5HEN A;  5CS8 A;  5F62 A;  5A82 A;  4IOR A;  4QY4 A;  5FB1 A;  5EWW A;  4N3W A;  4YH4 A;  4A9O A;  4TT4 A;  5ETB A;  5HQ7 A;  5LJ2 A;  4NXJ A;  5A83 A;  3AAD A;  5E7D A;  4LZS A;  4N4I A;  4QB3 A;  3IU6 A;  5EA1 A;  5F63 A;  5EPR A;  2YEK A;  5FE8 A;  4LDF A;  5E73 A;  5FFY A;  4LZR A;  5D3J A;  5FE2 A;  1E6I A;  4HBV A;  5FE4 A;  5KTX A;  4O7E A;  3O33 A;  4TQN A;  5E9M A;  5EP7 A;  3MXF A;  4LYI A;  5ENI A;  5I86 A;  4N4G A;  2DWW A;  5JI8 A;  5ENB A;  4IOO A;  4QSQ A;  2L84 A;  3LQI A;  2DVQ A;  4HXM A;  5EWC A;  4NR5 A;  5HFQ A;  2E7O A;  4OGJ A;  3U5J A;  2E7N A;  5EIC A;  5CQT A;  4CUP A;  4IR5 A;  4NQM A;  4QYD A;  5EWV A;  2DVR A;  4YYI A;  3QZS A;  5H1T A;  5DFD A;  5HQ6 A;  4QC1 A;  4UIZ A;  4BW2 A;  5FFW A;  5CY9 A;  2N9G A;  5H85 A;  4Z6I A;  5I88 A;  5EIS A;  5G4R A;  5HRX A;  5IGN A;  5II1 A;  5CU8 A;  5HLS A;  4UYH A;  4HXN A;  5IGK A;  4QEU A;  3ONI A;  4NR7 A;  4QUT A;  4YBM A;  4LC2 A;  4Z1Q A;  3IU5 A;  4QUU A;  4QC3 A;  4QR5 A;  5F5Z A;  5CRM A;  5FE3 A;  4CFK A;  5D7X A;  4UYF B; 
#chains in the Genus database with same CATH topology
 3MB3 A;  4J3I A;  4ZQL A;  4UYG A;  4TZ8 A;  4YYG A;  3Q2E A;  3LJW A;  4TYL A;  5L8T A;  5C4Q A;  4TT2 A;  4PS5 A;  2EJN A;  5FE0 A;  4O77 A;  2R10 A;  4GPJ A;  4CUT A;  5CQ8 A;  5LUU A;  4MEO A;  4QBM A;  5ETD A;  2G4A A;  5LKZ A;  2R0S A;  5ENE A;  3P1F A;  4TT6 A;  2NXB A;  4MR5 A;  4Z93 A;  4CUR A;  4MR6 A;  1ZKR A;  4N4H A;  4A9N A;  5COI A;  5K29 A;  5BT5 A;  1EQF A;  5D24 A;  5I1Q A;  2OSS A;  5TB6 A;  3SVF A;  5FDZ A;  5FB0 A;  1X0J A;  5ENJ A;  5ENF A;  5AME A;  4CUU A;  5BT3 A;  2YQD A;  2H60 A;  4NYV A;  4QEV A;  5FBX A;  4TTE A;  3DAI A;  5AMF A;  2DVS A;  5C85 A;  4O72 A;  4QNS A;  4HXS A;  2D82 A;  4YAX A;  5FH7 A;  5I80 A;  5ENH A;  3FKM X;  5DW1 A;  5EI4 A;  4TS8 A;  4NR8 A;  5DLX A;  2YW5 A;  4IR4 A;  2MJV B;  2DAT A;  4F3I A;  4YYD A;  5D3L A;  3P1C A;  5CQ5 A;  4TU6 A;  5L96 A;  5D3N A;  4IR6 A;  4UYD A;  3K2J A;  4O7F A;  5FG6 A;  5KHM A;  4O7C A;  4RVR A;  4QSX A;  5DKD A;  5G4S A;  5D3R A;  5CUD A;  5L98 A;  4C66 A;  4MEQ A;  1JM4 B;  3MUL A;  5EVA A;  5DKH A;  5FE9 A;  4A9H A;  4BW4 A;  4QST A;  5ACY A;  5HQ5 A;  5IG6 A;  5KTW A;  4YAD A;  4X2I A;  4NRC A;  4PCI A;  4A9J A;  5F36 A;  5C7N A;  5D26 A;  4LRG A;  4FLP A;  2RO1 A;  5LVQ A;  5E0R A;  3ZYU A;  2R0Y A;  2DKW A;  5EPB A;  4UIX A;  4QSU A;  4UIV A;  5A5N A;  4YYJ A;  5A5O A;  5FE1 A;  3TLP A;  4PTB A;  5DBM A;  5HEL A;  2GRC A;  1WUG A;  5DYA A;  3SVH A;  3MUK A;  5A5P A;  3G0L A;  4LR6 A;  5E74 A;  2YDW A;  4WIV A;  4E96 A;  5CP5 A;  4YBT A;  5CQ4 A;  5HFR A;  3GG3 A;  3MQM A;  4NYX A;  5D3P A;  4UYF A;  4A9F A;  4TU4 A;  3U5P A;  5AD2 A;  5E9V A;  4NUD A;  4NR9 A;  3U5N A;  5A5Q A;  5E3G A;  5ENG A;  4YAB A;  5HJC A;  5A81 A;  2L5E A;  4QEW A;  5DYU A;  5F1L A;  4Q0N A;  5CUB A;  2YYN A;  5FG5 A;  4YY6 A;  4PCE A;  4YYK A;  5L8U A;  5C89 A;  4PKL A;  5I29 A;  4YYH A;  5LJ0 A;  5II2 A;  4LYS A;  5IBN A;  2F6N A;  4XUB A;  4HXP A;  3G0J A;  4QSW A;  4O76 A;  4OUF A;  5CUG A;  3U5O A;  3UW9 A;  4Z6H A;  3UV5 A;  1F68 A;  3DWY A;  5CQA A;  5D3H A;  5FH8 A;  4BW3 A;  4YC9 A;  5HRW A;  4UIW A;  4HBW A;  5F61 A;  4AKH A;  4O70 A;  4XUA A;  5HRV A;  4UYE A;  5HEM A;  3LQH A;  3VKH A;  4YH3 A;  5EK9 A;  5EQ1 A;  4CUS A;  5A7C A;  5A5S A;  5I40 A;  5HCL A;  4UIY A;  5L97 A;  1JSP B;  4O78 A;  4NRB A;  5E3D A;  2D9E A;  4ZW1 A;  5A5R A;  3UV2 A;  5EWD A;  5CRZ A;  4CL9 A;  4NR6 A;  5FE7 A;  5CFW A;  5LVR A;  3JVL A;  4QSV A;  4NYW A;  4XYA A;  4MEN A;  4QSS A;  5EU1 A;  4YYN A;  3D1D A;  4WHW A;  3JVJ A;  4QYL A;  4QSR A;  5LJ1 A;  3JVK A;  2WP2 A;  4QR4 A;  2RNY A;  2RI7 A;  2F6J A;  3UVD A;  2DVV A;  5EV9 A;  4BHW A;  4O74 A;  2OO1 A;  4N4F A;  3S91 A;  5D0C A;  4HXL A;  5L99 A;  5F3A A;  5F25 A;  5DW2 A;  4ALH A;  4A9L A;  5F60 A;  3LQJ A;  4Q0O A;  5EM3 A;  5CUE A;  1ZS5 A;  3P5O A;  4YY4 A;  4YK0 A;  4Z1S A;  5J0D A;  3UV4 A;  5I83 A;  5TCM A;  5E9K A;  3O34 A;  3P1E A;  4J0S A;  4BJX A;  2YEL A;  5KO4 A;  5CTL A;  4PY6 A;  5JWM A;  5D3S A;  4NR4 A;  4KCX A;  5DYX A;  2YEM A;  4C67 A;  3O37 A;  3O35 A;  5CZG A;  1WUM A;  4XY9 A;  3MB4 A;  3HME A;  4MR4 A;  5D3T A;  4YYM A;  5CGP A;  5CUA A;  3I3J A;  4Y03 A;  5BT4 A;  4LZ2 A;  3UVX A;  4HBY A;  5CQ6 A;  2RS9 B;  5D25 A;  4ALG A;  2LSP B;  4WHU A;  5AD3 A;  3U5M A;  4UIU A;  5FE5 A;  3Q2F A;  5IGM A;  5FE6 A;  3S92 A;  2RNW A;  4NUE A;  4O71 A;  4HXR A;  4HBX A;  5C87 A;  4QZS A;  5H1V A;  5KTU A;  2E3K A;  2KTB B;  4J0R A;  4KV1 A;  5I7X A;  5F1H A;  5LKU A;  4NQN A;  3UVW A;  5LKT A;  4J1P A;  4CLB A;  3AQA A;  4XY8 A;  3HMH A;  4NUC A;  4CUQ A;  5DFC A;  4O7A A;  4A9E A;  5CQ3 A;  4OGI A;  4YAT A;  5A85 A;  5E9Y A;  5E9I A;  2RFJ A;  5DYC A;  5DKC A;  4ZC9 A;  5I89 A;  3RCW A;  4O7B A;  5C8G A;  3JVM A;  4A9K A;  4NRA A;  2OUO A;  4MR3 A;  2I7K A;  5DY7 A;  1N72 A;  2I8N A;  2R0V A;  4A9M A;  5EGU A;  3HMF A;  3D7C A;  4HXK A;  3QZV A;  4BW1 A;  3U5L A;  5KU3 A;  3NXB A;  2WP1 A;  4MEP A;  4UIT A;  3LXJ A;  4HXO A;  4IR3 A;  5DX4 A;  3QZT A;  3UVY A;  3P1D A;  5F2P A;  4YBS A;  5HM0 A;  4QR3 A;  5CPE A;  4O75 A;  5CQ7 A;  5ENC A;  4KV4 A;  5LKX A;  5EWH A;  5FG4 A;  5DLZ A;  4IOQ A;  2RNX A;  4AKN A;  4CFL A;  3U5K A;  5FH6 A;  5H1U A;  4TZ2 A;  5E9L A;  4DON A;  2L85 A;  3SVG A;  5I7Y A;  5IGL A;  5IID A;  5CUC A;  4AKI A;  5DFB A;  4NS5 A;  4QSP A;  2FSA A;  4LYW A;  5EPS A;  4A9I A;  3O36 A;  5FFV A;  5HEN A;  5CS8 A;  5F62 A;  5A82 A;  4IOR A;  4QY4 A;  5FB1 A;  5EWW A;  4N3W A;  4YH4 A;  4A9O A;  4TT4 A;  5ETB A;  5HQ7 A;  5LJ2 A;  4NXJ A;  5A83 A;  3AAD A;  5E7D A;  4LZS A;  4N4I A;  4QB3 A;  3IU6 A;  5EA1 A;  5F63 A;  5EPR A;  2YEK A;  1PUO A;  5FE8 A;  4LDF A;  3D1B A;  5E73 A;  5FFY A;  4LZR A;  5D3J A;  5FE2 A;  1E6I A;  4HBV A;  5FE4 A;  5KTX A;  4O7E A;  3O33 A;  3VKG A;  4TQN A;  5E9M A;  5EP7 A;  3MXF A;  4LYI A;  5ENI A;  5I86 A;  4N4G A;  2DWW A;  5JI8 A;  5ENB A;  4IOO A;  4QSQ A;  2L84 A;  3LQI A;  2DVQ A;  3ERR A;  4HXM A;  5EWC A;  4NR5 A;  5HFQ A;  2E7O A;  4OGJ A;  3U5J A;  2E7N A;  5EIC A;  5CQT A;  4CUP A;  4IR5 A;  4NQM A;  4QYD A;  5EWV A;  2DVR A;  4YYI A;  3QZS A;  5H1T A;  5DFD A;  5HQ6 A;  4QC1 A;  4UIZ A;  4BW2 A;  5FFW A;  5CY9 A;  2N9G A;  5H85 A;  4AKG A;  4Z6I A;  5I88 A;  5EIS A;  5G4R A;  5HRX A;  5IGN A;  5II1 A;  5CU8 A;  5HLS A;  4UYH A;  4HXN A;  5IGK A;  4QEU A;  3ONI A;  4NR7 A;  4QUT A;  4YBM A;  4LC2 A;  4Z1Q A;  3IU5 A;  4QUU A;  4QC3 A;  4QR5 A;  5F5Z A;  5CRM A;  5FE3 A;  4CFK A;  4AI6 A;  5D7X A;  4UYF B; 
#chains in the Genus database with same CATH homology
 3MB3 A;  4J3I A;  4ZQL A;  4UYG A;  4TZ8 A;  4YYG A;  3Q2E A;  3LJW A;  4TYL A;  5L8T A;  5C4Q A;  4TT2 A;  4PS5 A;  5FE0 A;  4O77 A;  2R10 A;  4GPJ A;  4CUT A;  5CQ8 A;  5LUU A;  4MEO A;  4QBM A;  5ETD A;  2G4A A;  5LKZ A;  2R0S A;  5ENE A;  3P1F A;  4TT6 A;  2NXB A;  4MR5 A;  4Z93 A;  4CUR A;  4MR6 A;  4N4H A;  4A9N A;  5COI A;  5K29 A;  5BT5 A;  1EQF A;  5D24 A;  5I1Q A;  2OSS A;  5TB6 A;  3SVF A;  5FDZ A;  5FB0 A;  1X0J A;  5ENJ A;  5ENF A;  5AME A;  4CUU A;  5BT3 A;  2YQD A;  2H60 A;  4NYV A;  4QEV A;  5FBX A;  4TTE A;  3DAI A;  5AMF A;  2DVS A;  5C85 A;  4O72 A;  4QNS A;  4HXS A;  2D82 A;  4YAX A;  5FH7 A;  5I80 A;  5ENH A;  3FKM X;  5DW1 A;  5EI4 A;  4TS8 A;  4NR8 A;  5DLX A;  2YW5 A;  4IR4 A;  2MJV B;  2DAT A;  4F3I A;  4YYD A;  5D3L A;  3P1C A;  5CQ5 A;  4TU6 A;  5L96 A;  5D3N A;  4IR6 A;  4UYD A;  3K2J A;  4O7F A;  5FG6 A;  5KHM A;  4O7C A;  4RVR A;  4QSX A;  5DKD A;  5G4S A;  5D3R A;  5CUD A;  5L98 A;  4C66 A;  4MEQ A;  1JM4 B;  3MUL A;  5EVA A;  5DKH A;  5FE9 A;  4A9H A;  4BW4 A;  4QST A;  5ACY A;  5HQ5 A;  5IG6 A;  5KTW A;  4YAD A;  4X2I A;  4NRC A;  4PCI A;  4A9J A;  5F36 A;  5C7N A;  5D26 A;  4LRG A;  4FLP A;  2RO1 A;  5LVQ A;  5E0R A;  3ZYU A;  2R0Y A;  2DKW A;  5EPB A;  4UIX A;  4QSU A;  4UIV A;  5A5N A;  4YYJ A;  5A5O A;  5FE1 A;  3TLP A;  4PTB A;  5DBM A;  5HEL A;  2GRC A;  1WUG A;  5DYA A;  3SVH A;  3MUK A;  5A5P A;  3G0L A;  4LR6 A;  5E74 A;  2YDW A;  4WIV A;  4E96 A;  5CP5 A;  4YBT A;  5CQ4 A;  5HFR A;  3GG3 A;  3MQM A;  4NYX A;  5D3P A;  4UYF A;  4A9F A;  4TU4 A;  3U5P A;  5AD2 A;  5E9V A;  4NUD A;  4NR9 A;  3U5N A;  5A5Q A;  5E3G A;  5ENG A;  4YAB A;  5HJC A;  5A81 A;  2L5E A;  4QEW A;  5DYU A;  5F1L A;  4Q0N A;  5CUB A;  2YYN A;  5FG5 A;  4YY6 A;  4PCE A;  4YYK A;  5L8U A;  5C89 A;  4PKL A;  5I29 A;  4YYH A;  5LJ0 A;  5II2 A;  4LYS A;  5IBN A;  2F6N A;  4XUB A;  4HXP A;  3G0J A;  4QSW A;  4O76 A;  4OUF A;  5CUG A;  3U5O A;  3UW9 A;  4Z6H A;  3UV5 A;  1F68 A;  3DWY A;  5CQA A;  5D3H A;  5FH8 A;  4BW3 A;  4YC9 A;  5HRW A;  4UIW A;  4HBW A;  5F61 A;  4O70 A;  4XUA A;  5HRV A;  4UYE A;  5HEM A;  3LQH A;  4YH3 A;  5EK9 A;  5EQ1 A;  4CUS A;  5A7C A;  5A5S A;  5I40 A;  5HCL A;  4UIY A;  5L97 A;  1JSP B;  4O78 A;  4NRB A;  5E3D A;  2D9E A;  4ZW1 A;  5A5R A;  3UV2 A;  5EWD A;  5CRZ A;  4CL9 A;  4NR6 A;  5FE7 A;  5CFW A;  5LVR A;  3JVL A;  4QSV A;  4NYW A;  4XYA A;  4MEN A;  4QSS A;  5EU1 A;  4YYN A;  4WHW A;  3JVJ A;  4QYL A;  4QSR A;  5LJ1 A;  3JVK A;  2WP2 A;  4QR4 A;  2RNY A;  2RI7 A;  2F6J A;  3UVD A;  2DVV A;  5EV9 A;  4BHW A;  4O74 A;  2OO1 A;  4N4F A;  3S91 A;  5D0C A;  4HXL A;  5L99 A;  5F3A A;  5F25 A;  5DW2 A;  4ALH A;  4A9L A;  5F60 A;  3LQJ A;  4Q0O A;  5EM3 A;  5CUE A;  1ZS5 A;  3P5O A;  4YY4 A;  4YK0 A;  4Z1S A;  5J0D A;  3UV4 A;  5I83 A;  5TCM A;  5E9K A;  3O34 A;  3P1E A;  4J0S A;  4BJX A;  2YEL A;  5KO4 A;  5CTL A;  4PY6 A;  5JWM A;  5D3S A;  4NR4 A;  4KCX A;  5DYX A;  2YEM A;  4C67 A;  3O37 A;  3O35 A;  5CZG A;  1WUM A;  4XY9 A;  3MB4 A;  3HME A;  4MR4 A;  5D3T A;  4YYM A;  5CGP A;  5CUA A;  3I3J A;  4Y03 A;  5BT4 A;  4LZ2 A;  3UVX A;  4HBY A;  5CQ6 A;  2RS9 B;  5D25 A;  4ALG A;  2LSP B;  4WHU A;  5AD3 A;  3U5M A;  4UIU A;  5FE5 A;  3Q2F A;  5IGM A;  5FE6 A;  3S92 A;  2RNW A;  4NUE A;  4O71 A;  4HXR A;  4HBX A;  5C87 A;  4QZS A;  5H1V A;  5KTU A;  2E3K A;  2KTB B;  4J0R A;  4KV1 A;  5I7X A;  5F1H A;  5LKU A;  4NQN A;  3UVW A;  5LKT A;  4J1P A;  4CLB A;  3AQA A;  4XY8 A;  3HMH A;  4NUC A;  4CUQ A;  5DFC A;  4O7A A;  4A9E A;  5CQ3 A;  4OGI A;  4YAT A;  5A85 A;  5E9Y A;  5E9I A;  2RFJ A;  5DYC A;  5DKC A;  4ZC9 A;  5I89 A;  3RCW A;  4O7B A;  5C8G A;  3JVM A;  4A9K A;  4NRA A;  2OUO A;  4MR3 A;  2I7K A;  5DY7 A;  1N72 A;  2I8N A;  2R0V A;  4A9M A;  5EGU A;  3HMF A;  3D7C A;  4HXK A;  3QZV A;  4BW1 A;  3U5L A;  5KU3 A;  3NXB A;  2WP1 A;  4MEP A;  4UIT A;  3LXJ A;  4HXO A;  4IR3 A;  5DX4 A;  3QZT A;  3UVY A;  3P1D A;  5F2P A;  4YBS A;  5HM0 A;  4QR3 A;  5CPE A;  4O75 A;  5CQ7 A;  5ENC A;  4KV4 A;  5LKX A;  5EWH A;  5FG4 A;  5DLZ A;  4IOQ A;  2RNX A;  4AKN A;  4CFL A;  3U5K A;  5FH6 A;  5H1U A;  4TZ2 A;  5E9L A;  4DON A;  2L85 A;  3SVG A;  5I7Y A;  5IGL A;  5IID A;  5CUC A;  5DFB A;  4NS5 A;  4QSP A;  2FSA A;  4LYW A;  5EPS A;  4A9I A;  3O36 A;  5FFV A;  5HEN A;  5CS8 A;  5F62 A;  5A82 A;  4IOR A;  4QY4 A;  5FB1 A;  5EWW A;  4N3W A;  4YH4 A;  4A9O A;  4TT4 A;  5ETB A;  5HQ7 A;  5LJ2 A;  4NXJ A;  5A83 A;  3AAD A;  5E7D A;  4LZS A;  4N4I A;  4QB3 A;  3IU6 A;  5EA1 A;  5F63 A;  5EPR A;  2YEK A;  5FE8 A;  4LDF A;  5E73 A;  5FFY A;  4LZR A;  5D3J A;  5FE2 A;  1E6I A;  4HBV A;  5FE4 A;  5KTX A;  4O7E A;  3O33 A;  4TQN A;  5E9M A;  5EP7 A;  3MXF A;  4LYI A;  5ENI A;  5I86 A;  4N4G A;  2DWW A;  5JI8 A;  5ENB A;  4IOO A;  4QSQ A;  2L84 A;  3LQI A;  2DVQ A;  4HXM A;  5EWC A;  4NR5 A;  5HFQ A;  2E7O A;  4OGJ A;  3U5J A;  2E7N A;  5EIC A;  5CQT A;  4CUP A;  4IR5 A;  4NQM A;  4QYD A;  5EWV A;  2DVR A;  4YYI A;  3QZS A;  5H1T A;  5DFD A;  5HQ6 A;  4QC1 A;  4UIZ A;  4BW2 A;  5FFW A;  5CY9 A;  2N9G A;  5H85 A;  4Z6I A;  5I88 A;  5EIS A;  5G4R A;  5HRX A;  5IGN A;  5II1 A;  5CU8 A;  5HLS A;  4UYH A;  4HXN A;  5IGK A;  4QEU A;  3ONI A;  4NR7 A;  4QUT A;  4YBM A;  4LC2 A;  4Z1Q A;  3IU5 A;  4QUU A;  4QC3 A;  4QR5 A;  5F5Z A;  5CRM A;  5FE3 A;  4CFK A;  5D7X A;  4UYF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...