2RNWA

The structural basis for site-specific lysine-acetylated histone recognition by the bromodomains of the human transcriptional co-activators pcaf and cbp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
GSHMSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/nuclear protein
molecule keywords Histone acetyltransferase PCAF
publication title Structural Basis of Site-Specific Histone Recognition by the Bromodomains of Human Coactivators PCAF and CBP/p300
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 118
sequence length 118
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2008-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2rnwA00
3U5OA 5EGUA 3UVWA 4QC3A 4QNSA 5K29A 5HLSA 3K2JA 4N4FA 4UYFA 4QR4A 5KTWA 5FFVA 5FH6A 3HMEA 4YY4A 5C8GA 1ZS5A 5A82A 5HRVA 2L85A 4O77A 4Z6IA 2YYNA 3D7CA 3HMFA 4YBTA 5CUGA 4Y03A 5DY7A 3JVKA 1F68A 1JM4B 2DVRA 5AMEA 5I29A 5EPSA 5ENFA 5IIDA 4HBYA 4LDFA 5D24A 2YW5A 4YAXA 5BT3A 4C67A 3U5PA 5F1HA 4TS8A 4Z6HA 4NUEA 4E96A 4LC2A 2YDWA 5CQ4A 5DBMA 4UYHA 2OSSA 4PTBA 5CQTA 4F3IA 5A5OA 5A5SA 4LZRA 3U5MA 5TCMA 3O33A 4CUPA 4BW4A 4BW3A 5KO4A 3IU6A 5EV9A 5KHMA 5CQ8A 5FB0A 5DFDA 4YYDA 5IGMA 4IOOA 4NR8A 3MXFA 5JWMA 3S91A 5ENEA 3P1EA 3G0JA 5C85A 4BJXA 1N72A 2GRCA 3G0LA 4NQMA 4TTEA 2DVVA 2YELA 4PKLA 5E9VA 5CQ5A 3NXBA 4QY4A 4QUUA 2D82A 4NR4A 2RO1A 2DATA 3U5LA 4NXJA 3LQIA 5IG6A 2F6JA 4OGJA 3U5JA 4YYIA 2H60A 3O37A 5H85A 2R0VA 3RCWA 4PCIA 3U5KA 5HENA 4KCXA 4MR3A 5LKZA 2RI7A 4PS5A 4YABA 4LYSA 5DFBA 4J3IA 4QSXA 5CS8A 4HBWA 3QZSA 5CRZA 5ENBA 4X2IA 3SVFA 4UIZA 3Q2FA 4N4GA 2N9GA 4O70A 5D25A 5HJCA 3SVHA 5E9KA 4HBXA 4C66A 4NUCA 5D3TA 5FE6A 4Q0OA 4QSRA 5FE2A 4BW1A 5LKUA 4NS5A 1EQFA 5IGNA 4XUBA 5EWCA 5E9IA 4CURA 4YYHA 4QSWA 3P1DA 5IBNA 5DW1A 4A9JA 5D3NA 3U5NA 4QYLA 5F63A 4ZQLA 5DLXA 5AD3A 5CPEA 4YH3A 5ETDA 5FG5A 5FH7A 5A83A 4TZ2A 4NR9A 4QSVA 4QR3A 5LKXA 3MQMA 5E73A 3GG3A 4UYGA 2L5EA 5ETBA 4QEUA 5DFCA 2DWWA 5LUUA 5FBXA 4UIXA 5CUCA 3O36A 4NYVA 5L98A 5EK9A 4QSSA 3MB3A 5HELA 4A9LA 4QR5A 5C87A 5I83A 5II1A 4YYMA 4LYWA 5L99A 2R0YA 5E7DA 4YADA 4GPJA 5FG6A 3O34A 5E3DA 5F25A 5JI8A 5FH8A 4UITA 5A5NA 5HQ7A 5ENHA 3ONIA 4XYAA 4KV1A 4J0RA 4UYEA 4WIVA 5ENJA 5A5QA 5ENIA 5H1UA 5HFQA 4QZSA 4HXKA 2D9EA 5EWHA 2YQDA 5F62A 2LSPB 3MULA 4XY9A 3QZTA 4YATA 5HM0A 4UIVA 5CRMA 4YBMA 5I80A 5CUBA 4OGIA 3DWYA 4QC1A 3LXJA 5EVAA 2R0SA 4O7BA 2YEKA 4MR5A 4UIWA 2R10A 4YK0A 5F2PA 3UV4A 5D3HA 5FE8A 4O75A 4NYXA 5L8UA 4A9EA 5F61A 3JVMA 5IGLA 5ENGA 5D3PA 5DYXA 3DAIA 3IU5A 5AD2A 4CUSA 4KV4A 4TT4A 4A9FA 5HRXA 5C89A 5J0DA 4YC9A 4HXNA 5CQ3A 5DKDA 3MUKA 4QBMA 3SVGA 5A81A 4TT2A 5KU3A 4YBSA 5FE3A 4MR6A 5EPBA 2WP2A 5E9LA 3P1CA 5DYUA 5CGPA 4LZ2A 4FLPA 4TU6A 4HBVA 5I89A 4DONA 5DYCA 4MEPA 5FFYA 5FE5A 1E6IA 4ZW1A 4J1PA 4CUQA 1X0JA 2FSAA 5E9MA 5EWVA 4HXSA 2DKWA 4NRCA 5D0CA 5DX4A 2DVQA 3UVDA 5A5RA 2E7OA 2KTBB 5EQ1A 4Z1QA 4AKNA 4NR5A 4QB3A 5I7YA 5CU8A 4IOQA 5HQ5A 5C7NA 5FB1A 5D7XA 5COIA 4QYDA 2G4AA 1JSPB 5BT5A 4WHWA 3P1FA 5CTLA 5E0RA 4UYFB 2L84A 3UVYA 5E3GA 5KTXA 5F60A 3AADA 4WHUA 1WUGA 4PY6A 5EWWA 5FDZA 5EM3A 5CUAA 5ENCA 5AMFA 1WUMA 4MENA 4NRAA 4A9MA 5EISA 4NR6A 5EWDA 5I88A 4N3WA 4UIUA 5G4RA 4Q0NA 2E3KA 4YYKA 4XUAA 2OUOA 4NQNA 4YY6A 4N4HA 5LJ1A 5F36A 3TLPA 5IGKA 5I1QA 5D26A 3FKMX 2RNXA 4MEOA 3UW9A 3S92A 5ACYA 5II2A 4HXRA 4UIYA 4CFLA 4A9HA 4MEQA 4NUDA 4O72A 3AQAA 5DW2A 4RVRA 5EA1A 4IR5A 5DKCA 4CUUA 4QSTA 4CFKA 5LJ2A 4O78A 4LR6A 4HXOA 3O35A 4A9NA 4NYWA 4O71A 4N4IA 5LJ0A 2RS9B 5L97A 4YYJA 5C4QA 4O74A 5HFRA 4TZ8A 5EU1A 5BT4A 4O76A 4ZC9A 3JVJA 4OUFA 5CUDA 2E7NA 5HEMA 4CL9A 4J0SA 5EPRA 4BW2A 4YH4A 5CQAA 4O7CA 3Q2EA 2WP1A 4A9KA 4QUTA 5E74A 4NR7A 5LVRA 2RNWA 2DVSA 5A5PA 5F3AA 3LQHA 4TQNA 5FE9A 4O7EA 4YYNA 4Z1SA 5CQ7A 5H1TA 5D3RA 5DLZA 4CUTA 5A7CA 5LVQA 2NXBA 5CUEA 5CFWA 5LKTA 4IR3A 5E9YA 5EICA 5CP5A 4PCEA 4IR6A 4QEVA 4A9OA 5FE4A 3ZYUA 5FE0A 5HCLA 4HXPA 4HXMA 2MJVB 2RFJA 4NRBA 5TB6A 5HRWA 3UVXA 3UV2A 4ALHA 5I7XA 5I40A 4ALGA 4QEWA 5I86A 5FG4A 4TU4A 2YEMA 4MR4A 4QSPA 5HQ6A 4IORA 5CY9A 4XY8A 5L96A 4QSUA 4YYGA 5CQ6A 3HMHA 4Z93A 5D3LA 2I7KA 5EP7A 5H1VA 3JVLA 5D3SA 5DYAA 4BHWA 3UV5A 5G4SA 4LRGA 3I3JA 4O7FA 4UYDA 5F1LA 2F6NA 5FE1A 4QSQA 5EI4A 5DKHA 2RNYA 2OO1A 3LQJA 4HXLA 5F5ZA 4CLBA 5A85A 4TT6A 5FE7A 3P5OA 4A9IA 3QZVA 4O7AA 4IR4A 5D3JA 3MB4A 4LZSA 5L8TA 5KTUA 2I8NA 5CZGA 4LYIA 3LJWA 4TYLA 5FFWA
chains in the Genus database with same CATH superfamily
4AKIA 3U5OA 5EGUA 3UVWA 4QC3A 4QNSA 5K29A 5HLSA 3K2JA 4N4FA 4UYFA 4QR4A 5KTWA 5FFVA 5FH6A 3HMEA 4YY4A 5C8GA 1ZS5A 3D1BA 5A82A 3VKHA 5HRVA 2L85A 4O77A 4Z6IA 2YYNA 3D7CA 3HMFA 4YBTA 5CUGA 4Y03A 5DY7A 3JVKA 1F68A 1JM4B 2DVRA 5AMEA 5I29A 5EPSA 5ENFA 5IIDA 4HBYA 4LDFA 5D24A 2YW5A 4YAXA 5BT3A 4C67A 3U5PA 5F1HA 4TS8A 4Z6HA 4NUEA 4E96A 4LC2A 2YDWA 5CQ4A 5DBMA 4UYHA 2OSSA 4PTBA 5CQTA 4F3IA 5A5OA 5A5SA 4AKGA 4LZRA 3U5MA 5TCMA 3O33A 4CUPA 4BW4A 4BW3A 5KO4A 3IU6A 5EV9A 5KHMA 5CQ8A 5FB0A 5DFDA 4YYDA 5IGMA 4AI6A 4IOOA 4NR8A 3MXFA 5JWMA 3S91A 5ENEA 3P1EA 3G0JA 5C85A 4BJXA 1N72A 2GRCA 3G0LA 4NQMA 4TTEA 1ZKRA 2DVVA 2YELA 4PKLA 5E9VA 5CQ5A 3NXBA 4QY4A 4QUUA 2D82A 4NR4A 2RO1A 2DATA 3U5LA 4NXJA 3LQIA 5IG6A 2F6JA 4OGJA 3U5JA 4YYIA 2H60A 3O37A 5H85A 2R0VA 3RCWA 4PCIA 3U5KA 5HENA 4KCXA 4MR3A 5LKZA 2RI7A 4PS5A 4YABA 4LYSA 5DFBA 4J3IA 4QSXA 5CS8A 4HBWA 3QZSA 5CRZA 5ENBA 4X2IA 3SVFA 4UIZA 3Q2FA 4N4GA 2N9GA 4O70A 5D25A 5HJCA 3SVHA 5E9KA 2EJNA 4HBXA 4C66A 4NUCA 5D3TA 5FE6A 4Q0OA 4QSRA 5FE2A 4BW1A 5LKUA 4NS5A 1EQFA 5IGNA 4XUBA 5EWCA 5E9IA 4CURA 4YYHA 4QSWA 3P1DA 5IBNA 5DW1A 4A9JA 5D3NA 3U5NA 4QYLA 5F63A 4ZQLA 5DLXA 5AD3A 5CPEA 4YH3A 5ETDA 5FG5A 5FH7A 5A83A 4TZ2A 4NR9A 4QSVA 4QR3A 5LKXA 3MQMA 5E73A 4UYGA 3GG3A 2L5EA 5ETBA 4QEUA 5DFCA 2DWWA 5LUUA 5FBXA 4UIXA 5CUCA 3O36A 4NYVA 5L98A 5EK9A 4QSSA 3MB3A 5HELA 4A9LA 4QR5A 5C87A 5I83A 5II1A 4YYMA 4LYWA 5L99A 2R0YA 5E7DA 4YADA 4GPJA 5FG6A 3O34A 5E3DA 5F25A 5JI8A 5FH8A 4UITA 5A5NA 5HQ7A 5ENHA 3ONIA 4XYAA 4KV1A 4J0RA 4UYEA 4WIVA 5ENJA 5A5QA 5ENIA 5H1UA 5HFQA 4QZSA 4HXKA 2D9EA 5EWHA 2YQDA 5F62A 2LSPB 3MULA 4XY9A 3QZTA 4YATA 5HM0A 4UIVA 5CRMA 4YBMA 5I80A 5CUBA 4OGIA 3DWYA 4QC1A 3LXJA 5EVAA 2R0SA 4O7BA 2YEKA 4MR5A 4UIWA 2R10A 4YK0A 5F2PA 3UV4A 5D3HA 5FE8A 4O75A 4NYXA 5L8UA 4A9EA 5F61A 3JVMA 5IGLA 5ENGA 5D3PA 5DYXA 3DAIA 3IU5A 5AD2A 4CUSA 4KV4A 4TT4A 4A9FA 5HRXA 5C89A 5J0DA 4YC9A 4HXNA 5CQ3A 5DKDA 3MUKA 4QBMA 3SVGA 5A81A 4TT2A 5KU3A 4YBSA 5FE3A 4MR6A 5EPBA 2WP2A 5E9LA 3P1CA 5DYUA 5CGPA 4LZ2A 4FLPA 4TU6A 4HBVA 5I89A 4DONA 5DYCA 4MEPA 5FFYA 5FE5A 1E6IA 4ZW1A 4J1PA 4CUQA 1X0JA 2FSAA 5E9MA 5EWVA 4HXSA 2DKWA 4NRCA 5D0CA 5DX4A 2DVQA 3UVDA 5A5RA 2E7OA 2KTBB 5EQ1A 4Z1QA 4AKNA 4NR5A 4QB3A 5I7YA 5CU8A 4IOQA 5HQ5A 5C7NA 5FB1A 5D7XA 5COIA 4QYDA 2G4AA 1JSPB 5BT5A 4WHWA 3P1FA 5CTLA 5E0RA 4UYFB 2L84A 3UVYA 5E3GA 5KTXA 5F60A 3AADA 4WHUA 1WUGA 4PY6A 5EWWA 5FDZA 5EM3A 5CUAA 5ENCA 5AMFA 1WUMA 4MENA 4NRAA 4A9MA 5EISA 4NR6A 5EWDA 5I88A 4N3WA 4UIUA 5G4RA 4Q0NA 2E3KA 4YYKA 4XUAA 2OUOA 4NQNA 4YY6A 4N4HA 5LJ1A 5F36A 3TLPA 5IGKA 5I1QA 4AKHA 5D26A 3FKMX 2RNXA 4MEOA 3UW9A 1PUOA 3S92A 5ACYA 5II2A 4HXRA 4UIYA 4CFLA 4A9HA 4MEQA 4NUDA 4O72A 3AQAA 5DW2A 4RVRA 5EA1A 4IR5A 5DKCA 4CUUA 4QSTA 4CFKA 5LJ2A 4O78A 4LR6A 4HXOA 3O35A 4A9NA 4NYWA 4O71A 4N4IA 5LJ0A 2RS9B 5L97A 4YYJA 5C4QA 4O74A 5HFRA 4TZ8A 5EU1A 5BT4A 4O76A 4ZC9A 3JVJA 4OUFA 5CUDA 2E7NA 5HEMA 4CL9A 4J0SA 5EPRA 4BW2A 4YH4A 5CQAA 4O7CA 3Q2EA 2WP1A 4A9KA 4QUTA 5E74A 4NR7A 5LVRA 2RNWA 2DVSA 5A5PA 5F3AA 3LQHA 4TQNA 3ERRA 5FE9A 4O7EA 4YYNA 4Z1SA 5CQ7A 5H1TA 5D3RA 5DLZA 4CUTA 5A7CA 5LVQA 2NXBA 5CUEA 5CFWA 5LKTA 4IR3A 5E9YA 5EICA 5CP5A 4PCEA 4IR6A 4QEVA 4A9OA 5FE4A 3ZYUA 5FE0A 5HCLA 3D1DA 4HXPA 4HXMA 2MJVB 2RFJA 4NRBA 5TB6A 5HRWA 3UVXA 3UV2A 4ALHA 5I7XA 5I40A 4ALGA 4QEWA 5I86A 5FG4A 4TU4A 2YEMA 4MR4A 4QSPA 5HQ6A 4IORA 5CY9A 4XY8A 5L96A 4QSUA 4YYGA 5CQ6A 3HMHA 4Z93A 5D3LA 2I7KA 5EP7A 5H1VA 3JVLA 5D3SA 5DYAA 4BHWA 3UV5A 5G4SA 4LRGA 3I3JA 4O7FA 4UYDA 5F1LA 2F6NA 5FE1A 4QSQA 5EI4A 5DKHA 2RNYA 2OO1A 3LQJA 3VKGA 4HXLA 5F5ZA 4CLBA 5A85A 4TT6A 5FE7A 3P5OA 4A9IA 3QZVA 4O7AA 4IR4A 5D3JA 3MB4A 4LZSA 5L8TA 5KTUA 2I8NA 5CZGA 4LYIA 3LJWA 4TYLA 5FFWA
chains in the Genus database with same CATH topology
3U5OA 5EGUA 3UVWA 4QC3A 4QNSA 5K29A 5HLSA 3K2JA 4N4FA 4UYFA 4QR4A 5KTWA 5FFVA 5FH6A 3HMEA 4YY4A 5C8GA 1ZS5A 5A82A 5HRVA 2L85A 4O77A 4Z6IA 2YYNA 3D7CA 3HMFA 4YBTA 5CUGA 4Y03A 5DY7A 3JVKA 1F68A 1JM4B 2DVRA 5AMEA 5I29A 5EPSA 5ENFA 5IIDA 4HBYA 4LDFA 5D24A 2YW5A 4YAXA 5BT3A 4C67A 3U5PA 5F1HA 4TS8A 4Z6HA 4NUEA 4E96A 4LC2A 2YDWA 5CQ4A 5DBMA 4UYHA 2OSSA 4PTBA 5CQTA 4F3IA 5A5OA 5A5SA 4LZRA 3U5MA 5TCMA 3O33A 4CUPA 4BW4A 4BW3A 5KO4A 3IU6A 5EV9A 5KHMA 5CQ8A 5FB0A 5DFDA 4YYDA 5IGMA 4IOOA 4NR8A 3MXFA 5JWMA 3S91A 5ENEA 3P1EA 3G0JA 5C85A 4BJXA 1N72A 2GRCA 3G0LA 4NQMA 4TTEA 2DVVA 2YELA 4PKLA 5E9VA 5CQ5A 3NXBA 4QY4A 4QUUA 2D82A 4NR4A 2RO1A 2DATA 3U5LA 4NXJA 3LQIA 5IG6A 2F6JA 4OGJA 3U5JA 4YYIA 2H60A 3O37A 5H85A 2R0VA 3RCWA 4PCIA 3U5KA 5HENA 4KCXA 4MR3A 5LKZA 2RI7A 4PS5A 4YABA 4LYSA 5DFBA 4J3IA 4QSXA 5CS8A 4HBWA 3QZSA 5CRZA 5ENBA 4X2IA 3SVFA 4UIZA 3Q2FA 4N4GA 2N9GA 4O70A 5D25A 5HJCA 3SVHA 5E9KA 4HBXA 4C66A 4NUCA 5D3TA 5FE6A 4Q0OA 4QSRA 5FE2A 4BW1A 5LKUA 4NS5A 1EQFA 5IGNA 4XUBA 5EWCA 5E9IA 4CURA 4YYHA 4QSWA 3P1DA 5IBNA 5DW1A 4A9JA 5D3NA 3U5NA 4QYLA 5F63A 4ZQLA 5DLXA 5AD3A 5CPEA 4YH3A 5ETDA 5FG5A 5FH7A 5A83A 4TZ2A 4NR9A 4QSVA 4QR3A 5LKXA 3MQMA 5E73A 3GG3A 4UYGA 2L5EA 5ETBA 4QEUA 5DFCA 2DWWA 5LUUA 5FBXA 4UIXA 5CUCA 3O36A 4NYVA 5L98A 5EK9A 4QSSA 3MB3A 5HELA 4A9LA 4QR5A 5C87A 5I83A 5II1A 4YYMA 4LYWA 5L99A 2R0YA 5E7DA 4YADA 4GPJA 5FG6A 3O34A 5E3DA 5F25A 5JI8A 5FH8A 4UITA 5A5NA 5HQ7A 5ENHA 3ONIA 4XYAA 4KV1A 4J0RA 4UYEA 4WIVA 5ENJA 5A5QA 5ENIA 5H1UA 5HFQA 4QZSA 4HXKA 2D9EA 5EWHA 2YQDA 5F62A 2LSPB 3MULA 4XY9A 3QZTA 4YATA 5HM0A 4UIVA 5CRMA 4YBMA 5I80A 5CUBA 4OGIA 3DWYA 4QC1A 3LXJA 5EVAA 2R0SA 4O7BA 2YEKA 4MR5A 4UIWA 2R10A 4YK0A 5F2PA 3UV4A 5D3HA 5FE8A 4O75A 4NYXA 5L8UA 4A9EA 5F61A 3JVMA 5IGLA 5ENGA 5D3PA 5DYXA 3DAIA 3IU5A 5AD2A 4CUSA 4KV4A 4TT4A 4A9FA 5HRXA 5C89A 5J0DA 4YC9A 4HXNA 5CQ3A 5DKDA 3MUKA 4QBMA 3SVGA 5A81A 4TT2A 5KU3A 4YBSA 5FE3A 4MR6A 5EPBA 2WP2A 5E9LA 3P1CA 5DYUA 5CGPA 4LZ2A 4FLPA 4TU6A 4HBVA 5I89A 4DONA 5DYCA 4MEPA 5FFYA 5FE5A 1E6IA 4ZW1A 4J1PA 4CUQA 1X0JA 2FSAA 5E9MA 5EWVA 4HXSA 2DKWA 4NRCA 5D0CA 5DX4A 2DVQA 3UVDA 5A5RA 2E7OA 2KTBB 5EQ1A 4Z1QA 4AKNA 4NR5A 4QB3A 5I7YA 5CU8A 4IOQA 5HQ5A 5C7NA 5FB1A 5D7XA 5COIA 4QYDA 2G4AA 1JSPB 5BT5A 4WHWA 3P1FA 5CTLA 5E0RA 4UYFB 2L84A 3UVYA 5E3GA 5KTXA 5F60A 3AADA 4WHUA 1WUGA 4PY6A 5EWWA 5FDZA 5EM3A 5CUAA 5ENCA 5AMFA 1WUMA 4MENA 4NRAA 4A9MA 5EISA 4NR6A 5EWDA 5I88A 4N3WA 4UIUA 5G4RA 4Q0NA 2E3KA 4YYKA 4XUAA 2OUOA 4NQNA 4YY6A 4N4HA 5LJ1A 5F36A 3TLPA 5IGKA 5I1QA 5D26A 3FKMX 2RNXA 4MEOA 3UW9A 3S92A 5ACYA 5II2A 4HXRA 4UIYA 4CFLA 4A9HA 4MEQA 4NUDA 4O72A 3AQAA 5DW2A 4RVRA 5EA1A 4IR5A 5DKCA 4CUUA 4QSTA 4CFKA 5LJ2A 4O78A 4LR6A 4HXOA 3O35A 4A9NA 4NYWA 4O71A 4N4IA 5LJ0A 2RS9B 5L97A 4YYJA 5C4QA 4O74A 5HFRA 4TZ8A 5EU1A 5BT4A 4O76A 4ZC9A 3JVJA 4OUFA 5CUDA 2E7NA 5HEMA 4CL9A 4J0SA 5EPRA 4BW2A 4YH4A 5CQAA 4O7CA 3Q2EA 2WP1A 4A9KA 4QUTA 5E74A 4NR7A 5LVRA 2RNWA 2DVSA 5A5PA 5F3AA 3LQHA 4TQNA 5FE9A 4O7EA 4YYNA 4Z1SA 5CQ7A 5H1TA 5D3RA 5DLZA 4CUTA 5A7CA 5LVQA 2NXBA 5CUEA 5CFWA 5LKTA 4IR3A 5E9YA 5EICA 5CP5A 4PCEA 4IR6A 4QEVA 4A9OA 5FE4A 3ZYUA 5FE0A 5HCLA 4HXPA 4HXMA 2MJVB 2RFJA 4NRBA 5TB6A 5HRWA 3UVXA 3UV2A 4ALHA 5I7XA 5I40A 4ALGA 4QEWA 5I86A 5FG4A 4TU4A 2YEMA 4MR4A 4QSPA 5HQ6A 4IORA 5CY9A 4XY8A 5L96A 4QSUA 4YYGA 5CQ6A 3HMHA 4Z93A 5D3LA 2I7KA 5EP7A 5H1VA 3JVLA 5D3SA 5DYAA 4BHWA 3UV5A 5G4SA 4LRGA 3I3JA 4O7FA 4UYDA 5F1LA 2F6NA 5FE1A 4QSQA 5EI4A 5DKHA 2RNYA 2OO1A 3LQJA 4HXLA 5F5ZA 4CLBA 5A85A 4TT6A 5FE7A 3P5OA 4A9IA 3QZVA 4O7AA 4IR4A 5D3JA 3MB4A 4LZSA 5L8TA 5KTUA 2I8NA 5CZGA 4LYIA 3LJWA 4TYLA 5FFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5O A;  5EGU A;  3UVW A;  4QC3 A;  4QNS A;  5K29 A;  5HLS A;  3K2J A;  4N4F A;  4UYF A;  4QR4 A;  5KTW A;  5FFV A;  5FH6 A;  3HME A;  4YY4 A;  5C8G A;  1ZS5 A;  5A82 A;  5HRV A;  2L85 A;  4O77 A;  4Z6I A;  2YYN A;  3D7C A;  3HMF A;  4YBT A;  5CUG A;  4Y03 A;  5DY7 A;  3JVK A;  1F68 A;  1JM4 B;  2DVR A;  5AME A;  5I29 A;  5EPS A;  5ENF A;  5IID A;  4HBY A;  4LDF A;  5D24 A;  2YW5 A;  4YAX A;  5BT3 A;  4C67 A;  3U5P A;  5F1H A;  4TS8 A;  4Z6H A;  4NUE A;  4E96 A;  4LC2 A;  2YDW A;  5CQ4 A;  5DBM A;  4UYH A;  2OSS A;  4PTB A;  5CQT A;  4F3I A;  5A5O A;  5A5S A;  4LZR A;  3U5M A;  5TCM A;  3O33 A;  4CUP A;  4BW4 A;  4BW3 A;  5KO4 A;  3IU6 A;  5EV9 A;  5KHM A;  5CQ8 A;  5FB0 A;  5DFD A;  4YYD A;  5IGM A;  4IOO A;  4NR8 A;  3MXF A;  5JWM A;  3S91 A;  5ENE A;  3P1E A;  3G0J A;  5C85 A;  4BJX A;  1N72 A;  2GRC A;  3G0L A;  4NQM A;  4TTE A;  2DVV A;  2YEL A;  4PKL A;  5E9V A;  5CQ5 A;  3NXB A;  4QY4 A;  4QUU A;  2D82 A;  4NR4 A;  2RO1 A;  2DAT A;  3U5L A;  4NXJ A;  3LQI A;  5IG6 A;  2F6J A;  4OGJ A;  3U5J A;  4YYI A;  2H60 A;  3O37 A;  5H85 A;  2R0V A;  3RCW A;  4PCI A;  3U5K A;  5HEN A;  4KCX A;  4MR3 A;  5LKZ A;  2RI7 A;  4PS5 A;  4YAB A;  4LYS A;  5DFB A;  4J3I A;  4QSX A;  5CS8 A;  4HBW A;  3QZS A;  5CRZ A;  5ENB A;  4X2I A;  3SVF A;  4UIZ A;  3Q2F A;  4N4G A;  2N9G A;  4O70 A;  5D25 A;  5HJC A;  3SVH A;  5E9K A;  4HBX A;  4C66 A;  4NUC A;  5D3T A;  5FE6 A;  4Q0O A;  4QSR A;  5FE2 A;  4BW1 A;  5LKU A;  4NS5 A;  1EQF A;  5IGN A;  4XUB A;  5EWC A;  5E9I A;  4CUR A;  4YYH A;  4QSW A;  3P1D A;  5IBN A;  5DW1 A;  4A9J A;  5D3N A;  3U5N A;  4QYL A;  5F63 A;  4ZQL A;  5DLX A;  5AD3 A;  5CPE A;  4YH3 A;  5ETD A;  5FG5 A;  5FH7 A;  5A83 A;  4TZ2 A;  4NR9 A;  4QSV A;  4QR3 A;  5LKX A;  3MQM A;  5E73 A;  3GG3 A;  4UYG A;  2L5E A;  5ETB A;  4QEU A;  5DFC A;  2DWW A;  5LUU A;  5FBX A;  4UIX A;  5CUC A;  3O36 A;  4NYV A;  5L98 A;  5EK9 A;  4QSS A;  3MB3 A;  5HEL A;  4A9L A;  4QR5 A;  5C87 A;  5I83 A;  5II1 A;  4YYM A;  4LYW A;  5L99 A;  2R0Y A;  5E7D A;  4YAD A;  4GPJ A;  5FG6 A;  3O34 A;  5E3D A;  5F25 A;  5JI8 A;  5FH8 A;  4UIT A;  5A5N A;  5HQ7 A;  5ENH A;  3ONI A;  4XYA A;  4KV1 A;  4J0R A;  4UYE A;  4WIV A;  5ENJ A;  5A5Q A;  5ENI A;  5H1U A;  5HFQ A;  4QZS A;  4HXK A;  2D9E A;  5EWH A;  2YQD A;  5F62 A;  2LSP B;  3MUL A;  4XY9 A;  3QZT A;  4YAT A;  5HM0 A;  4UIV A;  5CRM A;  4YBM A;  5I80 A;  5CUB A;  4OGI A;  3DWY A;  4QC1 A;  3LXJ A;  5EVA A;  2R0S A;  4O7B A;  2YEK A;  4MR5 A;  4UIW A;  2R10 A;  4YK0 A;  5F2P A;  3UV4 A;  5D3H A;  5FE8 A;  4O75 A;  4NYX A;  5L8U A;  4A9E A;  5F61 A;  3JVM A;  5IGL A;  5ENG A;  5D3P A;  5DYX A;  3DAI A;  3IU5 A;  5AD2 A;  4CUS A;  4KV4 A;  4TT4 A;  4A9F A;  5HRX A;  5C89 A;  5J0D A;  4YC9 A;  4HXN A;  5CQ3 A;  5DKD A;  3MUK A;  4QBM A;  3SVG A;  5A81 A;  4TT2 A;  5KU3 A;  4YBS A;  5FE3 A;  4MR6 A;  5EPB A;  2WP2 A;  5E9L A;  3P1C A;  5DYU A;  5CGP A;  4LZ2 A;  4FLP A;  4TU6 A;  4HBV A;  5I89 A;  4DON A;  5DYC A;  4MEP A;  5FFY A;  5FE5 A;  1E6I A;  4ZW1 A;  4J1P A;  4CUQ A;  1X0J A;  2FSA A;  5E9M A;  5EWV A;  4HXS A;  2DKW A;  4NRC A;  5D0C A;  5DX4 A;  2DVQ A;  3UVD A;  5A5R A;  2E7O A;  2KTB B;  5EQ1 A;  4Z1Q A;  4AKN A;  4NR5 A;  4QB3 A;  5I7Y A;  5CU8 A;  4IOQ A;  5HQ5 A;  5C7N A;  5FB1 A;  5D7X A;  5COI A;  4QYD A;  2G4A A;  1JSP B;  5BT5 A;  4WHW A;  3P1F A;  5CTL A;  5E0R A;  4UYF B;  2L84 A;  3UVY A;  5E3G A;  5KTX A;  5F60 A;  3AAD A;  4WHU A;  1WUG A;  4PY6 A;  5EWW A;  5FDZ A;  5EM3 A;  5CUA A;  5ENC A;  5AMF A;  1WUM A;  4MEN A;  4NRA A;  4A9M A;  5EIS A;  4NR6 A;  5EWD A;  5I88 A;  4N3W A;  4UIU A;  5G4R A;  4Q0N A;  2E3K A;  4YYK A;  4XUA A;  2OUO A;  4NQN A;  4YY6 A;  4N4H A;  5LJ1 A;  5F36 A;  3TLP A;  5IGK A;  5I1Q A;  5D26 A;  3FKM X;  2RNX A;  4MEO A;  3UW9 A;  3S92 A;  5ACY A;  5II2 A;  4HXR A;  4UIY A;  4CFL A;  4A9H A;  4MEQ A;  4NUD A;  4O72 A;  3AQA A;  5DW2 A;  4RVR A;  5EA1 A;  4IR5 A;  5DKC A;  4CUU A;  4QST A;  4CFK A;  5LJ2 A;  4O78 A;  4LR6 A;  4HXO A;  3O35 A;  4A9N A;  4NYW A;  4O71 A;  4N4I A;  5LJ0 A;  2RS9 B;  5L97 A;  4YYJ A;  5C4Q A;  4O74 A;  5HFR A;  4TZ8 A;  5EU1 A;  5BT4 A;  4O76 A;  4ZC9 A;  3JVJ A;  4OUF A;  5CUD A;  2E7N A;  5HEM A;  4CL9 A;  4J0S A;  5EPR A;  4BW2 A;  4YH4 A;  5CQA A;  4O7C A;  3Q2E A;  2WP1 A;  4A9K A;  4QUT A;  5E74 A;  4NR7 A;  5LVR A;  2RNW A;  2DVS A;  5A5P A;  5F3A A;  3LQH A;  4TQN A;  5FE9 A;  4O7E A;  4YYN A;  4Z1S A;  5CQ7 A;  5H1T A;  5D3R A;  5DLZ A;  4CUT A;  5A7C A;  5LVQ A;  2NXB A;  5CUE A;  5CFW A;  5LKT A;  4IR3 A;  5E9Y A;  5EIC A;  5CP5 A;  4PCE A;  4IR6 A;  4QEV A;  4A9O A;  5FE4 A;  3ZYU A;  5FE0 A;  5HCL A;  4HXP A;  4HXM A;  2MJV B;  2RFJ A;  4NRB A;  5TB6 A;  5HRW A;  3UVX A;  3UV2 A;  4ALH A;  5I7X A;  5I40 A;  4ALG A;  4QEW A;  5I86 A;  5FG4 A;  4TU4 A;  2YEM A;  4MR4 A;  4QSP A;  5HQ6 A;  4IOR A;  5CY9 A;  4XY8 A;  5L96 A;  4QSU A;  4YYG A;  5CQ6 A;  3HMH A;  4Z93 A;  5D3L A;  2I7K A;  5EP7 A;  5H1V A;  3JVL A;  5D3S A;  5DYA A;  4BHW A;  3UV5 A;  5G4S A;  4LRG A;  3I3J A;  4O7F A;  4UYD A;  5F1L A;  2F6N A;  5FE1 A;  4QSQ A;  5EI4 A;  5DKH A;  2RNY A;  2OO1 A;  3LQJ A;  4HXL A;  5F5Z A;  4CLB A;  5A85 A;  4TT6 A;  5FE7 A;  3P5O A;  4A9I A;  3QZV A;  4O7A A;  4IR4 A;  5D3J A;  3MB4 A;  4LZS A;  5L8T A;  5KTU A;  2I8N A;  5CZG A;  4LYI A;  3LJW A;  4TYL A;  5FFW A; 
#chains in the Genus database with same CATH topology
 4AKI A;  3U5O A;  5EGU A;  3UVW A;  4QC3 A;  4QNS A;  5K29 A;  5HLS A;  3K2J A;  4N4F A;  4UYF A;  4QR4 A;  5KTW A;  5FFV A;  5FH6 A;  3HME A;  4YY4 A;  5C8G A;  1ZS5 A;  3D1B A;  5A82 A;  3VKH A;  5HRV A;  2L85 A;  4O77 A;  4Z6I A;  2YYN A;  3D7C A;  3HMF A;  4YBT A;  5CUG A;  4Y03 A;  5DY7 A;  3JVK A;  1F68 A;  1JM4 B;  2DVR A;  5AME A;  5I29 A;  5EPS A;  5ENF A;  5IID A;  4HBY A;  4LDF A;  5D24 A;  2YW5 A;  4YAX A;  5BT3 A;  4C67 A;  3U5P A;  5F1H A;  4TS8 A;  4Z6H A;  4NUE A;  4E96 A;  4LC2 A;  2YDW A;  5CQ4 A;  5DBM A;  4UYH A;  2OSS A;  4PTB A;  5CQT A;  4F3I A;  5A5O A;  5A5S A;  4AKG A;  4LZR A;  3U5M A;  5TCM A;  3O33 A;  4CUP A;  4BW4 A;  4BW3 A;  5KO4 A;  3IU6 A;  5EV9 A;  5KHM A;  5CQ8 A;  5FB0 A;  5DFD A;  4YYD A;  5IGM A;  4AI6 A;  4IOO A;  4NR8 A;  3MXF A;  5JWM A;  3S91 A;  5ENE A;  3P1E A;  3G0J A;  5C85 A;  4BJX A;  1N72 A;  2GRC A;  3G0L A;  4NQM A;  4TTE A;  1ZKR A;  2DVV A;  2YEL A;  4PKL A;  5E9V A;  5CQ5 A;  3NXB A;  4QY4 A;  4QUU A;  2D82 A;  4NR4 A;  2RO1 A;  2DAT A;  3U5L A;  4NXJ A;  3LQI A;  5IG6 A;  2F6J A;  4OGJ A;  3U5J A;  4YYI A;  2H60 A;  3O37 A;  5H85 A;  2R0V A;  3RCW A;  4PCI A;  3U5K A;  5HEN A;  4KCX A;  4MR3 A;  5LKZ A;  2RI7 A;  4PS5 A;  4YAB A;  4LYS A;  5DFB A;  4J3I A;  4QSX A;  5CS8 A;  4HBW A;  3QZS A;  5CRZ A;  5ENB A;  4X2I A;  3SVF A;  4UIZ A;  3Q2F A;  4N4G A;  2N9G A;  4O70 A;  5D25 A;  5HJC A;  3SVH A;  5E9K A;  2EJN A;  4HBX A;  4C66 A;  4NUC A;  5D3T A;  5FE6 A;  4Q0O A;  4QSR A;  5FE2 A;  4BW1 A;  5LKU A;  4NS5 A;  1EQF A;  5IGN A;  4XUB A;  5EWC A;  5E9I A;  4CUR A;  4YYH A;  4QSW A;  3P1D A;  5IBN A;  5DW1 A;  4A9J A;  5D3N A;  3U5N A;  4QYL A;  5F63 A;  4ZQL A;  5DLX A;  5AD3 A;  5CPE A;  4YH3 A;  5ETD A;  5FG5 A;  5FH7 A;  5A83 A;  4TZ2 A;  4NR9 A;  4QSV A;  4QR3 A;  5LKX A;  3MQM A;  5E73 A;  4UYG A;  3GG3 A;  2L5E A;  5ETB A;  4QEU A;  5DFC A;  2DWW A;  5LUU A;  5FBX A;  4UIX A;  5CUC A;  3O36 A;  4NYV A;  5L98 A;  5EK9 A;  4QSS A;  3MB3 A;  5HEL A;  4A9L A;  4QR5 A;  5C87 A;  5I83 A;  5II1 A;  4YYM A;  4LYW A;  5L99 A;  2R0Y A;  5E7D A;  4YAD A;  4GPJ A;  5FG6 A;  3O34 A;  5E3D A;  5F25 A;  5JI8 A;  5FH8 A;  4UIT A;  5A5N A;  5HQ7 A;  5ENH A;  3ONI A;  4XYA A;  4KV1 A;  4J0R A;  4UYE A;  4WIV A;  5ENJ A;  5A5Q A;  5ENI A;  5H1U A;  5HFQ A;  4QZS A;  4HXK A;  2D9E A;  5EWH A;  2YQD A;  5F62 A;  2LSP B;  3MUL A;  4XY9 A;  3QZT A;  4YAT A;  5HM0 A;  4UIV A;  5CRM A;  4YBM A;  5I80 A;  5CUB A;  4OGI A;  3DWY A;  4QC1 A;  3LXJ A;  5EVA A;  2R0S A;  4O7B A;  2YEK A;  4MR5 A;  4UIW A;  2R10 A;  4YK0 A;  5F2P A;  3UV4 A;  5D3H A;  5FE8 A;  4O75 A;  4NYX A;  5L8U A;  4A9E A;  5F61 A;  3JVM A;  5IGL A;  5ENG A;  5D3P A;  5DYX A;  3DAI A;  3IU5 A;  5AD2 A;  4CUS A;  4KV4 A;  4TT4 A;  4A9F A;  5HRX A;  5C89 A;  5J0D A;  4YC9 A;  4HXN A;  5CQ3 A;  5DKD A;  3MUK A;  4QBM A;  3SVG A;  5A81 A;  4TT2 A;  5KU3 A;  4YBS A;  5FE3 A;  4MR6 A;  5EPB A;  2WP2 A;  5E9L A;  3P1C A;  5DYU A;  5CGP A;  4LZ2 A;  4FLP A;  4TU6 A;  4HBV A;  5I89 A;  4DON A;  5DYC A;  4MEP A;  5FFY A;  5FE5 A;  1E6I A;  4ZW1 A;  4J1P A;  4CUQ A;  1X0J A;  2FSA A;  5E9M A;  5EWV A;  4HXS A;  2DKW A;  4NRC A;  5D0C A;  5DX4 A;  2DVQ A;  3UVD A;  5A5R A;  2E7O A;  2KTB B;  5EQ1 A;  4Z1Q A;  4AKN A;  4NR5 A;  4QB3 A;  5I7Y A;  5CU8 A;  4IOQ A;  5HQ5 A;  5C7N A;  5FB1 A;  5D7X A;  5COI A;  4QYD A;  2G4A A;  1JSP B;  5BT5 A;  4WHW A;  3P1F A;  5CTL A;  5E0R A;  4UYF B;  2L84 A;  3UVY A;  5E3G A;  5KTX A;  5F60 A;  3AAD A;  4WHU A;  1WUG A;  4PY6 A;  5EWW A;  5FDZ A;  5EM3 A;  5CUA A;  5ENC A;  5AMF A;  1WUM A;  4MEN A;  4NRA A;  4A9M A;  5EIS A;  4NR6 A;  5EWD A;  5I88 A;  4N3W A;  4UIU A;  5G4R A;  4Q0N A;  2E3K A;  4YYK A;  4XUA A;  2OUO A;  4NQN A;  4YY6 A;  4N4H A;  5LJ1 A;  5F36 A;  3TLP A;  5IGK A;  5I1Q A;  4AKH A;  5D26 A;  3FKM X;  2RNX A;  4MEO A;  3UW9 A;  1PUO A;  3S92 A;  5ACY A;  5II2 A;  4HXR A;  4UIY A;  4CFL A;  4A9H A;  4MEQ A;  4NUD A;  4O72 A;  3AQA A;  5DW2 A;  4RVR A;  5EA1 A;  4IR5 A;  5DKC A;  4CUU A;  4QST A;  4CFK A;  5LJ2 A;  4O78 A;  4LR6 A;  4HXO A;  3O35 A;  4A9N A;  4NYW A;  4O71 A;  4N4I A;  5LJ0 A;  2RS9 B;  5L97 A;  4YYJ A;  5C4Q A;  4O74 A;  5HFR A;  4TZ8 A;  5EU1 A;  5BT4 A;  4O76 A;  4ZC9 A;  3JVJ A;  4OUF A;  5CUD A;  2E7N A;  5HEM A;  4CL9 A;  4J0S A;  5EPR A;  4BW2 A;  4YH4 A;  5CQA A;  4O7C A;  3Q2E A;  2WP1 A;  4A9K A;  4QUT A;  5E74 A;  4NR7 A;  5LVR A;  2RNW A;  2DVS A;  5A5P A;  5F3A A;  3LQH A;  4TQN A;  3ERR A;  5FE9 A;  4O7E A;  4YYN A;  4Z1S A;  5CQ7 A;  5H1T A;  5D3R A;  5DLZ A;  4CUT A;  5A7C A;  5LVQ A;  2NXB A;  5CUE A;  5CFW A;  5LKT A;  4IR3 A;  5E9Y A;  5EIC A;  5CP5 A;  4PCE A;  4IR6 A;  4QEV A;  4A9O A;  5FE4 A;  3ZYU A;  5FE0 A;  5HCL A;  3D1D A;  4HXP A;  4HXM A;  2MJV B;  2RFJ A;  4NRB A;  5TB6 A;  5HRW A;  3UVX A;  3UV2 A;  4ALH A;  5I7X A;  5I40 A;  4ALG A;  4QEW A;  5I86 A;  5FG4 A;  4TU4 A;  2YEM A;  4MR4 A;  4QSP A;  5HQ6 A;  4IOR A;  5CY9 A;  4XY8 A;  5L96 A;  4QSU A;  4YYG A;  5CQ6 A;  3HMH A;  4Z93 A;  5D3L A;  2I7K A;  5EP7 A;  5H1V A;  3JVL A;  5D3S A;  5DYA A;  4BHW A;  3UV5 A;  5G4S A;  4LRG A;  3I3J A;  4O7F A;  4UYD A;  5F1L A;  2F6N A;  5FE1 A;  4QSQ A;  5EI4 A;  5DKH A;  2RNY A;  2OO1 A;  3LQJ A;  3VKG A;  4HXL A;  5F5Z A;  4CLB A;  5A85 A;  4TT6 A;  5FE7 A;  3P5O A;  4A9I A;  3QZV A;  4O7A A;  4IR4 A;  5D3J A;  3MB4 A;  4LZS A;  5L8T A;  5KTU A;  2I8N A;  5CZG A;  4LYI A;  3LJW A;  4TYL A;  5FFW A; 
#chains in the Genus database with same CATH homology
 3U5O A;  5EGU A;  3UVW A;  4QC3 A;  4QNS A;  5K29 A;  5HLS A;  3K2J A;  4N4F A;  4UYF A;  4QR4 A;  5KTW A;  5FFV A;  5FH6 A;  3HME A;  4YY4 A;  5C8G A;  1ZS5 A;  5A82 A;  5HRV A;  2L85 A;  4O77 A;  4Z6I A;  2YYN A;  3D7C A;  3HMF A;  4YBT A;  5CUG A;  4Y03 A;  5DY7 A;  3JVK A;  1F68 A;  1JM4 B;  2DVR A;  5AME A;  5I29 A;  5EPS A;  5ENF A;  5IID A;  4HBY A;  4LDF A;  5D24 A;  2YW5 A;  4YAX A;  5BT3 A;  4C67 A;  3U5P A;  5F1H A;  4TS8 A;  4Z6H A;  4NUE A;  4E96 A;  4LC2 A;  2YDW A;  5CQ4 A;  5DBM A;  4UYH A;  2OSS A;  4PTB A;  5CQT A;  4F3I A;  5A5O A;  5A5S A;  4LZR A;  3U5M A;  5TCM A;  3O33 A;  4CUP A;  4BW4 A;  4BW3 A;  5KO4 A;  3IU6 A;  5EV9 A;  5KHM A;  5CQ8 A;  5FB0 A;  5DFD A;  4YYD A;  5IGM A;  4IOO A;  4NR8 A;  3MXF A;  5JWM A;  3S91 A;  5ENE A;  3P1E A;  3G0J A;  5C85 A;  4BJX A;  1N72 A;  2GRC A;  3G0L A;  4NQM A;  4TTE A;  2DVV A;  2YEL A;  4PKL A;  5E9V A;  5CQ5 A;  3NXB A;  4QY4 A;  4QUU A;  2D82 A;  4NR4 A;  2RO1 A;  2DAT A;  3U5L A;  4NXJ A;  3LQI A;  5IG6 A;  2F6J A;  4OGJ A;  3U5J A;  4YYI A;  2H60 A;  3O37 A;  5H85 A;  2R0V A;  3RCW A;  4PCI A;  3U5K A;  5HEN A;  4KCX A;  4MR3 A;  5LKZ A;  2RI7 A;  4PS5 A;  4YAB A;  4LYS A;  5DFB A;  4J3I A;  4QSX A;  5CS8 A;  4HBW A;  3QZS A;  5CRZ A;  5ENB A;  4X2I A;  3SVF A;  4UIZ A;  3Q2F A;  4N4G A;  2N9G A;  4O70 A;  5D25 A;  5HJC A;  3SVH A;  5E9K A;  4HBX A;  4C66 A;  4NUC A;  5D3T A;  5FE6 A;  4Q0O A;  4QSR A;  5FE2 A;  4BW1 A;  5LKU A;  4NS5 A;  1EQF A;  5IGN A;  4XUB A;  5EWC A;  5E9I A;  4CUR A;  4YYH A;  4QSW A;  3P1D A;  5IBN A;  5DW1 A;  4A9J A;  5D3N A;  3U5N A;  4QYL A;  5F63 A;  4ZQL A;  5DLX A;  5AD3 A;  5CPE A;  4YH3 A;  5ETD A;  5FG5 A;  5FH7 A;  5A83 A;  4TZ2 A;  4NR9 A;  4QSV A;  4QR3 A;  5LKX A;  3MQM A;  5E73 A;  3GG3 A;  4UYG A;  2L5E A;  5ETB A;  4QEU A;  5DFC A;  2DWW A;  5LUU A;  5FBX A;  4UIX A;  5CUC A;  3O36 A;  4NYV A;  5L98 A;  5EK9 A;  4QSS A;  3MB3 A;  5HEL A;  4A9L A;  4QR5 A;  5C87 A;  5I83 A;  5II1 A;  4YYM A;  4LYW A;  5L99 A;  2R0Y A;  5E7D A;  4YAD A;  4GPJ A;  5FG6 A;  3O34 A;  5E3D A;  5F25 A;  5JI8 A;  5FH8 A;  4UIT A;  5A5N A;  5HQ7 A;  5ENH A;  3ONI A;  4XYA A;  4KV1 A;  4J0R A;  4UYE A;  4WIV A;  5ENJ A;  5A5Q A;  5ENI A;  5H1U A;  5HFQ A;  4QZS A;  4HXK A;  2D9E A;  5EWH A;  2YQD A;  5F62 A;  2LSP B;  3MUL A;  4XY9 A;  3QZT A;  4YAT A;  5HM0 A;  4UIV A;  5CRM A;  4YBM A;  5I80 A;  5CUB A;  4OGI A;  3DWY A;  4QC1 A;  3LXJ A;  5EVA A;  2R0S A;  4O7B A;  2YEK A;  4MR5 A;  4UIW A;  2R10 A;  4YK0 A;  5F2P A;  3UV4 A;  5D3H A;  5FE8 A;  4O75 A;  4NYX A;  5L8U A;  4A9E A;  5F61 A;  3JVM A;  5IGL A;  5ENG A;  5D3P A;  5DYX A;  3DAI A;  3IU5 A;  5AD2 A;  4CUS A;  4KV4 A;  4TT4 A;  4A9F A;  5HRX A;  5C89 A;  5J0D A;  4YC9 A;  4HXN A;  5CQ3 A;  5DKD A;  3MUK A;  4QBM A;  3SVG A;  5A81 A;  4TT2 A;  5KU3 A;  4YBS A;  5FE3 A;  4MR6 A;  5EPB A;  2WP2 A;  5E9L A;  3P1C A;  5DYU A;  5CGP A;  4LZ2 A;  4FLP A;  4TU6 A;  4HBV A;  5I89 A;  4DON A;  5DYC A;  4MEP A;  5FFY A;  5FE5 A;  1E6I A;  4ZW1 A;  4J1P A;  4CUQ A;  1X0J A;  2FSA A;  5E9M A;  5EWV A;  4HXS A;  2DKW A;  4NRC A;  5D0C A;  5DX4 A;  2DVQ A;  3UVD A;  5A5R A;  2E7O A;  2KTB B;  5EQ1 A;  4Z1Q A;  4AKN A;  4NR5 A;  4QB3 A;  5I7Y A;  5CU8 A;  4IOQ A;  5HQ5 A;  5C7N A;  5FB1 A;  5D7X A;  5COI A;  4QYD A;  2G4A A;  1JSP B;  5BT5 A;  4WHW A;  3P1F A;  5CTL A;  5E0R A;  4UYF B;  2L84 A;  3UVY A;  5E3G A;  5KTX A;  5F60 A;  3AAD A;  4WHU A;  1WUG A;  4PY6 A;  5EWW A;  5FDZ A;  5EM3 A;  5CUA A;  5ENC A;  5AMF A;  1WUM A;  4MEN A;  4NRA A;  4A9M A;  5EIS A;  4NR6 A;  5EWD A;  5I88 A;  4N3W A;  4UIU A;  5G4R A;  4Q0N A;  2E3K A;  4YYK A;  4XUA A;  2OUO A;  4NQN A;  4YY6 A;  4N4H A;  5LJ1 A;  5F36 A;  3TLP A;  5IGK A;  5I1Q A;  5D26 A;  3FKM X;  2RNX A;  4MEO A;  3UW9 A;  3S92 A;  5ACY A;  5II2 A;  4HXR A;  4UIY A;  4CFL A;  4A9H A;  4MEQ A;  4NUD A;  4O72 A;  3AQA A;  5DW2 A;  4RVR A;  5EA1 A;  4IR5 A;  5DKC A;  4CUU A;  4QST A;  4CFK A;  5LJ2 A;  4O78 A;  4LR6 A;  4HXO A;  3O35 A;  4A9N A;  4NYW A;  4O71 A;  4N4I A;  5LJ0 A;  2RS9 B;  5L97 A;  4YYJ A;  5C4Q A;  4O74 A;  5HFR A;  4TZ8 A;  5EU1 A;  5BT4 A;  4O76 A;  4ZC9 A;  3JVJ A;  4OUF A;  5CUD A;  2E7N A;  5HEM A;  4CL9 A;  4J0S A;  5EPR A;  4BW2 A;  4YH4 A;  5CQA A;  4O7C A;  3Q2E A;  2WP1 A;  4A9K A;  4QUT A;  5E74 A;  4NR7 A;  5LVR A;  2RNW A;  2DVS A;  5A5P A;  5F3A A;  3LQH A;  4TQN A;  5FE9 A;  4O7E A;  4YYN A;  4Z1S A;  5CQ7 A;  5H1T A;  5D3R A;  5DLZ A;  4CUT A;  5A7C A;  5LVQ A;  2NXB A;  5CUE A;  5CFW A;  5LKT A;  4IR3 A;  5E9Y A;  5EIC A;  5CP5 A;  4PCE A;  4IR6 A;  4QEV A;  4A9O A;  5FE4 A;  3ZYU A;  5FE0 A;  5HCL A;  4HXP A;  4HXM A;  2MJV B;  2RFJ A;  4NRB A;  5TB6 A;  5HRW A;  3UVX A;  3UV2 A;  4ALH A;  5I7X A;  5I40 A;  4ALG A;  4QEW A;  5I86 A;  5FG4 A;  4TU4 A;  2YEM A;  4MR4 A;  4QSP A;  5HQ6 A;  4IOR A;  5CY9 A;  4XY8 A;  5L96 A;  4QSU A;  4YYG A;  5CQ6 A;  3HMH A;  4Z93 A;  5D3L A;  2I7K A;  5EP7 A;  5H1V A;  3JVL A;  5D3S A;  5DYA A;  4BHW A;  3UV5 A;  5G4S A;  4LRG A;  3I3J A;  4O7F A;  4UYD A;  5F1L A;  2F6N A;  5FE1 A;  4QSQ A;  5EI4 A;  5DKH A;  2RNY A;  2OO1 A;  3LQJ A;  4HXL A;  5F5Z A;  4CLB A;  5A85 A;  4TT6 A;  5FE7 A;  3P5O A;  4A9I A;  3QZV A;  4O7A A;  4IR4 A;  5D3J A;  3MB4 A;  4LZS A;  5L8T A;  5KTU A;  2I8N A;  5CZG A;  4LYI A;  3LJW A;  4TYL A;  5FFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...