4LR6A

Structure of brd4 bromodomain 1 with a 3-methyl-4-phenylisoxazol-5-amine fragment
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
125
structure length
125
Chain Sequence
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/inhibitor
molecule keywords Bromodomain-containing protein 4
publication title Discovery, Design, and Optimization of Isoxazole Azepine BET Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4lr6A01
4UIWA 5H85A 5II1A 4N3WA 3SVHA 5DKDA 3JVJA 4BJXA 4YY4A 2LSPB 3U5MA 5DFDA 4BHWA 5II2A 3DAIA 3MB4A 5FH8A 4QSRA 5EICA 4OGJA 3U5PA 4YYMA 5FBXA 4NRAA 5EP7A 3MUKA 5EA1A 5ENJA 5E9KA 5E9YA 5LVRA 4UIUA 4ZC9A 3S91A 4IR6A 5I7YA 5HFRA 4YAXA 5CRZA 4BW3A 4NQNA 4A9MA 5FH6A 5A7CA 5HLSA 4MEPA 5D3NA 5L99A 5HM0A 4YADA 5CGPA 3HMFA 5IGNA 4KV1A 5A82A 5A5OA 5EK9A 5EU1A 3LJWA 5BT5A 5KTWA 5FE6A 3ZYUA 5ENIA 5E9LA 5I88A 5G4SA 4QEUA 3G0JA 3MULA 4QSXA 4Z1SA 5I40A 2MJVB 4QEWA 4YYIA 5FE3A 3IU6A 5D3SA 4A9LA 2GRCA 4Z1QA 4A9OA 5DBMA 5E3DA 5FE2A 4LZ2A 4XYAA 4QBMA 5EWCA 4TU6A 5JWMA 4QZSA 5FG4A 4QC1A 4TS8A 2OSSA 5G4RA 2E7OA 4YH4A 5EGUA 4Y03A 3LQHA 5TCMA 4LDFA 5FE4A 5C7NA 5EWHA 5FFWA 3MXFA 5ACYA 5F3AA 5AD2A 3P1EA 2YYNA 4HBXA 4NQMA 4XUAA 2YEKA 1JSPB 5CRMA 4YYHA 2KTBB 4CL9A 5F63A 5D3TA 5DW1A 5F62A 5K29A 5A85A 5L98A 4HXPA 4YYDA 5C8GA 4KCXA 5CQTA 5I1QA 5LVQA 3UVWA 4A9HA 4LZRA 4PS5A 3TLPA 3UVXA 5HELA 2F6NA 4Z6HA 4NR4A 2RFJA 5E9MA 5BT3A 5CQ3A 4AKNA 5E73A 4MR5A 5F1LA 3GG3A 3HMEA 5CTLA 4MR6A 4O78A 2I8NA 2WP1A 3MQMA 2N9GA 2R10A 4WHWA 5CS8A 4XY9A 4TYLA 4CLBA 4UYHA 4OGIA 4O71A 5HJCA 5BT4A 2L5EA 4HXSA 5F60A 5ENCA 4A9NA 4QB3A 5FE5A 5CQ5A 4HXKA 2RS9B 5IBNA 4NYXA 4YC9A 5DFCA 5IGLA 5FE9A 4O7EA 4QSSA 5DYAA 3Q2FA 5EPSA 4IORA 4IR4A 4LZSA 4A9JA 4ZW1A 5F1HA 4MEQA 5FE0A 5FG6A 4UIYA 4UYFA 5DY7A 4LYWA 5ENBA 4ALGA 5HRWA 4PCIA 5IGMA 4NR8A 2YELA 5HENA 4O70A 5FB1A 4IOOA 1WUMA 4C66A 5CY9A 4E96A 3U5LA 3SVFA 2OO1A 4XUBA 4HXLA 5L96A 5I80A 4J0RA 5A5RA 3D7CA 4NRCA 5CUAA 4LYIA 4TTEA 3UW9A 4TZ2A 3P1FA 4LR6A 5L97A 4CUTA 3AQAA 1N72A 4UYEA 5I83A 4YBSA 4YBTA 4GPJA 4NYWA 5EWVA 4NR6A 4HBVA 1E6IA 4QSPA 3K2JA 4FLPA 5ETDA 2DKWA 3QZTA 5DLXA 4QSUA 4DONA 4MR4A 3FKMX 4QSTA 1F68A 4BW1A 4YYKA 4KV4A 4UITA 5LJ0A 4MEOA 4WIVA 5CUDA 5EQ1A 3NXBA 4TQNA 5CFWA 4UIXA 4RVRA 5DKCA 5DLZA 4NXJA 2OUOA 4CFKA 5LKXA 2DWWA 3SVGA 5D3JA 4IR5A 1JM4B 3S92A 4QSWA 5FB0A 3LQJA 5KHMA 3UVDA 2YQDA 5AD3A 5DYCA 4OUFA 3UV4A 4O74A 2RO1A 5HRXA 4A9KA 4YATA 5F5ZA 5D3PA 5DFBA 5FDZA 4CURA 4YH3A 4NR9A 5HFQA 3P5OA 5IIDA 4Q0NA 2DVQA 5CUCA 5HCLA 5EM3A 4HBWA 5D7XA 5E9VA 2RI7A 4O7AA 5D0CA 5FE8A 4J0SA 5ENFA 2YW5A 5CUGA 3ONIA 4QSVA 4ZQLA 4Z6IA 3U5JA 2H60A 4UYDA 4Q0OA 4PCEA 4F3IA 5CU8A 5COIA 4YBMA 4QEVA 3UVYA 1ZS5A 3Q2EA 5C89A 4QUUA 4TT2A 5ENHA 5D26A 5J0DA 4N4IA 4QR5A 5E0RA 5D24A 2G4AA 5I86A 5D3LA 4QR3A 5EISA 5KU3A 4PTBA 3DWYA 3MB3A 2E3KA 4J3IA 2E7NA 5FG5A 4HBYA 2DVSA 3U5KA 4A9EA 4QUTA 5D3HA 5ENEA 2F6JA 4QC3A 5EVAA 3RCWA 4C67A 4QNSA 5ETBA 5E7DA 4Z93A 5A81A 4MR3A 5L8TA 3U5NA 4MENA 5LJ2A 5E74A 4QYDA 2YEMA 3O35A 4HXRA 5C85A 4UIVA 5KO4A 4LRGA 4QYLA 5A5NA 5CPEA 3IU5A 3O33A 2R0VA 4CUQA 2DVRA 4LYSA 5LUUA 4X2IA 4NR7A 4YYJA 3O37A 4YYGA 5FE7A 2DVVA 4N4HA 4YY6A 5CQ7A 5EV9A 3JVLA 5DYXA 5H1UA 5CUEA 5KTXA 4UYFB 5F61A 5HEMA 4A9IA 5TB6A 2RNYA 5EWWA 5A5SA 2RNXA 5A5PA 1X0JA 5E3GA 2L84A 5D3RA 3I3JA 5I29A 4YABA 5EI4A 4BW4A 3UV2A 5L8UA 4O7CA 3LXJA 5CQ6A 4TT6A 5I89A 5F36A 5CUBA 4BW2A 4CUPA 1WUGA 4YK0A 4TZ8A 5F2PA 5LKZA 5H1VA 5I7XA 5EWDA 4CUUA 4CFLA 2FSAA 4O7BA 4XY8A 4HXNA 5AMFA 4ALHA 2WP2A 2RNWA 2R0SA 1EQFA 5H1TA 3P1CA 5D25A 4TU4A 4IR3A 3HMHA 4NUCA 5EPRA 5FFVA 4NR5A 5LKUA 5C87A 5A83A 4TT4A 5FH7A 4QSQA 4UYGA 5CP5A 4UIZA 3G0LA 5CQ4A 2D9EA 4N4GA 5A5QA 3AADA 5DW2A 3JVKA 4WHUA 2R0YA 3QZVA 5DX4A 5CZGA 5E9IA 3O36A 4O76A 3LQIA 2NXBA 5LKTA 4O72A 4IOQA 5AMEA 5LJ1A 5HRVA 3JVMA 3QZSA 5JI8A 4NYVA 5C4QA 4HXMA 5CQ8A 4PY6A 5EPBA 5CQAA 5HQ5A 3UV5A 4J1PA 3P1DA 4QY4A 2D82A 5IG6A 5HQ7A 4O7FA 5IGKA 5DYUA 4A9FA 4O77A 5F25A 5FFYA 4O75A 4HXOA 4QR4A 5KTUA 3U5OA 5FE1A 2L85A 3O34A 4YYNA 4NRBA 4NUEA 4LC2A 5DKHA 4PKLA 5HQ6A 2I7KA 2DATA 4NS5A 4CUSA 4N4FA 5ENGA 2YDWA 4NUDA
chains in the Genus database with same CATH superfamily
4UIWA 5H85A 4AI6A 5II1A 4N3WA 3SVHA 5DKDA 3JVJA 4BJXA 4YY4A 2LSPB 3U5MA 5DFDA 4BHWA 5II2A 3DAIA 3MB4A 5FH8A 4QSRA 5EICA 4OGJA 3U5PA 4YYMA 5FBXA 4NRAA 5EP7A 3MUKA 5EA1A 5ENJA 5E9KA 5E9YA 5LVRA 4UIUA 4ZC9A 3S91A 4IR6A 5I7YA 5HFRA 4YAXA 5CRZA 4BW3A 4NQNA 4A9MA 5FH6A 5A7CA 5HLSA 4MEPA 5D3NA 5L99A 5HM0A 4YADA 5CGPA 3HMFA 5IGNA 4KV1A 5A82A 5A5OA 5EK9A 5EU1A 3LJWA 5BT5A 5KTWA 5FE6A 3ZYUA 5ENIA 5E9LA 5I88A 5G4SA 4QEUA 3G0JA 3MULA 4QSXA 4Z1SA 5I40A 2MJVB 4QEWA 2EJNA 5FE3A 3IU6A 5D3SA 4A9LA 4YYIA 2GRCA 4Z1QA 4A9OA 5DBMA 5E3DA 5FE2A 4AKGA 4LZ2A 4XYAA 4QBMA 5EWCA 4TU6A 5JWMA 4QZSA 5FG4A 4QC1A 4TS8A 2OSSA 5G4RA 2E7OA 4YH4A 5EGUA 4Y03A 3LQHA 5TCMA 4LDFA 5FE4A 5C7NA 5EWHA 5FFWA 3MXFA 5ACYA 5F3AA 5AD2A 3P1EA 2YYNA 4HBXA 4NQMA 4XUAA 2YEKA 1JSPB 5CRMA 4YYHA 2KTBB 4CL9A 5F63A 5D3TA 5DW1A 5F62A 5K29A 5A85A 5L98A 4HXPA 4YYDA 5C8GA 4KCXA 5CQTA 5I1QA 5LVQA 3UVWA 4A9HA 4LZRA 4PS5A 3TLPA 3UVXA 5HELA 2F6NA 4Z6HA 4NR4A 2RFJA 5E9MA 5BT3A 5CQ3A 4AKNA 5E73A 4MR5A 5F1LA 3GG3A 3HMEA 5CTLA 4MR6A 4O78A 2I8NA 2WP1A 3MQMA 2N9GA 2R10A 4WHWA 5CS8A 4XY9A 4TYLA 4CLBA 4UYHA 4OGIA 4O71A 5HJCA 5BT4A 2L5EA 4HXSA 3D1DA 5F60A 5ENCA 4A9NA 4QB3A 5FE5A 5CQ5A 4HXKA 2RS9B 5IBNA 4NYXA 4YC9A 5DFCA 5IGLA 3VKHA 5FE9A 4O7EA 4QSSA 5DYAA 3Q2FA 5EPSA 4IORA 4IR4A 4LZSA 4A9JA 4ZW1A 5F1HA 4MEQA 5FE0A 5FG6A 4UIYA 4UYFA 5DY7A 4LYWA 5ENBA 4ALGA 5HRWA 4PCIA 5IGMA 4NR8A 2YELA 5HENA 4O70A 5FB1A 4IOOA 1WUMA 4C66A 5CY9A 4E96A 3U5LA 3SVFA 2OO1A 4XUBA 4HXLA 5L96A 5I80A 4J0RA 5A5RA 3D7CA 4NRCA 5CUAA 4LYIA 4TTEA 3UW9A 4TZ2A 3P1FA 4LR6A 5L97A 4CUTA 3AQAA 1N72A 4UYEA 5I83A 4YBSA 4YBTA 4GPJA 4NYWA 5EWVA 4NR6A 4HBVA 1E6IA 4QSPA 3K2JA 4FLPA 5ETDA 2DKWA 3QZTA 5DLXA 4QSUA 4DONA 4MR4A 3FKMX 4QSTA 1F68A 4BW1A 4YYKA 4KV4A 4UITA 5LJ0A 4MEOA 4WIVA 5CUDA 5EQ1A 3NXBA 4TQNA 5CFWA 4UIXA 4RVRA 5DKCA 5DLZA 4NXJA 2OUOA 4CFKA 5LKXA 2DWWA 3SVGA 5D3JA 4IR5A 1JM4B 3S92A 4QSWA 5FB0A 3LQJA 5KHMA 3UVDA 2YQDA 5AD3A 5DYCA 4OUFA 3UV4A 4O74A 2RO1A 5HRXA 4A9KA 4YATA 5F5ZA 5D3PA 5DFBA 5FDZA 4CURA 4YH3A 4NR9A 5HFQA 3P5OA 5IIDA 4Q0NA 2DVQA 5CUCA 5HCLA 5EM3A 4HBWA 5D7XA 5E9VA 2RI7A 4O7AA 5D0CA 5FE8A 4J0SA 5ENFA 2YW5A 5CUGA 3ONIA 4AKIA 4QSVA 4ZQLA 4Z6IA 3U5JA 2H60A 4UYDA 4Q0OA 4PCEA 4F3IA 5CU8A 5COIA 4YBMA 4QEVA 3UVYA 1ZS5A 3Q2EA 5C89A 4QUUA 4TT2A 5ENHA 5D26A 5J0DA 4N4IA 4QR5A 5E0RA 5D24A 2G4AA 5I86A 5D3LA 4QR3A 5EISA 5KU3A 4PTBA 3DWYA 3MB3A 2E3KA 4J3IA 2E7NA 5FG5A 4HBYA 2DVSA 3U5KA 4A9EA 4QUTA 5D3HA 5ENEA 2F6JA 4QC3A 5EVAA 3RCWA 4C67A 4QNSA 5ETBA 5E7DA 4Z93A 5A81A 4MR3A 5L8TA 3U5NA 4MENA 5LJ2A 5E74A 4QYDA 2YEMA 3O35A 4HXRA 4AKHA 5C85A 4UIVA 5KO4A 4LRGA 4QYLA 5A5NA 5CPEA 3IU5A 3O33A 2R0VA 4CUQA 2DVRA 4LYSA 5LUUA 4X2IA 4NR7A 4YYJA 3O37A 4YYGA 5FE7A 2DVVA 3VKGA 4N4HA 4YY6A 5CQ7A 5EV9A 3JVLA 3ERRA 5DYXA 5H1UA 5CUEA 5KTXA 4UYFB 5F61A 5HEMA 4A9IA 5TB6A 2RNYA 5EWWA 1ZKRA 5A5SA 2RNXA 5A5PA 1X0JA 5E3GA 2L84A 5D3RA 3I3JA 5I29A 4YABA 5EI4A 1PUOA 4BW4A 3UV2A 5L8UA 4O7CA 3LXJA 5CQ6A 4TT6A 5I89A 5F36A 5CUBA 4BW2A 4CUPA 1WUGA 4YK0A 4TZ8A 5F2PA 5LKZA 5H1VA 5I7XA 5EWDA 4CUUA 4CFLA 2FSAA 4O7BA 4XY8A 4HXNA 5AMFA 4ALHA 2WP2A 2RNWA 2R0SA 1EQFA 5H1TA 3P1CA 5D25A 4TU4A 4IR3A 3HMHA 4NUCA 5EPRA 5FFVA 4NR5A 5LKUA 5C87A 5A83A 4TT4A 5FH7A 4QSQA 4UYGA 5CP5A 4UIZA 3G0LA 5CQ4A 2D9EA 4N4GA 5A5QA 3AADA 5DW2A 3JVKA 4WHUA 2R0YA 3QZVA 5DX4A 5CZGA 5E9IA 3O36A 4O76A 3LQIA 2NXBA 5LKTA 4O72A 4IOQA 5AMEA 5LJ1A 5HRVA 3JVMA 3QZSA 5JI8A 4NYVA 5C4QA 4HXMA 5CQ8A 4PY6A 5EPBA 5CQAA 5HQ5A 3UV5A 4J1PA 3P1DA 4QY4A 2D82A 5IG6A 5HQ7A 4O7FA 3D1BA 5IGKA 5DYUA 4A9FA 4O77A 5F25A 5FFYA 4O75A 4HXOA 4QR4A 5KTUA 3U5OA 5FE1A 2L85A 3O34A 4YYNA 4NRBA 4NUEA 4LC2A 5DKHA 4PKLA 5HQ6A 2I7KA 2DATA 4NS5A 4CUSA 4N4FA 5ENGA 2YDWA 4NUDA
chains in the Genus database with same CATH topology
4UIWA 5H85A 5II1A 4N3WA 3SVHA 5DKDA 3JVJA 4BJXA 4YY4A 2LSPB 3U5MA 5DFDA 4BHWA 5II2A 3DAIA 3MB4A 5FH8A 4QSRA 5EICA 4OGJA 3U5PA 4YYMA 5FBXA 4NRAA 5EP7A 3MUKA 5EA1A 5ENJA 5E9KA 5E9YA 5LVRA 4UIUA 4ZC9A 3S91A 4IR6A 5I7YA 5HFRA 4YAXA 5CRZA 4BW3A 4NQNA 4A9MA 5FH6A 5A7CA 5HLSA 4MEPA 5D3NA 5L99A 5HM0A 4YADA 5CGPA 3HMFA 5IGNA 4KV1A 5A82A 5A5OA 5EK9A 5EU1A 3LJWA 5BT5A 5KTWA 5FE6A 3ZYUA 5ENIA 5E9LA 5I88A 5G4SA 4QEUA 3G0JA 3MULA 4QSXA 4Z1SA 5I40A 2MJVB 4QEWA 4YYIA 5FE3A 3IU6A 5D3SA 4A9LA 2GRCA 4Z1QA 4A9OA 5DBMA 5E3DA 5FE2A 4LZ2A 4XYAA 4QBMA 5EWCA 4TU6A 5JWMA 4QZSA 5FG4A 4QC1A 4TS8A 2OSSA 5G4RA 2E7OA 4YH4A 5EGUA 4Y03A 3LQHA 5TCMA 4LDFA 5FE4A 5C7NA 5EWHA 5FFWA 3MXFA 5ACYA 5F3AA 5AD2A 3P1EA 2YYNA 4HBXA 4NQMA 4XUAA 2YEKA 1JSPB 5CRMA 4YYHA 2KTBB 4CL9A 5F63A 5D3TA 5DW1A 5F62A 5K29A 5A85A 5L98A 4HXPA 4YYDA 5C8GA 4KCXA 5CQTA 5I1QA 5LVQA 3UVWA 4A9HA 4LZRA 4PS5A 3TLPA 3UVXA 5HELA 2F6NA 4Z6HA 4NR4A 2RFJA 5E9MA 5BT3A 5CQ3A 4AKNA 5E73A 4MR5A 5F1LA 3GG3A 3HMEA 5CTLA 4MR6A 4O78A 2I8NA 2WP1A 3MQMA 2N9GA 2R10A 4WHWA 5CS8A 4XY9A 4TYLA 4CLBA 4UYHA 4OGIA 4O71A 5HJCA 5BT4A 2L5EA 4HXSA 5F60A 5ENCA 4A9NA 4QB3A 5FE5A 5CQ5A 4HXKA 2RS9B 5IBNA 4NYXA 4YC9A 5DFCA 5IGLA 5FE9A 4O7EA 4QSSA 5DYAA 3Q2FA 5EPSA 4IORA 4IR4A 4LZSA 4A9JA 4ZW1A 5F1HA 4MEQA 5FE0A 5FG6A 4UIYA 4UYFA 5DY7A 4LYWA 5ENBA 4ALGA 5HRWA 4PCIA 5IGMA 4NR8A 2YELA 5HENA 4O70A 5FB1A 4IOOA 1WUMA 4C66A 5CY9A 4E96A 3U5LA 3SVFA 2OO1A 4XUBA 4HXLA 5L96A 5I80A 4J0RA 5A5RA 3D7CA 4NRCA 5CUAA 4LYIA 4TTEA 3UW9A 4TZ2A 3P1FA 4LR6A 5L97A 4CUTA 3AQAA 1N72A 4UYEA 5I83A 4YBSA 4YBTA 4GPJA 4NYWA 5EWVA 4NR6A 4HBVA 1E6IA 4QSPA 3K2JA 4FLPA 5ETDA 2DKWA 3QZTA 5DLXA 4QSUA 4DONA 4MR4A 3FKMX 4QSTA 1F68A 4BW1A 4YYKA 4KV4A 4UITA 5LJ0A 4MEOA 4WIVA 5CUDA 5EQ1A 3NXBA 4TQNA 5CFWA 4UIXA 4RVRA 5DKCA 5DLZA 4NXJA 2OUOA 4CFKA 5LKXA 2DWWA 3SVGA 5D3JA 4IR5A 1JM4B 3S92A 4QSWA 5FB0A 3LQJA 5KHMA 3UVDA 2YQDA 5AD3A 5DYCA 4OUFA 3UV4A 4O74A 2RO1A 5HRXA 4A9KA 4YATA 5F5ZA 5D3PA 5DFBA 5FDZA 4CURA 4YH3A 4NR9A 5HFQA 3P5OA 5IIDA 4Q0NA 2DVQA 5CUCA 5HCLA 5EM3A 4HBWA 5D7XA 5E9VA 2RI7A 4O7AA 5D0CA 5FE8A 4J0SA 5ENFA 2YW5A 5CUGA 3ONIA 4QSVA 4ZQLA 4Z6IA 3U5JA 2H60A 4UYDA 4Q0OA 4PCEA 4F3IA 5CU8A 5COIA 4YBMA 4QEVA 3UVYA 1ZS5A 3Q2EA 5C89A 4QUUA 4TT2A 5ENHA 5D26A 5J0DA 4N4IA 4QR5A 5E0RA 5D24A 2G4AA 5I86A 5D3LA 4QR3A 5EISA 5KU3A 4PTBA 3DWYA 3MB3A 2E3KA 4J3IA 2E7NA 5FG5A 4HBYA 2DVSA 3U5KA 4A9EA 4QUTA 5D3HA 5ENEA 2F6JA 4QC3A 5EVAA 3RCWA 4C67A 4QNSA 5ETBA 5E7DA 4Z93A 5A81A 4MR3A 5L8TA 3U5NA 4MENA 5LJ2A 5E74A 4QYDA 2YEMA 3O35A 4HXRA 5C85A 4UIVA 5KO4A 4LRGA 4QYLA 5A5NA 5CPEA 3IU5A 3O33A 2R0VA 4CUQA 2DVRA 4LYSA 5LUUA 4X2IA 4NR7A 4YYJA 3O37A 4YYGA 5FE7A 2DVVA 4N4HA 4YY6A 5CQ7A 5EV9A 3JVLA 5DYXA 5H1UA 5CUEA 5KTXA 4UYFB 5F61A 5HEMA 4A9IA 5TB6A 2RNYA 5EWWA 5A5SA 2RNXA 5A5PA 1X0JA 5E3GA 2L84A 5D3RA 3I3JA 5I29A 4YABA 5EI4A 4BW4A 3UV2A 5L8UA 4O7CA 3LXJA 5CQ6A 4TT6A 5I89A 5F36A 5CUBA 4BW2A 4CUPA 1WUGA 4YK0A 4TZ8A 5F2PA 5LKZA 5H1VA 5I7XA 5EWDA 4CUUA 4CFLA 2FSAA 4O7BA 4XY8A 4HXNA 5AMFA 4ALHA 2WP2A 2RNWA 2R0SA 1EQFA 5H1TA 3P1CA 5D25A 4TU4A 4IR3A 3HMHA 4NUCA 5EPRA 5FFVA 4NR5A 5LKUA 5C87A 5A83A 4TT4A 5FH7A 4QSQA 4UYGA 5CP5A 4UIZA 3G0LA 5CQ4A 2D9EA 4N4GA 5A5QA 3AADA 5DW2A 3JVKA 4WHUA 2R0YA 3QZVA 5DX4A 5CZGA 5E9IA 3O36A 4O76A 3LQIA 2NXBA 5LKTA 4O72A 4IOQA 5AMEA 5LJ1A 5HRVA 3JVMA 3QZSA 5JI8A 4NYVA 5C4QA 4HXMA 5CQ8A 4PY6A 5EPBA 5CQAA 5HQ5A 3UV5A 4J1PA 3P1DA 4QY4A 2D82A 5IG6A 5HQ7A 4O7FA 5IGKA 5DYUA 4A9FA 4O77A 5F25A 5FFYA 4O75A 4HXOA 4QR4A 5KTUA 3U5OA 5FE1A 2L85A 3O34A 4YYNA 4NRBA 4NUEA 4LC2A 5DKHA 4PKLA 5HQ6A 2I7KA 2DATA 4NS5A 4CUSA 4N4FA 5ENGA 2YDWA 4NUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UIW A;  5H85 A;  5II1 A;  4N3W A;  3SVH A;  5DKD A;  3JVJ A;  4BJX A;  4YY4 A;  2LSP B;  3U5M A;  5DFD A;  4BHW A;  5II2 A;  3DAI A;  3MB4 A;  5FH8 A;  4QSR A;  5EIC A;  4OGJ A;  3U5P A;  4YYM A;  5FBX A;  4NRA A;  5EP7 A;  3MUK A;  5EA1 A;  5ENJ A;  5E9K A;  5E9Y A;  5LVR A;  4UIU A;  4ZC9 A;  3S91 A;  4IR6 A;  5I7Y A;  5HFR A;  4YAX A;  5CRZ A;  4BW3 A;  4NQN A;  4A9M A;  5FH6 A;  5A7C A;  5HLS A;  4MEP A;  5D3N A;  5L99 A;  5HM0 A;  4YAD A;  5CGP A;  3HMF A;  5IGN A;  4KV1 A;  5A82 A;  5A5O A;  5EK9 A;  5EU1 A;  3LJW A;  5BT5 A;  5KTW A;  5FE6 A;  3ZYU A;  5ENI A;  5E9L A;  5I88 A;  5G4S A;  4QEU A;  3G0J A;  3MUL A;  4QSX A;  4Z1S A;  5I40 A;  2MJV B;  4QEW A;  4YYI A;  5FE3 A;  3IU6 A;  5D3S A;  4A9L A;  2GRC A;  4Z1Q A;  4A9O A;  5DBM A;  5E3D A;  5FE2 A;  4LZ2 A;  4XYA A;  4QBM A;  5EWC A;  4TU6 A;  5JWM A;  4QZS A;  5FG4 A;  4QC1 A;  4TS8 A;  2OSS A;  5G4R A;  2E7O A;  4YH4 A;  5EGU A;  4Y03 A;  3LQH A;  5TCM A;  4LDF A;  5FE4 A;  5C7N A;  5EWH A;  5FFW A;  3MXF A;  5ACY A;  5F3A A;  5AD2 A;  3P1E A;  2YYN A;  4HBX A;  4NQM A;  4XUA A;  2YEK A;  1JSP B;  5CRM A;  4YYH A;  2KTB B;  4CL9 A;  5F63 A;  5D3T A;  5DW1 A;  5F62 A;  5K29 A;  5A85 A;  5L98 A;  4HXP A;  4YYD A;  5C8G A;  4KCX A;  5CQT A;  5I1Q A;  5LVQ A;  3UVW A;  4A9H A;  4LZR A;  4PS5 A;  3TLP A;  3UVX A;  5HEL A;  2F6N A;  4Z6H A;  4NR4 A;  2RFJ A;  5E9M A;  5BT3 A;  5CQ3 A;  4AKN A;  5E73 A;  4MR5 A;  5F1L A;  3GG3 A;  3HME A;  5CTL A;  4MR6 A;  4O78 A;  2I8N A;  2WP1 A;  3MQM A;  2N9G A;  2R10 A;  4WHW A;  5CS8 A;  4XY9 A;  4TYL A;  4CLB A;  4UYH A;  4OGI A;  4O71 A;  5HJC A;  5BT4 A;  2L5E A;  4HXS A;  5F60 A;  5ENC A;  4A9N A;  4QB3 A;  5FE5 A;  5CQ5 A;  4HXK A;  2RS9 B;  5IBN A;  4NYX A;  4YC9 A;  5DFC A;  5IGL A;  5FE9 A;  4O7E A;  4QSS A;  5DYA A;  3Q2F A;  5EPS A;  4IOR A;  4IR4 A;  4LZS A;  4A9J A;  4ZW1 A;  5F1H A;  4MEQ A;  5FE0 A;  5FG6 A;  4UIY A;  4UYF A;  5DY7 A;  4LYW A;  5ENB A;  4ALG A;  5HRW A;  4PCI A;  5IGM A;  4NR8 A;  2YEL A;  5HEN A;  4O70 A;  5FB1 A;  4IOO A;  1WUM A;  4C66 A;  5CY9 A;  4E96 A;  3U5L A;  3SVF A;  2OO1 A;  4XUB A;  4HXL A;  5L96 A;  5I80 A;  4J0R A;  5A5R A;  3D7C A;  4NRC A;  5CUA A;  4LYI A;  4TTE A;  3UW9 A;  4TZ2 A;  3P1F A;  4LR6 A;  5L97 A;  4CUT A;  3AQA A;  1N72 A;  4UYE A;  5I83 A;  4YBS A;  4YBT A;  4GPJ A;  4NYW A;  5EWV A;  4NR6 A;  4HBV A;  1E6I A;  4QSP A;  3K2J A;  4FLP A;  5ETD A;  2DKW A;  3QZT A;  5DLX A;  4QSU A;  4DON A;  4MR4 A;  3FKM X;  4QST A;  1F68 A;  4BW1 A;  4YYK A;  4KV4 A;  4UIT A;  5LJ0 A;  4MEO A;  4WIV A;  5CUD A;  5EQ1 A;  3NXB A;  4TQN A;  5CFW A;  4UIX A;  4RVR A;  5DKC A;  5DLZ A;  4NXJ A;  2OUO A;  4CFK A;  5LKX A;  2DWW A;  3SVG A;  5D3J A;  4IR5 A;  1JM4 B;  3S92 A;  4QSW A;  5FB0 A;  3LQJ A;  5KHM A;  3UVD A;  2YQD A;  5AD3 A;  5DYC A;  4OUF A;  3UV4 A;  4O74 A;  2RO1 A;  5HRX A;  4A9K A;  4YAT A;  5F5Z A;  5D3P A;  5DFB A;  5FDZ A;  4CUR A;  4YH3 A;  4NR9 A;  5HFQ A;  3P5O A;  5IID A;  4Q0N A;  2DVQ A;  5CUC A;  5HCL A;  5EM3 A;  4HBW A;  5D7X A;  5E9V A;  2RI7 A;  4O7A A;  5D0C A;  5FE8 A;  4J0S A;  5ENF A;  2YW5 A;  5CUG A;  3ONI A;  4QSV A;  4ZQL A;  4Z6I A;  3U5J A;  2H60 A;  4UYD A;  4Q0O A;  4PCE A;  4F3I A;  5CU8 A;  5COI A;  4YBM A;  4QEV A;  3UVY A;  1ZS5 A;  3Q2E A;  5C89 A;  4QUU A;  4TT2 A;  5ENH A;  5D26 A;  5J0D A;  4N4I A;  4QR5 A;  5E0R A;  5D24 A;  2G4A A;  5I86 A;  5D3L A;  4QR3 A;  5EIS A;  5KU3 A;  4PTB A;  3DWY A;  3MB3 A;  2E3K A;  4J3I A;  2E7N A;  5FG5 A;  4HBY A;  2DVS A;  3U5K A;  4A9E A;  4QUT A;  5D3H A;  5ENE A;  2F6J A;  4QC3 A;  5EVA A;  3RCW A;  4C67 A;  4QNS A;  5ETB A;  5E7D A;  4Z93 A;  5A81 A;  4MR3 A;  5L8T A;  3U5N A;  4MEN A;  5LJ2 A;  5E74 A;  4QYD A;  2YEM A;  3O35 A;  4HXR A;  5C85 A;  4UIV A;  5KO4 A;  4LRG A;  4QYL A;  5A5N A;  5CPE A;  3IU5 A;  3O33 A;  2R0V A;  4CUQ A;  2DVR A;  4LYS A;  5LUU A;  4X2I A;  4NR7 A;  4YYJ A;  3O37 A;  4YYG A;  5FE7 A;  2DVV A;  4N4H A;  4YY6 A;  5CQ7 A;  5EV9 A;  3JVL A;  5DYX A;  5H1U A;  5CUE A;  5KTX A;  4UYF B;  5F61 A;  5HEM A;  4A9I A;  5TB6 A;  2RNY A;  5EWW A;  5A5S A;  2RNX A;  5A5P A;  1X0J A;  5E3G A;  2L84 A;  5D3R A;  3I3J A;  5I29 A;  4YAB A;  5EI4 A;  4BW4 A;  3UV2 A;  5L8U A;  4O7C A;  3LXJ A;  5CQ6 A;  4TT6 A;  5I89 A;  5F36 A;  5CUB A;  4BW2 A;  4CUP A;  1WUG A;  4YK0 A;  4TZ8 A;  5F2P A;  5LKZ A;  5H1V A;  5I7X A;  5EWD A;  4CUU A;  4CFL A;  2FSA A;  4O7B A;  4XY8 A;  4HXN A;  5AMF A;  4ALH A;  2WP2 A;  2RNW A;  2R0S A;  1EQF A;  5H1T A;  3P1C A;  5D25 A;  4TU4 A;  4IR3 A;  3HMH A;  4NUC A;  5EPR A;  5FFV A;  4NR5 A;  5LKU A;  5C87 A;  5A83 A;  4TT4 A;  5FH7 A;  4QSQ A;  4UYG A;  5CP5 A;  4UIZ A;  3G0L A;  5CQ4 A;  2D9E A;  4N4G A;  5A5Q A;  3AAD A;  5DW2 A;  3JVK A;  4WHU A;  2R0Y A;  3QZV A;  5DX4 A;  5CZG A;  5E9I A;  3O36 A;  4O76 A;  3LQI A;  2NXB A;  5LKT A;  4O72 A;  4IOQ A;  5AME A;  5LJ1 A;  5HRV A;  3JVM A;  3QZS A;  5JI8 A;  4NYV A;  5C4Q A;  4HXM A;  5CQ8 A;  4PY6 A;  5EPB A;  5CQA A;  5HQ5 A;  3UV5 A;  4J1P A;  3P1D A;  4QY4 A;  2D82 A;  5IG6 A;  5HQ7 A;  4O7F A;  5IGK A;  5DYU A;  4A9F A;  4O77 A;  5F25 A;  5FFY A;  4O75 A;  4HXO A;  4QR4 A;  5KTU A;  3U5O A;  5FE1 A;  2L85 A;  3O34 A;  4YYN A;  4NRB A;  4NUE A;  4LC2 A;  5DKH A;  4PKL A;  5HQ6 A;  2I7K A;  2DAT A;  4NS5 A;  4CUS A;  4N4F A;  5ENG A;  2YDW A;  4NUD A; 
#chains in the Genus database with same CATH topology
 4UIW A;  5H85 A;  4AI6 A;  5II1 A;  4N3W A;  3SVH A;  5DKD A;  3JVJ A;  4BJX A;  4YY4 A;  2LSP B;  3U5M A;  5DFD A;  4BHW A;  5II2 A;  3DAI A;  3MB4 A;  5FH8 A;  4QSR A;  5EIC A;  4OGJ A;  3U5P A;  4YYM A;  5FBX A;  4NRA A;  5EP7 A;  3MUK A;  5EA1 A;  5ENJ A;  5E9K A;  5E9Y A;  5LVR A;  4UIU A;  4ZC9 A;  3S91 A;  4IR6 A;  5I7Y A;  5HFR A;  4YAX A;  5CRZ A;  4BW3 A;  4NQN A;  4A9M A;  5FH6 A;  5A7C A;  5HLS A;  4MEP A;  5D3N A;  5L99 A;  5HM0 A;  4YAD A;  5CGP A;  3HMF A;  5IGN A;  4KV1 A;  5A82 A;  5A5O A;  5EK9 A;  5EU1 A;  3LJW A;  5BT5 A;  5KTW A;  5FE6 A;  3ZYU A;  5ENI A;  5E9L A;  5I88 A;  5G4S A;  4QEU A;  3G0J A;  3MUL A;  4QSX A;  4Z1S A;  5I40 A;  2MJV B;  4QEW A;  2EJN A;  5FE3 A;  3IU6 A;  5D3S A;  4A9L A;  4YYI A;  2GRC A;  4Z1Q A;  4A9O A;  5DBM A;  5E3D A;  5FE2 A;  4AKG A;  4LZ2 A;  4XYA A;  4QBM A;  5EWC A;  4TU6 A;  5JWM A;  4QZS A;  5FG4 A;  4QC1 A;  4TS8 A;  2OSS A;  5G4R A;  2E7O A;  4YH4 A;  5EGU A;  4Y03 A;  3LQH A;  5TCM A;  4LDF A;  5FE4 A;  5C7N A;  5EWH A;  5FFW A;  3MXF A;  5ACY A;  5F3A A;  5AD2 A;  3P1E A;  2YYN A;  4HBX A;  4NQM A;  4XUA A;  2YEK A;  1JSP B;  5CRM A;  4YYH A;  2KTB B;  4CL9 A;  5F63 A;  5D3T A;  5DW1 A;  5F62 A;  5K29 A;  5A85 A;  5L98 A;  4HXP A;  4YYD A;  5C8G A;  4KCX A;  5CQT A;  5I1Q A;  5LVQ A;  3UVW A;  4A9H A;  4LZR A;  4PS5 A;  3TLP A;  3UVX A;  5HEL A;  2F6N A;  4Z6H A;  4NR4 A;  2RFJ A;  5E9M A;  5BT3 A;  5CQ3 A;  4AKN A;  5E73 A;  4MR5 A;  5F1L A;  3GG3 A;  3HME A;  5CTL A;  4MR6 A;  4O78 A;  2I8N A;  2WP1 A;  3MQM A;  2N9G A;  2R10 A;  4WHW A;  5CS8 A;  4XY9 A;  4TYL A;  4CLB A;  4UYH A;  4OGI A;  4O71 A;  5HJC A;  5BT4 A;  2L5E A;  4HXS A;  3D1D A;  5F60 A;  5ENC A;  4A9N A;  4QB3 A;  5FE5 A;  5CQ5 A;  4HXK A;  2RS9 B;  5IBN A;  4NYX A;  4YC9 A;  5DFC A;  5IGL A;  3VKH A;  5FE9 A;  4O7E A;  4QSS A;  5DYA A;  3Q2F A;  5EPS A;  4IOR A;  4IR4 A;  4LZS A;  4A9J A;  4ZW1 A;  5F1H A;  4MEQ A;  5FE0 A;  5FG6 A;  4UIY A;  4UYF A;  5DY7 A;  4LYW A;  5ENB A;  4ALG A;  5HRW A;  4PCI A;  5IGM A;  4NR8 A;  2YEL A;  5HEN A;  4O70 A;  5FB1 A;  4IOO A;  1WUM A;  4C66 A;  5CY9 A;  4E96 A;  3U5L A;  3SVF A;  2OO1 A;  4XUB A;  4HXL A;  5L96 A;  5I80 A;  4J0R A;  5A5R A;  3D7C A;  4NRC A;  5CUA A;  4LYI A;  4TTE A;  3UW9 A;  4TZ2 A;  3P1F A;  4LR6 A;  5L97 A;  4CUT A;  3AQA A;  1N72 A;  4UYE A;  5I83 A;  4YBS A;  4YBT A;  4GPJ A;  4NYW A;  5EWV A;  4NR6 A;  4HBV A;  1E6I A;  4QSP A;  3K2J A;  4FLP A;  5ETD A;  2DKW A;  3QZT A;  5DLX A;  4QSU A;  4DON A;  4MR4 A;  3FKM X;  4QST A;  1F68 A;  4BW1 A;  4YYK A;  4KV4 A;  4UIT A;  5LJ0 A;  4MEO A;  4WIV A;  5CUD A;  5EQ1 A;  3NXB A;  4TQN A;  5CFW A;  4UIX A;  4RVR A;  5DKC A;  5DLZ A;  4NXJ A;  2OUO A;  4CFK A;  5LKX A;  2DWW A;  3SVG A;  5D3J A;  4IR5 A;  1JM4 B;  3S92 A;  4QSW A;  5FB0 A;  3LQJ A;  5KHM A;  3UVD A;  2YQD A;  5AD3 A;  5DYC A;  4OUF A;  3UV4 A;  4O74 A;  2RO1 A;  5HRX A;  4A9K A;  4YAT A;  5F5Z A;  5D3P A;  5DFB A;  5FDZ A;  4CUR A;  4YH3 A;  4NR9 A;  5HFQ A;  3P5O A;  5IID A;  4Q0N A;  2DVQ A;  5CUC A;  5HCL A;  5EM3 A;  4HBW A;  5D7X A;  5E9V A;  2RI7 A;  4O7A A;  5D0C A;  5FE8 A;  4J0S A;  5ENF A;  2YW5 A;  5CUG A;  3ONI A;  4AKI A;  4QSV A;  4ZQL A;  4Z6I A;  3U5J A;  2H60 A;  4UYD A;  4Q0O A;  4PCE A;  4F3I A;  5CU8 A;  5COI A;  4YBM A;  4QEV A;  3UVY A;  1ZS5 A;  3Q2E A;  5C89 A;  4QUU A;  4TT2 A;  5ENH A;  5D26 A;  5J0D A;  4N4I A;  4QR5 A;  5E0R A;  5D24 A;  2G4A A;  5I86 A;  5D3L A;  4QR3 A;  5EIS A;  5KU3 A;  4PTB A;  3DWY A;  3MB3 A;  2E3K A;  4J3I A;  2E7N A;  5FG5 A;  4HBY A;  2DVS A;  3U5K A;  4A9E A;  4QUT A;  5D3H A;  5ENE A;  2F6J A;  4QC3 A;  5EVA A;  3RCW A;  4C67 A;  4QNS A;  5ETB A;  5E7D A;  4Z93 A;  5A81 A;  4MR3 A;  5L8T A;  3U5N A;  4MEN A;  5LJ2 A;  5E74 A;  4QYD A;  2YEM A;  3O35 A;  4HXR A;  4AKH A;  5C85 A;  4UIV A;  5KO4 A;  4LRG A;  4QYL A;  5A5N A;  5CPE A;  3IU5 A;  3O33 A;  2R0V A;  4CUQ A;  2DVR A;  4LYS A;  5LUU A;  4X2I A;  4NR7 A;  4YYJ A;  3O37 A;  4YYG A;  5FE7 A;  2DVV A;  3VKG A;  4N4H A;  4YY6 A;  5CQ7 A;  5EV9 A;  3JVL A;  3ERR A;  5DYX A;  5H1U A;  5CUE A;  5KTX A;  4UYF B;  5F61 A;  5HEM A;  4A9I A;  5TB6 A;  2RNY A;  5EWW A;  1ZKR A;  5A5S A;  2RNX A;  5A5P A;  1X0J A;  5E3G A;  2L84 A;  5D3R A;  3I3J A;  5I29 A;  4YAB A;  5EI4 A;  1PUO A;  4BW4 A;  3UV2 A;  5L8U A;  4O7C A;  3LXJ A;  5CQ6 A;  4TT6 A;  5I89 A;  5F36 A;  5CUB A;  4BW2 A;  4CUP A;  1WUG A;  4YK0 A;  4TZ8 A;  5F2P A;  5LKZ A;  5H1V A;  5I7X A;  5EWD A;  4CUU A;  4CFL A;  2FSA A;  4O7B A;  4XY8 A;  4HXN A;  5AMF A;  4ALH A;  2WP2 A;  2RNW A;  2R0S A;  1EQF A;  5H1T A;  3P1C A;  5D25 A;  4TU4 A;  4IR3 A;  3HMH A;  4NUC A;  5EPR A;  5FFV A;  4NR5 A;  5LKU A;  5C87 A;  5A83 A;  4TT4 A;  5FH7 A;  4QSQ A;  4UYG A;  5CP5 A;  4UIZ A;  3G0L A;  5CQ4 A;  2D9E A;  4N4G A;  5A5Q A;  3AAD A;  5DW2 A;  3JVK A;  4WHU A;  2R0Y A;  3QZV A;  5DX4 A;  5CZG A;  5E9I A;  3O36 A;  4O76 A;  3LQI A;  2NXB A;  5LKT A;  4O72 A;  4IOQ A;  5AME A;  5LJ1 A;  5HRV A;  3JVM A;  3QZS A;  5JI8 A;  4NYV A;  5C4Q A;  4HXM A;  5CQ8 A;  4PY6 A;  5EPB A;  5CQA A;  5HQ5 A;  3UV5 A;  4J1P A;  3P1D A;  4QY4 A;  2D82 A;  5IG6 A;  5HQ7 A;  4O7F A;  3D1B A;  5IGK A;  5DYU A;  4A9F A;  4O77 A;  5F25 A;  5FFY A;  4O75 A;  4HXO A;  4QR4 A;  5KTU A;  3U5O A;  5FE1 A;  2L85 A;  3O34 A;  4YYN A;  4NRB A;  4NUE A;  4LC2 A;  5DKH A;  4PKL A;  5HQ6 A;  2I7K A;  2DAT A;  4NS5 A;  4CUS A;  4N4F A;  5ENG A;  2YDW A;  4NUD A; 
#chains in the Genus database with same CATH homology
 4UIW A;  5H85 A;  5II1 A;  4N3W A;  3SVH A;  5DKD A;  3JVJ A;  4BJX A;  4YY4 A;  2LSP B;  3U5M A;  5DFD A;  4BHW A;  5II2 A;  3DAI A;  3MB4 A;  5FH8 A;  4QSR A;  5EIC A;  4OGJ A;  3U5P A;  4YYM A;  5FBX A;  4NRA A;  5EP7 A;  3MUK A;  5EA1 A;  5ENJ A;  5E9K A;  5E9Y A;  5LVR A;  4UIU A;  4ZC9 A;  3S91 A;  4IR6 A;  5I7Y A;  5HFR A;  4YAX A;  5CRZ A;  4BW3 A;  4NQN A;  4A9M A;  5FH6 A;  5A7C A;  5HLS A;  4MEP A;  5D3N A;  5L99 A;  5HM0 A;  4YAD A;  5CGP A;  3HMF A;  5IGN A;  4KV1 A;  5A82 A;  5A5O A;  5EK9 A;  5EU1 A;  3LJW A;  5BT5 A;  5KTW A;  5FE6 A;  3ZYU A;  5ENI A;  5E9L A;  5I88 A;  5G4S A;  4QEU A;  3G0J A;  3MUL A;  4QSX A;  4Z1S A;  5I40 A;  2MJV B;  4QEW A;  4YYI A;  5FE3 A;  3IU6 A;  5D3S A;  4A9L A;  2GRC A;  4Z1Q A;  4A9O A;  5DBM A;  5E3D A;  5FE2 A;  4LZ2 A;  4XYA A;  4QBM A;  5EWC A;  4TU6 A;  5JWM A;  4QZS A;  5FG4 A;  4QC1 A;  4TS8 A;  2OSS A;  5G4R A;  2E7O A;  4YH4 A;  5EGU A;  4Y03 A;  3LQH A;  5TCM A;  4LDF A;  5FE4 A;  5C7N A;  5EWH A;  5FFW A;  3MXF A;  5ACY A;  5F3A A;  5AD2 A;  3P1E A;  2YYN A;  4HBX A;  4NQM A;  4XUA A;  2YEK A;  1JSP B;  5CRM A;  4YYH A;  2KTB B;  4CL9 A;  5F63 A;  5D3T A;  5DW1 A;  5F62 A;  5K29 A;  5A85 A;  5L98 A;  4HXP A;  4YYD A;  5C8G A;  4KCX A;  5CQT A;  5I1Q A;  5LVQ A;  3UVW A;  4A9H A;  4LZR A;  4PS5 A;  3TLP A;  3UVX A;  5HEL A;  2F6N A;  4Z6H A;  4NR4 A;  2RFJ A;  5E9M A;  5BT3 A;  5CQ3 A;  4AKN A;  5E73 A;  4MR5 A;  5F1L A;  3GG3 A;  3HME A;  5CTL A;  4MR6 A;  4O78 A;  2I8N A;  2WP1 A;  3MQM A;  2N9G A;  2R10 A;  4WHW A;  5CS8 A;  4XY9 A;  4TYL A;  4CLB A;  4UYH A;  4OGI A;  4O71 A;  5HJC A;  5BT4 A;  2L5E A;  4HXS A;  5F60 A;  5ENC A;  4A9N A;  4QB3 A;  5FE5 A;  5CQ5 A;  4HXK A;  2RS9 B;  5IBN A;  4NYX A;  4YC9 A;  5DFC A;  5IGL A;  5FE9 A;  4O7E A;  4QSS A;  5DYA A;  3Q2F A;  5EPS A;  4IOR A;  4IR4 A;  4LZS A;  4A9J A;  4ZW1 A;  5F1H A;  4MEQ A;  5FE0 A;  5FG6 A;  4UIY A;  4UYF A;  5DY7 A;  4LYW A;  5ENB A;  4ALG A;  5HRW A;  4PCI A;  5IGM A;  4NR8 A;  2YEL A;  5HEN A;  4O70 A;  5FB1 A;  4IOO A;  1WUM A;  4C66 A;  5CY9 A;  4E96 A;  3U5L A;  3SVF A;  2OO1 A;  4XUB A;  4HXL A;  5L96 A;  5I80 A;  4J0R A;  5A5R A;  3D7C A;  4NRC A;  5CUA A;  4LYI A;  4TTE A;  3UW9 A;  4TZ2 A;  3P1F A;  4LR6 A;  5L97 A;  4CUT A;  3AQA A;  1N72 A;  4UYE A;  5I83 A;  4YBS A;  4YBT A;  4GPJ A;  4NYW A;  5EWV A;  4NR6 A;  4HBV A;  1E6I A;  4QSP A;  3K2J A;  4FLP A;  5ETD A;  2DKW A;  3QZT A;  5DLX A;  4QSU A;  4DON A;  4MR4 A;  3FKM X;  4QST A;  1F68 A;  4BW1 A;  4YYK A;  4KV4 A;  4UIT A;  5LJ0 A;  4MEO A;  4WIV A;  5CUD A;  5EQ1 A;  3NXB A;  4TQN A;  5CFW A;  4UIX A;  4RVR A;  5DKC A;  5DLZ A;  4NXJ A;  2OUO A;  4CFK A;  5LKX A;  2DWW A;  3SVG A;  5D3J A;  4IR5 A;  1JM4 B;  3S92 A;  4QSW A;  5FB0 A;  3LQJ A;  5KHM A;  3UVD A;  2YQD A;  5AD3 A;  5DYC A;  4OUF A;  3UV4 A;  4O74 A;  2RO1 A;  5HRX A;  4A9K A;  4YAT A;  5F5Z A;  5D3P A;  5DFB A;  5FDZ A;  4CUR A;  4YH3 A;  4NR9 A;  5HFQ A;  3P5O A;  5IID A;  4Q0N A;  2DVQ A;  5CUC A;  5HCL A;  5EM3 A;  4HBW A;  5D7X A;  5E9V A;  2RI7 A;  4O7A A;  5D0C A;  5FE8 A;  4J0S A;  5ENF A;  2YW5 A;  5CUG A;  3ONI A;  4QSV A;  4ZQL A;  4Z6I A;  3U5J A;  2H60 A;  4UYD A;  4Q0O A;  4PCE A;  4F3I A;  5CU8 A;  5COI A;  4YBM A;  4QEV A;  3UVY A;  1ZS5 A;  3Q2E A;  5C89 A;  4QUU A;  4TT2 A;  5ENH A;  5D26 A;  5J0D A;  4N4I A;  4QR5 A;  5E0R A;  5D24 A;  2G4A A;  5I86 A;  5D3L A;  4QR3 A;  5EIS A;  5KU3 A;  4PTB A;  3DWY A;  3MB3 A;  2E3K A;  4J3I A;  2E7N A;  5FG5 A;  4HBY A;  2DVS A;  3U5K A;  4A9E A;  4QUT A;  5D3H A;  5ENE A;  2F6J A;  4QC3 A;  5EVA A;  3RCW A;  4C67 A;  4QNS A;  5ETB A;  5E7D A;  4Z93 A;  5A81 A;  4MR3 A;  5L8T A;  3U5N A;  4MEN A;  5LJ2 A;  5E74 A;  4QYD A;  2YEM A;  3O35 A;  4HXR A;  5C85 A;  4UIV A;  5KO4 A;  4LRG A;  4QYL A;  5A5N A;  5CPE A;  3IU5 A;  3O33 A;  2R0V A;  4CUQ A;  2DVR A;  4LYS A;  5LUU A;  4X2I A;  4NR7 A;  4YYJ A;  3O37 A;  4YYG A;  5FE7 A;  2DVV A;  4N4H A;  4YY6 A;  5CQ7 A;  5EV9 A;  3JVL A;  5DYX A;  5H1U A;  5CUE A;  5KTX A;  4UYF B;  5F61 A;  5HEM A;  4A9I A;  5TB6 A;  2RNY A;  5EWW A;  5A5S A;  2RNX A;  5A5P A;  1X0J A;  5E3G A;  2L84 A;  5D3R A;  3I3J A;  5I29 A;  4YAB A;  5EI4 A;  4BW4 A;  3UV2 A;  5L8U A;  4O7C A;  3LXJ A;  5CQ6 A;  4TT6 A;  5I89 A;  5F36 A;  5CUB A;  4BW2 A;  4CUP A;  1WUG A;  4YK0 A;  4TZ8 A;  5F2P A;  5LKZ A;  5H1V A;  5I7X A;  5EWD A;  4CUU A;  4CFL A;  2FSA A;  4O7B A;  4XY8 A;  4HXN A;  5AMF A;  4ALH A;  2WP2 A;  2RNW A;  2R0S A;  1EQF A;  5H1T A;  3P1C A;  5D25 A;  4TU4 A;  4IR3 A;  3HMH A;  4NUC A;  5EPR A;  5FFV A;  4NR5 A;  5LKU A;  5C87 A;  5A83 A;  4TT4 A;  5FH7 A;  4QSQ A;  4UYG A;  5CP5 A;  4UIZ A;  3G0L A;  5CQ4 A;  2D9E A;  4N4G A;  5A5Q A;  3AAD A;  5DW2 A;  3JVK A;  4WHU A;  2R0Y A;  3QZV A;  5DX4 A;  5CZG A;  5E9I A;  3O36 A;  4O76 A;  3LQI A;  2NXB A;  5LKT A;  4O72 A;  4IOQ A;  5AME A;  5LJ1 A;  5HRV A;  3JVM A;  3QZS A;  5JI8 A;  4NYV A;  5C4Q A;  4HXM A;  5CQ8 A;  4PY6 A;  5EPB A;  5CQA A;  5HQ5 A;  3UV5 A;  4J1P A;  3P1D A;  4QY4 A;  2D82 A;  5IG6 A;  5HQ7 A;  4O7F A;  5IGK A;  5DYU A;  4A9F A;  4O77 A;  5F25 A;  5FFY A;  4O75 A;  4HXO A;  4QR4 A;  5KTU A;  3U5O A;  5FE1 A;  2L85 A;  3O34 A;  4YYN A;  4NRB A;  4NUE A;  4LC2 A;  5DKH A;  4PKL A;  5HQ6 A;  2I7K A;  2DAT A;  4NS5 A;  4CUS A;  4N4F A;  5ENG A;  2YDW A;  4NUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...