4LR6A

Structure of brd4 bromodomain 1 with a 3-methyl-4-phenylisoxazol-5-amine fragment
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
125
structure length
125
Chain Sequence
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Discovery, Design, and Optimization of Isoxazole Azepine BET Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator/inhibitor
total genus 43
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4lr6A01
4UYEA 5I40A 4TTEA 3ONIA 4NUEA 3UW9A 5EV9A 3NXBA 2DVVA 5ENCA 5L8UA 5CGPA 4QSTA 4HXPA 4WIVA 2YEKA 5IBNA 5A82A 4NR6A 2F6JA 3TLPA 5AMEA 5EU1A 4UIUA 4QSPA 4QB3A 3QZVA 5C4QA 4QSSA 4NRAA 4AKNA 4XY9A 5CUGA 5H1VA 2E3KA 2H60A 4QYDA 2YDWA 4N4IA 4QSUA 4CFKA 5DLXA 5E9VA 4QUUA 4BW2A 5I83A 5A5PA 4MEOA 5AMFA 3U5KA 5F25A 5ACYA 5LVQA 5HQ7A 5CRMA 4HXRA 5CY9A 4N4HA 4X2IA 4O72A 5EWHA 5LVRA 5EWDA 2RNWA 4NS5A 3HMHA 5EPSA 4J0SA 4PTBA 5D3TA 4HXNA 4E96A 4YBMA 3O36A 3HMEA 5CQ6A 3DAIA 5ENJA 5FFYA 4YYDA 4YC9A 5L98A 4YH4A 4ZW1A 5HRXA 4NYVA 4CUSA 2NXBA 4QY4A 3MB3A 3MB4A 3MXFA 5E9LA 4YYMA 5E73A 4UIYA 4CUUA 5C87A 5FE1A 5L96A 4N4GA 4NUCA 5D3JA 2I7KA 5KO4A 4A9JA 5EWWA 4ZQLA 2YYNA 5CQAA 4Q0NA 4N4FA 5H1UA 4PS5A 1JSPB 3O33A 5A5SA 3JVKA 4QUTA 4KV4A 3U5JA 2E7OA 4LZ2A 4O7CA 4NR5A 4UYFA 5DFCA 5LJ0A 5E0RA 5CP5A 5HJCA 4MR3A 2I8NA 5L99A 4UYHA 5ENGA 4O7BA 4QZSA 3UV2A 4F3IA 4O75A 3P1FA 5FB1A 5DY7A 5DKHA 4A9OA 4O74A 5I7XA 3U5LA 3G0JA 4FLPA 4O7FA 5CQ8A 2MJVB 5A5OA 4YYGA 4LRGA 5KTXA 3IU6A 4LDFA 4TT2A 4C67A 2G4AA 5I88A 5EICA 5IGKA 4KV1A 4IR3A 4NYWA 5ENFA 5CRZA 4J3IA 5BT3A 4TQNA 5HRWA 3U5MA 4MENA 4YAXA 4RVRA 5CQ5A 2YW5A 4YYNA 5F1HA 5IGMA 4HBXA 5E9IA 3P1CA 5J0DA 3P5OA 4IOOA 3U5OA 5F62A 4QC3A 5F61A 5FH7A 2WP1A 5LKXA 5HCLA 5EM3A 4MEQA 5IG6A 5A5QA 5L8TA 2RI7A 4QSQA 5FE8A 5ETDA 5EPBA 4YATA 4MR6A 5FG6A 5FFWA 5A81A 4IR5A 5CUAA 5EWCA 2D9EA 5EK9A 3UVXA 4YADA 1N72A 4J1PA 5FE3A 5FE7A 5LKTA 4LYSA 5F60A 3QZTA 5F1LA 3O37A 5DFDA 5ENHA 4A9HA 4HXLA 4TS8A 1ZS5A 5FFVA 4QR5A 2DVQA 4BW1A 4QR4A 4TZ2A 5HEMA 4DONA 4WHWA 5F36A 4C66A 2GRCA 4TT6A 4LZRA 5ENIA 4BW4A 5HELA 4YYIA 4UIXA 5HRVA 4YY4A 4CLBA 4NR4A 2DVSA 4PCEA 5D3PA 4NRBA 4XUAA 5F63A 5E3DA 5LJ1A 4O71A 5D3HA 4OGIA 4A9KA 4BHWA 3S91A 3K2JA 2OSSA 4N3WA 4NQNA 4TZ8A 5CUDA 2DKWA 2DVRA 2L85A 3UV5A 4XY8A 5A85A 3SVGA 5DKCA 5I86A 5DKDA 4LR6A 4QEWA 4CURA 4HXKA 5I80A 5IIDA 5F2PA 3G0LA 4UYFB 4UIVA 4IR4A 4PY6A 5HLSA 5LJ2A 5E7DA 5L97A 4TT4A 4QSWA 3RCWA 4PCIA 3LXJA 5A5RA 5F3AA 5E9YA 5CUCA 5FB0A 5HFRA 5KHMA 2D82A 2E7NA 4NUDA 5EP7A 5IGLA 5EGUA 2WP2A 5E9KA 5D3NA 3LJWA 4TU4A 4UIWA 5ENBA 5FH6A 1JM4B 4OUFA 4Q0OA 4QEUA 5K29A 5HENA 4LYIA 2R10A 4CUQA 5KTUA 2L84A 4IORA 4O7EA 4CUTA 4HBVA 5JWMA 3LQHA 4UITA 5H1TA 3JVMA 5CUEA 5I1QA 4QYLA 5CZGA 4PKLA 5FE4A 4ZC9A 4NQMA 3S92A 4QNSA 4MR4A 5EVAA 1EQFA 5F5ZA 2YEMA 5FBXA 4UYGA 5CQ4A 4A9MA 3U5NA 5G4SA 4LYWA 4CFLA 5E3GA 5FE9A 5JI8A 5FDZA 5II1A 5I29A 4A9NA 4CL9A 5KTWA 3ZYUA 4O78A 5D3SA 4Z6IA 3SVFA 4IOQA 2R0YA 4TYLA 5G4RA 1WUGA 5EQ1A 2RNXA 4CUPA 5LKZA 3O35A 4Y03A 4XUBA 5C89A 4QEVA 5D24A 5CU8A 4NR9A 4MEPA 3O34A 3UVYA 2LSPB 4GPJA 3UV4A 1X0JA 2YQDA 5CPEA 4XYAA 5HQ6A 3FKMX 4O77A 5CFWA 5A5NA 5E74A 5DX4A 5CQTA 4HBYA 3AQAA 4NXJA 5A7CA 5HM0A 5IGNA 3JVLA 3AADA 5FG4A 4YY6A 5AD2A 4O76A 5E9MA 4QSXA 5DFBA 5EPRA 3P1DA 3Q2EA 2YELA 2L5EA 4IR6A 4YBSA 5AD3A 4UIZA 2KTBB 4HXMA 2OO1A 4A9IA 5D3RA 4YYKA 4NYXA 4QSVA 5I7YA 1E6IA 5EWVA 5D0CA 4YH3A 5KU3A 4J0RA 1F68A 2FSAA 3D7CA 5ETBA 4Z93A 4QSRA 5II2A 2F6NA 5DYXA 4YYHA 4QR3A 5ENEA 5BT4A 4Z6HA 4LC2A 3MULA 5DYAA 5DBMA 5EISA 5FH8A 5C7NA 4QC1A 5EI4A 3QZSA 4YYJA 2N9GA 2RS9B 4A9EA 4NR8A 4ALGA 3LQJA 4WHUA 5BT5A 5DYUA 4ALHA 5D26A 4HBWA 2OUOA 3P1EA 4MR5A 2RFJA 4BW3A 5C8GA 4A9LA 5H85A 2DWWA 4NR7A 2R0SA 5DW1A 5FE2A 5D25A 5DW2A 5TCMA 4QBMA 4O7AA 4BJXA 4UYDA 4TU6A 4NRCA 4O70A 3LQIA 3JVJA 4YABA 5DYCA 3HMFA 5DLZA 3UVWA 5CTLA 5FE0A 3Q2FA 4HXSA 5CQ7A 2R0VA 5HFQA 3SVHA 5C85A 2RNYA 4Z1SA 3GG3A 4OGJA 5LUUA 5D3LA 2DATA 3I3JA 5CQ3A 5CUBA 4LZSA 5CS8A 5D7XA 2RO1A 5A83A 4HXOA 5FE5A 5EA1A 5I89A 5TB6A 4YBTA 4KCXA 3MUKA 5FE6A 3MQMA 3DWYA 1WUMA 5LKUA 5COIA 4A9FA 3UVDA 3U5PA 5FG5A 3IU5A 4Z1QA 5HQ5A 4YK0A
chains in the Genus database with same CATH superfamily
4UYEA 5I40A 4TTEA 3ONIA 4NUEA 3UW9A 5EV9A 3NXBA 2DVVA 5ENCA 5L8UA 5CGPA 4QSTA 4HXPA 4WIVA 2YEKA 5IBNA 5A82A 4NR6A 2F6JA 3D1BA 3TLPA 5AMEA 5EU1A 4UIUA 4QSPA 4QB3A 3QZVA 5C4QA 4QSSA 4NRAA 4AKNA 4XY9A 5CUGA 5H1VA 2E3KA 2H60A 4QYDA 2YDWA 4N4IA 4QSUA 4CFKA 5DLXA 5E9VA 4QUUA 4BW2A 5I83A 5A5PA 4MEOA 5AMFA 3U5KA 5F25A 5ACYA 5LVQA 5HQ7A 5CRMA 4HXRA 5CY9A 4N4HA 4X2IA 4O72A 5EWHA 5LVRA 5EWDA 2RNWA 4NS5A 3HMHA 5EPSA 4J0SA 4PTBA 5D3TA 4HXNA 4E96A 4YBMA 3O36A 3HMEA 5CQ6A 3DAIA 5ENJA 5FFYA 4YYDA 4YC9A 5L98A 4YH4A 4ZW1A 5HRXA 4NYVA 4CUSA 2NXBA 4QY4A 3MB3A 3MB4A 3MXFA 5E9LA 4YYMA 5E73A 4UIYA 4CUUA 5C87A 5FE1A 5L96A 4N4GA 4NUCA 5D3JA 2I7KA 5KO4A 4A9JA 5EWWA 4ZQLA 2YYNA 5CQAA 4Q0NA 4N4FA 5H1UA 4PS5A 1JSPB 3O33A 5A5SA 3JVKA 4QUTA 4KV4A 3U5JA 2E7OA 4LZ2A 4O7CA 4NR5A 4UYFA 5DFCA 5LJ0A 5E0RA 5CP5A 5HJCA 4MR3A 2I8NA 5L99A 4UYHA 5ENGA 4O7BA 4QZSA 3UV2A 4F3IA 4O75A 3P1FA 5FB1A 5DY7A 5DKHA 4A9OA 4O74A 5I7XA 3U5LA 3G0JA 4FLPA 4O7FA 5CQ8A 2MJVB 5A5OA 4YYGA 4LRGA 5KTXA 3IU6A 4LDFA 4TT2A 4C67A 2G4AA 5I88A 5EICA 5IGKA 4KV1A 4IR3A 4NYWA 5ENFA 5CRZA 4J3IA 5BT3A 4TQNA 5HRWA 3U5MA 4MENA 4YAXA 4RVRA 5CQ5A 3D1DA 2YW5A 4YYNA 5F1HA 5IGMA 4HBXA 5E9IA 3P1CA 5J0DA 3P5OA 4IOOA 3U5OA 5F62A 4QC3A 5F61A 5FH7A 2WP1A 5LKXA 4AKHA 5HCLA 5EM3A 4MEQA 5IG6A 5A5QA 5L8TA 2RI7A 4QSQA 5FE8A 5ETDA 5EPBA 4YATA 4MR6A 5FG6A 5FFWA 5A81A 4IR5A 5CUAA 5EWCA 2D9EA 5EK9A 3UVXA 4YADA 1N72A 4J1PA 5FE3A 5FE7A 5LKTA 4AI6A 4LYSA 5F60A 3QZTA 5F1LA 3O37A 5DFDA 5ENHA 4A9HA 4HXLA 4TS8A 1ZS5A 5FFVA 4QR5A 2DVQA 4BW1A 3VKGA 4QR4A 4TZ2A 5HEMA 4DONA 4WHWA 5F36A 4C66A 2GRCA 4TT6A 4LZRA 5ENIA 4BW4A 5HELA 4YYIA 4UIXA 5HRVA 4YY4A 4CLBA 4NR4A 2DVSA 4PCEA 5D3PA 4NRBA 4XUAA 5F63A 5E3DA 5LJ1A 4O71A 5D3HA 4OGIA 3ERRA 4A9KA 4BHWA 3S91A 3K2JA 2OSSA 4N3WA 4NQNA 1PUOA 4TZ8A 5CUDA 2DKWA 2DVRA 2L85A 3UV5A 4XY8A 5A85A 3SVGA 5DKCA 5I86A 5DKDA 4LR6A 4QEWA 4CURA 4HXKA 5I80A 5IIDA 5F2PA 3G0LA 4UYFB 4UIVA 4IR4A 4PY6A 5HLSA 5LJ2A 5E7DA 5L97A 4TT4A 4QSWA 3RCWA 4PCIA 3LXJA 5A5RA 4AKGA 5F3AA 5E9YA 5CUCA 5FB0A 5HFRA 5KHMA 2D82A 2E7NA 4NUDA 5EP7A 5IGLA 5EGUA 2WP2A 5E9KA 5D3NA 3LJWA 4TU4A 4UIWA 5ENBA 5FH6A 1JM4B 4OUFA 4Q0OA 4QEUA 5K29A 5HENA 4LYIA 2R10A 4CUQA 5KTUA 2L84A 4IORA 4O7EA 4CUTA 4HBVA 5JWMA 3LQHA 4UITA 5H1TA 3JVMA 5CUEA 5I1QA 4QYLA 5CZGA 4PKLA 5FE4A 4ZC9A 4NQMA 3S92A 4QNSA 4MR4A 5EVAA 1EQFA 5F5ZA 2YEMA 5FBXA 4UYGA 5CQ4A 4A9MA 3U5NA 2EJNA 5G4SA 4LYWA 4CFLA 5E3GA 5FE9A 5JI8A 5FDZA 5II1A 5I29A 4A9NA 4CL9A 5KTWA 3ZYUA 4O78A 5D3SA 4Z6IA 3SVFA 4IOQA 2R0YA 4TYLA 5G4RA 1WUGA 5EQ1A 2RNXA 4CUPA 5LKZA 3O35A 4Y03A 4XUBA 5C89A 4QEVA 5D24A 5CU8A 4NR9A 4MEPA 3O34A 3UVYA 2LSPB 4GPJA 3UV4A 1X0JA 2YQDA 5CPEA 4XYAA 5HQ6A 3FKMX 4O77A 5CFWA 5A5NA 5E74A 5DX4A 5CQTA 4HBYA 3AQAA 4NXJA 5A7CA 5HM0A 5IGNA 3JVLA 3AADA 5FG4A 4YY6A 5AD2A 4O76A 5E9MA 4QSXA 5DFBA 5EPRA 3P1DA 3Q2EA 2YELA 2L5EA 4IR6A 4YBSA 5AD3A 4UIZA 2KTBB 4HXMA 2OO1A 4A9IA 5D3RA 4YYKA 4NYXA 4QSVA 5I7YA 1E6IA 5EWVA 5D0CA 4YH3A 5KU3A 4J0RA 1F68A 2FSAA 3D7CA 5ETBA 4Z93A 4QSRA 5II2A 2F6NA 5DYXA 4YYHA 4QR3A 5ENEA 5BT4A 4Z6HA 4LC2A 3MULA 5DYAA 5DBMA 5EISA 5FH8A 5C7NA 3VKHA 4QC1A 5EI4A 3QZSA 4YYJA 2N9GA 2RS9B 4A9EA 4NR8A 4ALGA 3LQJA 1ZKRA 4WHUA 5DYUA 4ALHA 5BT5A 5D26A 4HBWA 2OUOA 3P1EA 4MR5A 2RFJA 4BW3A 5C8GA 4A9LA 5H85A 2DWWA 4NR7A 2R0SA 5DW1A 5FE2A 5D25A 5DW2A 5TCMA 4QBMA 4O7AA 4BJXA 4UYDA 4TU6A 4NRCA 4O70A 3LQIA 3JVJA 4YABA 5DYCA 3HMFA 5DLZA 4AKIA 3UVWA 5CTLA 5FE0A 3Q2FA 4HXSA 5CQ7A 2R0VA 5HFQA 3SVHA 5C85A 2RNYA 4Z1SA 3GG3A 4OGJA 5LUUA 5D3LA 2DATA 3I3JA 5CQ3A 5CUBA 4LZSA 5CS8A 5D7XA 2RO1A 5A83A 4HXOA 5FE5A 5EA1A 5I89A 5TB6A 4YBTA 4KCXA 3MUKA 5FE6A 3MQMA 3DWYA 1WUMA 5LKUA 5COIA 4A9FA 3UVDA 3U5PA 5FG5A 3IU5A 4Z1QA 5HQ5A 4YK0A
chains in the Genus database with same CATH topology
4UYEA 5I40A 4TTEA 3ONIA 4NUEA 3UW9A 5EV9A 3NXBA 2DVVA 5ENCA 5L8UA 5CGPA 4QSTA 4HXPA 4WIVA 2YEKA 5IBNA 5A82A 4NR6A 2F6JA 3TLPA 5AMEA 5EU1A 4UIUA 4QSPA 4QB3A 3QZVA 5C4QA 4QSSA 4NRAA 4AKNA 4XY9A 5CUGA 5H1VA 2E3KA 2H60A 4QYDA 2YDWA 4N4IA 4QSUA 4CFKA 5DLXA 5E9VA 4QUUA 4BW2A 5I83A 5A5PA 4MEOA 5AMFA 3U5KA 5F25A 5ACYA 5LVQA 5HQ7A 5CRMA 4HXRA 5CY9A 4N4HA 4X2IA 4O72A 5EWHA 5LVRA 5EWDA 2RNWA 4NS5A 3HMHA 5EPSA 4J0SA 4PTBA 5D3TA 4HXNA 4E96A 4YBMA 3O36A 3HMEA 5CQ6A 3DAIA 5ENJA 5FFYA 4YYDA 4YC9A 5L98A 4YH4A 4ZW1A 5HRXA 4NYVA 4CUSA 2NXBA 4QY4A 3MB3A 3MB4A 3MXFA 5E9LA 4YYMA 5E73A 4UIYA 4CUUA 5C87A 5FE1A 5L96A 4N4GA 4NUCA 5D3JA 2I7KA 5KO4A 4A9JA 5EWWA 4ZQLA 2YYNA 5CQAA 4Q0NA 4N4FA 5H1UA 4PS5A 1JSPB 3O33A 5A5SA 3JVKA 4QUTA 4KV4A 3U5JA 2E7OA 4LZ2A 4O7CA 4NR5A 4UYFA 5DFCA 5LJ0A 5E0RA 5CP5A 5HJCA 4MR3A 2I8NA 5L99A 4UYHA 5ENGA 4O7BA 4QZSA 3UV2A 4F3IA 4O75A 3P1FA 5FB1A 5DY7A 5DKHA 4A9OA 4O74A 5I7XA 3U5LA 3G0JA 4FLPA 4O7FA 5CQ8A 2MJVB 5A5OA 4YYGA 4LRGA 5KTXA 3IU6A 4LDFA 4TT2A 4C67A 2G4AA 5I88A 5EICA 5IGKA 4KV1A 4IR3A 4NYWA 5ENFA 5CRZA 4J3IA 5BT3A 4TQNA 5HRWA 3U5MA 4MENA 4YAXA 4RVRA 5CQ5A 2YW5A 4YYNA 5F1HA 5IGMA 4HBXA 5E9IA 3P1CA 5J0DA 3P5OA 4IOOA 3U5OA 5F62A 4QC3A 5F61A 5FH7A 2WP1A 5LKXA 5HCLA 5EM3A 4MEQA 5IG6A 5A5QA 5L8TA 2RI7A 4QSQA 5FE8A 5ETDA 5EPBA 4YATA 4MR6A 5FG6A 5FFWA 5A81A 4IR5A 5CUAA 5EWCA 2D9EA 5EK9A 3UVXA 4YADA 1N72A 4J1PA 5FE3A 5FE7A 5LKTA 4LYSA 5F60A 3QZTA 5F1LA 3O37A 5DFDA 5ENHA 4A9HA 4HXLA 4TS8A 1ZS5A 5FFVA 4QR5A 2DVQA 4BW1A 4QR4A 4TZ2A 5HEMA 4DONA 4WHWA 5F36A 4C66A 2GRCA 4TT6A 4LZRA 5ENIA 4BW4A 5HELA 4YYIA 4UIXA 5HRVA 4YY4A 4CLBA 4NR4A 2DVSA 4PCEA 5D3PA 4NRBA 4XUAA 5F63A 5E3DA 5LJ1A 4O71A 5D3HA 4OGIA 4A9KA 4BHWA 3S91A 3K2JA 2OSSA 4N3WA 4NQNA 4TZ8A 5CUDA 2DKWA 2DVRA 2L85A 3UV5A 4XY8A 5A85A 3SVGA 5DKCA 5I86A 5DKDA 4LR6A 4QEWA 4CURA 4HXKA 5I80A 5IIDA 5F2PA 3G0LA 4UYFB 4UIVA 4IR4A 4PY6A 5HLSA 5LJ2A 5E7DA 5L97A 4TT4A 4QSWA 3RCWA 4PCIA 3LXJA 5A5RA 5F3AA 5E9YA 5CUCA 5FB0A 5HFRA 5KHMA 2D82A 2E7NA 4NUDA 5EP7A 5IGLA 5EGUA 2WP2A 5E9KA 5D3NA 3LJWA 4TU4A 4UIWA 5ENBA 5FH6A 1JM4B 4OUFA 4Q0OA 4QEUA 5K29A 5HENA 4LYIA 2R10A 4CUQA 5KTUA 2L84A 4IORA 4O7EA 4CUTA 4HBVA 5JWMA 3LQHA 4UITA 5H1TA 3JVMA 5CUEA 5I1QA 4QYLA 5CZGA 4PKLA 5FE4A 4ZC9A 4NQMA 3S92A 4QNSA 4MR4A 5EVAA 1EQFA 5F5ZA 2YEMA 5FBXA 4UYGA 5CQ4A 4A9MA 3U5NA 5G4SA 4LYWA 4CFLA 5E3GA 5FE9A 5JI8A 5FDZA 5II1A 5I29A 4A9NA 4CL9A 5KTWA 3ZYUA 4O78A 5D3SA 4Z6IA 3SVFA 4IOQA 2R0YA 4TYLA 5G4RA 1WUGA 5EQ1A 2RNXA 4CUPA 5LKZA 3O35A 4Y03A 4XUBA 5C89A 4QEVA 5D24A 5CU8A 4NR9A 4MEPA 3O34A 3UVYA 2LSPB 4GPJA 3UV4A 1X0JA 2YQDA 5CPEA 4XYAA 5HQ6A 3FKMX 4O77A 5CFWA 5A5NA 5E74A 5DX4A 5CQTA 4HBYA 3AQAA 4NXJA 5A7CA 5HM0A 5IGNA 3JVLA 3AADA 5FG4A 4YY6A 5AD2A 4O76A 5E9MA 4QSXA 5DFBA 5EPRA 3P1DA 3Q2EA 2YELA 2L5EA 4IR6A 4YBSA 5AD3A 4UIZA 2KTBB 4HXMA 2OO1A 4A9IA 5D3RA 4YYKA 4NYXA 4QSVA 5I7YA 1E6IA 5EWVA 5D0CA 4YH3A 5KU3A 4J0RA 1F68A 2FSAA 3D7CA 5ETBA 4Z93A 4QSRA 5II2A 2F6NA 5DYXA 4YYHA 4QR3A 5ENEA 5BT4A 4Z6HA 4LC2A 3MULA 5DYAA 5DBMA 5EISA 5FH8A 5C7NA 4QC1A 5EI4A 3QZSA 4YYJA 2N9GA 2RS9B 4A9EA 4NR8A 4ALGA 3LQJA 4WHUA 5BT5A 5DYUA 4ALHA 5D26A 4HBWA 2OUOA 3P1EA 4MR5A 2RFJA 4BW3A 5C8GA 4A9LA 5H85A 2DWWA 4NR7A 2R0SA 5DW1A 5FE2A 5D25A 5DW2A 5TCMA 4QBMA 4O7AA 4BJXA 4UYDA 4TU6A 4NRCA 4O70A 3LQIA 3JVJA 4YABA 5DYCA 3HMFA 5DLZA 3UVWA 5CTLA 5FE0A 3Q2FA 4HXSA 5CQ7A 2R0VA 5HFQA 3SVHA 5C85A 2RNYA 4Z1SA 3GG3A 4OGJA 5LUUA 5D3LA 2DATA 3I3JA 5CQ3A 5CUBA 4LZSA 5CS8A 5D7XA 2RO1A 5A83A 4HXOA 5FE5A 5EA1A 5I89A 5TB6A 4YBTA 4KCXA 3MUKA 5FE6A 3MQMA 3DWYA 1WUMA 5LKUA 5COIA 4A9FA 3UVDA 3U5PA 5FG5A 3IU5A 4Z1QA 5HQ5A 4YK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UYE A;  5I40 A;  4TTE A;  3ONI A;  4NUE A;  3UW9 A;  5EV9 A;  3NXB A;  2DVV A;  5ENC A;  5L8U A;  5CGP A;  4QST A;  4HXP A;  4WIV A;  2YEK A;  5IBN A;  5A82 A;  4NR6 A;  2F6J A;  3TLP A;  5AME A;  5EU1 A;  4UIU A;  4QSP A;  4QB3 A;  3QZV A;  5C4Q A;  4QSS A;  4NRA A;  4AKN A;  4XY9 A;  5CUG A;  5H1V A;  2E3K A;  2H60 A;  4QYD A;  2YDW A;  4N4I A;  4QSU A;  4CFK A;  5DLX A;  5E9V A;  4QUU A;  4BW2 A;  5I83 A;  5A5P A;  4MEO A;  5AMF A;  3U5K A;  5F25 A;  5ACY A;  5LVQ A;  5HQ7 A;  5CRM A;  4HXR A;  5CY9 A;  4N4H A;  4X2I A;  4O72 A;  5EWH A;  5LVR A;  5EWD A;  2RNW A;  4NS5 A;  3HMH A;  5EPS A;  4J0S A;  4PTB A;  5D3T A;  4HXN A;  4E96 A;  4YBM A;  3O36 A;  3HME A;  5CQ6 A;  3DAI A;  5ENJ A;  5FFY A;  4YYD A;  4YC9 A;  5L98 A;  4YH4 A;  4ZW1 A;  5HRX A;  4NYV A;  4CUS A;  2NXB A;  4QY4 A;  3MB3 A;  3MB4 A;  3MXF A;  5E9L A;  4YYM A;  5E73 A;  4UIY A;  4CUU A;  5C87 A;  5FE1 A;  5L96 A;  4N4G A;  4NUC A;  5D3J A;  2I7K A;  5KO4 A;  4A9J A;  5EWW A;  4ZQL A;  2YYN A;  5CQA A;  4Q0N A;  4N4F A;  5H1U A;  4PS5 A;  1JSP B;  3O33 A;  5A5S A;  3JVK A;  4QUT A;  4KV4 A;  3U5J A;  2E7O A;  4LZ2 A;  4O7C A;  4NR5 A;  4UYF A;  5DFC A;  5LJ0 A;  5E0R A;  5CP5 A;  5HJC A;  4MR3 A;  2I8N A;  5L99 A;  4UYH A;  5ENG A;  4O7B A;  4QZS A;  3UV2 A;  4F3I A;  4O75 A;  3P1F A;  5FB1 A;  5DY7 A;  5DKH A;  4A9O A;  4O74 A;  5I7X A;  3U5L A;  3G0J A;  4FLP A;  4O7F A;  5CQ8 A;  2MJV B;  5A5O A;  4YYG A;  4LRG A;  5KTX A;  3IU6 A;  4LDF A;  4TT2 A;  4C67 A;  2G4A A;  5I88 A;  5EIC A;  5IGK A;  4KV1 A;  4IR3 A;  4NYW A;  5ENF A;  5CRZ A;  4J3I A;  5BT3 A;  4TQN A;  5HRW A;  3U5M A;  4MEN A;  4YAX A;  4RVR A;  5CQ5 A;  2YW5 A;  4YYN A;  5F1H A;  5IGM A;  4HBX A;  5E9I A;  3P1C A;  5J0D A;  3P5O A;  4IOO A;  3U5O A;  5F62 A;  4QC3 A;  5F61 A;  5FH7 A;  2WP1 A;  5LKX A;  5HCL A;  5EM3 A;  4MEQ A;  5IG6 A;  5A5Q A;  5L8T A;  2RI7 A;  4QSQ A;  5FE8 A;  5ETD A;  5EPB A;  4YAT A;  4MR6 A;  5FG6 A;  5FFW A;  5A81 A;  4IR5 A;  5CUA A;  5EWC A;  2D9E A;  5EK9 A;  3UVX A;  4YAD A;  1N72 A;  4J1P A;  5FE3 A;  5FE7 A;  5LKT A;  4LYS A;  5F60 A;  3QZT A;  5F1L A;  3O37 A;  5DFD A;  5ENH A;  4A9H A;  4HXL A;  4TS8 A;  1ZS5 A;  5FFV A;  4QR5 A;  2DVQ A;  4BW1 A;  4QR4 A;  4TZ2 A;  5HEM A;  4DON A;  4WHW A;  5F36 A;  4C66 A;  2GRC A;  4TT6 A;  4LZR A;  5ENI A;  4BW4 A;  5HEL A;  4YYI A;  4UIX A;  5HRV A;  4YY4 A;  4CLB A;  4NR4 A;  2DVS A;  4PCE A;  5D3P A;  4NRB A;  4XUA A;  5F63 A;  5E3D A;  5LJ1 A;  4O71 A;  5D3H A;  4OGI A;  4A9K A;  4BHW A;  3S91 A;  3K2J A;  2OSS A;  4N3W A;  4NQN A;  4TZ8 A;  5CUD A;  2DKW A;  2DVR A;  2L85 A;  3UV5 A;  4XY8 A;  5A85 A;  3SVG A;  5DKC A;  5I86 A;  5DKD A;  4LR6 A;  4QEW A;  4CUR A;  4HXK A;  5I80 A;  5IID A;  5F2P A;  3G0L A;  4UYF B;  4UIV A;  4IR4 A;  4PY6 A;  5HLS A;  5LJ2 A;  5E7D A;  5L97 A;  4TT4 A;  4QSW A;  3RCW A;  4PCI A;  3LXJ A;  5A5R A;  5F3A A;  5E9Y A;  5CUC A;  5FB0 A;  5HFR A;  5KHM A;  2D82 A;  2E7N A;  4NUD A;  5EP7 A;  5IGL A;  5EGU A;  2WP2 A;  5E9K A;  5D3N A;  3LJW A;  4TU4 A;  4UIW A;  5ENB A;  5FH6 A;  1JM4 B;  4OUF A;  4Q0O A;  4QEU A;  5K29 A;  5HEN A;  4LYI A;  2R10 A;  4CUQ A;  5KTU A;  2L84 A;  4IOR A;  4O7E A;  4CUT A;  4HBV A;  5JWM A;  3LQH A;  4UIT A;  5H1T A;  3JVM A;  5CUE A;  5I1Q A;  4QYL A;  5CZG A;  4PKL A;  5FE4 A;  4ZC9 A;  4NQM A;  3S92 A;  4QNS A;  4MR4 A;  5EVA A;  1EQF A;  5F5Z A;  2YEM A;  5FBX A;  4UYG A;  5CQ4 A;  4A9M A;  3U5N A;  5G4S A;  4LYW A;  4CFL A;  5E3G A;  5FE9 A;  5JI8 A;  5FDZ A;  5II1 A;  5I29 A;  4A9N A;  4CL9 A;  5KTW A;  3ZYU A;  4O78 A;  5D3S A;  4Z6I A;  3SVF A;  4IOQ A;  2R0Y A;  4TYL A;  5G4R A;  1WUG A;  5EQ1 A;  2RNX A;  4CUP A;  5LKZ A;  3O35 A;  4Y03 A;  4XUB A;  5C89 A;  4QEV A;  5D24 A;  5CU8 A;  4NR9 A;  4MEP A;  3O34 A;  3UVY A;  2LSP B;  4GPJ A;  3UV4 A;  1X0J A;  2YQD A;  5CPE A;  4XYA A;  5HQ6 A;  3FKM X;  4O77 A;  5CFW A;  5A5N A;  5E74 A;  5DX4 A;  5CQT A;  4HBY A;  3AQA A;  4NXJ A;  5A7C A;  5HM0 A;  5IGN A;  3JVL A;  3AAD A;  5FG4 A;  4YY6 A;  5AD2 A;  4O76 A;  5E9M A;  4QSX A;  5DFB A;  5EPR A;  3P1D A;  3Q2E A;  2YEL A;  2L5E A;  4IR6 A;  4YBS A;  5AD3 A;  4UIZ A;  2KTB B;  4HXM A;  2OO1 A;  4A9I A;  5D3R A;  4YYK A;  4NYX A;  4QSV A;  5I7Y A;  1E6I A;  5EWV A;  5D0C A;  4YH3 A;  5KU3 A;  4J0R A;  1F68 A;  2FSA A;  3D7C A;  5ETB A;  4Z93 A;  4QSR A;  5II2 A;  2F6N A;  5DYX A;  4YYH A;  4QR3 A;  5ENE A;  5BT4 A;  4Z6H A;  4LC2 A;  3MUL A;  5DYA A;  5DBM A;  5EIS A;  5FH8 A;  5C7N A;  4QC1 A;  5EI4 A;  3QZS A;  4YYJ A;  2N9G A;  2RS9 B;  4A9E A;  4NR8 A;  4ALG A;  3LQJ A;  4WHU A;  5BT5 A;  5DYU A;  4ALH A;  5D26 A;  4HBW A;  2OUO A;  3P1E A;  4MR5 A;  2RFJ A;  4BW3 A;  5C8G A;  4A9L A;  5H85 A;  2DWW A;  4NR7 A;  2R0S A;  5DW1 A;  5FE2 A;  5D25 A;  5DW2 A;  5TCM A;  4QBM A;  4O7A A;  4BJX A;  4UYD A;  4TU6 A;  4NRC A;  4O70 A;  3LQI A;  3JVJ A;  4YAB A;  5DYC A;  3HMF A;  5DLZ A;  3UVW A;  5CTL A;  5FE0 A;  3Q2F A;  4HXS A;  5CQ7 A;  2R0V A;  5HFQ A;  3SVH A;  5C85 A;  2RNY A;  4Z1S A;  3GG3 A;  4OGJ A;  5LUU A;  5D3L A;  2DAT A;  3I3J A;  5CQ3 A;  5CUB A;  4LZS A;  5CS8 A;  5D7X A;  2RO1 A;  5A83 A;  4HXO A;  5FE5 A;  5EA1 A;  5I89 A;  5TB6 A;  4YBT A;  4KCX A;  3MUK A;  5FE6 A;  3MQM A;  3DWY A;  1WUM A;  5LKU A;  5COI A;  4A9F A;  3UVD A;  3U5P A;  5FG5 A;  3IU5 A;  4Z1Q A;  5HQ5 A;  4YK0 A; 
#chains in the Genus database with same CATH topology
 4UYE A;  5I40 A;  4TTE A;  3ONI A;  4NUE A;  3UW9 A;  5EV9 A;  3NXB A;  2DVV A;  5ENC A;  5L8U A;  5CGP A;  4QST A;  4HXP A;  4WIV A;  2YEK A;  5IBN A;  5A82 A;  4NR6 A;  2F6J A;  3D1B A;  3TLP A;  5AME A;  5EU1 A;  4UIU A;  4QSP A;  4QB3 A;  3QZV A;  5C4Q A;  4QSS A;  4NRA A;  4AKN A;  4XY9 A;  5CUG A;  5H1V A;  2E3K A;  2H60 A;  4QYD A;  2YDW A;  4N4I A;  4QSU A;  4CFK A;  5DLX A;  5E9V A;  4QUU A;  4BW2 A;  5I83 A;  5A5P A;  4MEO A;  5AMF A;  3U5K A;  5F25 A;  5ACY A;  5LVQ A;  5HQ7 A;  5CRM A;  4HXR A;  5CY9 A;  4N4H A;  4X2I A;  4O72 A;  5EWH A;  5LVR A;  5EWD A;  2RNW A;  4NS5 A;  3HMH A;  5EPS A;  4J0S A;  4PTB A;  5D3T A;  4HXN A;  4E96 A;  4YBM A;  3O36 A;  3HME A;  5CQ6 A;  3DAI A;  5ENJ A;  5FFY A;  4YYD A;  4YC9 A;  5L98 A;  4YH4 A;  4ZW1 A;  5HRX A;  4NYV A;  4CUS A;  2NXB A;  4QY4 A;  3MB3 A;  3MB4 A;  3MXF A;  5E9L A;  4YYM A;  5E73 A;  4UIY A;  4CUU A;  5C87 A;  5FE1 A;  5L96 A;  4N4G A;  4NUC A;  5D3J A;  2I7K A;  5KO4 A;  4A9J A;  5EWW A;  4ZQL A;  2YYN A;  5CQA A;  4Q0N A;  4N4F A;  5H1U A;  4PS5 A;  1JSP B;  3O33 A;  5A5S A;  3JVK A;  4QUT A;  4KV4 A;  3U5J A;  2E7O A;  4LZ2 A;  4O7C A;  4NR5 A;  4UYF A;  5DFC A;  5LJ0 A;  5E0R A;  5CP5 A;  5HJC A;  4MR3 A;  2I8N A;  5L99 A;  4UYH A;  5ENG A;  4O7B A;  4QZS A;  3UV2 A;  4F3I A;  4O75 A;  3P1F A;  5FB1 A;  5DY7 A;  5DKH A;  4A9O A;  4O74 A;  5I7X A;  3U5L A;  3G0J A;  4FLP A;  4O7F A;  5CQ8 A;  2MJV B;  5A5O A;  4YYG A;  4LRG A;  5KTX A;  3IU6 A;  4LDF A;  4TT2 A;  4C67 A;  2G4A A;  5I88 A;  5EIC A;  5IGK A;  4KV1 A;  4IR3 A;  4NYW A;  5ENF A;  5CRZ A;  4J3I A;  5BT3 A;  4TQN A;  5HRW A;  3U5M A;  4MEN A;  4YAX A;  4RVR A;  5CQ5 A;  3D1D A;  2YW5 A;  4YYN A;  5F1H A;  5IGM A;  4HBX A;  5E9I A;  3P1C A;  5J0D A;  3P5O A;  4IOO A;  3U5O A;  5F62 A;  4QC3 A;  5F61 A;  5FH7 A;  2WP1 A;  5LKX A;  4AKH A;  5HCL A;  5EM3 A;  4MEQ A;  5IG6 A;  5A5Q A;  5L8T A;  2RI7 A;  4QSQ A;  5FE8 A;  5ETD A;  5EPB A;  4YAT A;  4MR6 A;  5FG6 A;  5FFW A;  5A81 A;  4IR5 A;  5CUA A;  5EWC A;  2D9E A;  5EK9 A;  3UVX A;  4YAD A;  1N72 A;  4J1P A;  5FE3 A;  5FE7 A;  5LKT A;  4AI6 A;  4LYS A;  5F60 A;  3QZT A;  5F1L A;  3O37 A;  5DFD A;  5ENH A;  4A9H A;  4HXL A;  4TS8 A;  1ZS5 A;  5FFV A;  4QR5 A;  2DVQ A;  4BW1 A;  3VKG A;  4QR4 A;  4TZ2 A;  5HEM A;  4DON A;  4WHW A;  5F36 A;  4C66 A;  2GRC A;  4TT6 A;  4LZR A;  5ENI A;  4BW4 A;  5HEL A;  4YYI A;  4UIX A;  5HRV A;  4YY4 A;  4CLB A;  4NR4 A;  2DVS A;  4PCE A;  5D3P A;  4NRB A;  4XUA A;  5F63 A;  5E3D A;  5LJ1 A;  4O71 A;  5D3H A;  4OGI A;  3ERR A;  4A9K A;  4BHW A;  3S91 A;  3K2J A;  2OSS A;  4N3W A;  4NQN A;  1PUO A;  4TZ8 A;  5CUD A;  2DKW A;  2DVR A;  2L85 A;  3UV5 A;  4XY8 A;  5A85 A;  3SVG A;  5DKC A;  5I86 A;  5DKD A;  4LR6 A;  4QEW A;  4CUR A;  4HXK A;  5I80 A;  5IID A;  5F2P A;  3G0L A;  4UYF B;  4UIV A;  4IR4 A;  4PY6 A;  5HLS A;  5LJ2 A;  5E7D A;  5L97 A;  4TT4 A;  4QSW A;  3RCW A;  4PCI A;  3LXJ A;  5A5R A;  4AKG A;  5F3A A;  5E9Y A;  5CUC A;  5FB0 A;  5HFR A;  5KHM A;  2D82 A;  2E7N A;  4NUD A;  5EP7 A;  5IGL A;  5EGU A;  2WP2 A;  5E9K A;  5D3N A;  3LJW A;  4TU4 A;  4UIW A;  5ENB A;  5FH6 A;  1JM4 B;  4OUF A;  4Q0O A;  4QEU A;  5K29 A;  5HEN A;  4LYI A;  2R10 A;  4CUQ A;  5KTU A;  2L84 A;  4IOR A;  4O7E A;  4CUT A;  4HBV A;  5JWM A;  3LQH A;  4UIT A;  5H1T A;  3JVM A;  5CUE A;  5I1Q A;  4QYL A;  5CZG A;  4PKL A;  5FE4 A;  4ZC9 A;  4NQM A;  3S92 A;  4QNS A;  4MR4 A;  5EVA A;  1EQF A;  5F5Z A;  2YEM A;  5FBX A;  4UYG A;  5CQ4 A;  4A9M A;  3U5N A;  2EJN A;  5G4S A;  4LYW A;  4CFL A;  5E3G A;  5FE9 A;  5JI8 A;  5FDZ A;  5II1 A;  5I29 A;  4A9N A;  4CL9 A;  5KTW A;  3ZYU A;  4O78 A;  5D3S A;  4Z6I A;  3SVF A;  4IOQ A;  2R0Y A;  4TYL A;  5G4R A;  1WUG A;  5EQ1 A;  2RNX A;  4CUP A;  5LKZ A;  3O35 A;  4Y03 A;  4XUB A;  5C89 A;  4QEV A;  5D24 A;  5CU8 A;  4NR9 A;  4MEP A;  3O34 A;  3UVY A;  2LSP B;  4GPJ A;  3UV4 A;  1X0J A;  2YQD A;  5CPE A;  4XYA A;  5HQ6 A;  3FKM X;  4O77 A;  5CFW A;  5A5N A;  5E74 A;  5DX4 A;  5CQT A;  4HBY A;  3AQA A;  4NXJ A;  5A7C A;  5HM0 A;  5IGN A;  3JVL A;  3AAD A;  5FG4 A;  4YY6 A;  5AD2 A;  4O76 A;  5E9M A;  4QSX A;  5DFB A;  5EPR A;  3P1D A;  3Q2E A;  2YEL A;  2L5E A;  4IR6 A;  4YBS A;  5AD3 A;  4UIZ A;  2KTB B;  4HXM A;  2OO1 A;  4A9I A;  5D3R A;  4YYK A;  4NYX A;  4QSV A;  5I7Y A;  1E6I A;  5EWV A;  5D0C A;  4YH3 A;  5KU3 A;  4J0R A;  1F68 A;  2FSA A;  3D7C A;  5ETB A;  4Z93 A;  4QSR A;  5II2 A;  2F6N A;  5DYX A;  4YYH A;  4QR3 A;  5ENE A;  5BT4 A;  4Z6H A;  4LC2 A;  3MUL A;  5DYA A;  5DBM A;  5EIS A;  5FH8 A;  5C7N A;  3VKH A;  4QC1 A;  5EI4 A;  3QZS A;  4YYJ A;  2N9G A;  2RS9 B;  4A9E A;  4NR8 A;  4ALG A;  3LQJ A;  1ZKR A;  4WHU A;  5DYU A;  4ALH A;  5BT5 A;  5D26 A;  4HBW A;  2OUO A;  3P1E A;  4MR5 A;  2RFJ A;  4BW3 A;  5C8G A;  4A9L A;  5H85 A;  2DWW A;  4NR7 A;  2R0S A;  5DW1 A;  5FE2 A;  5D25 A;  5DW2 A;  5TCM A;  4QBM A;  4O7A A;  4BJX A;  4UYD A;  4TU6 A;  4NRC A;  4O70 A;  3LQI A;  3JVJ A;  4YAB A;  5DYC A;  3HMF A;  5DLZ A;  4AKI A;  3UVW A;  5CTL A;  5FE0 A;  3Q2F A;  4HXS A;  5CQ7 A;  2R0V A;  5HFQ A;  3SVH A;  5C85 A;  2RNY A;  4Z1S A;  3GG3 A;  4OGJ A;  5LUU A;  5D3L A;  2DAT A;  3I3J A;  5CQ3 A;  5CUB A;  4LZS A;  5CS8 A;  5D7X A;  2RO1 A;  5A83 A;  4HXO A;  5FE5 A;  5EA1 A;  5I89 A;  5TB6 A;  4YBT A;  4KCX A;  3MUK A;  5FE6 A;  3MQM A;  3DWY A;  1WUM A;  5LKU A;  5COI A;  4A9F A;  3UVD A;  3U5P A;  5FG5 A;  3IU5 A;  4Z1Q A;  5HQ5 A;  4YK0 A; 
#chains in the Genus database with same CATH homology
 4UYE A;  5I40 A;  4TTE A;  3ONI A;  4NUE A;  3UW9 A;  5EV9 A;  3NXB A;  2DVV A;  5ENC A;  5L8U A;  5CGP A;  4QST A;  4HXP A;  4WIV A;  2YEK A;  5IBN A;  5A82 A;  4NR6 A;  2F6J A;  3TLP A;  5AME A;  5EU1 A;  4UIU A;  4QSP A;  4QB3 A;  3QZV A;  5C4Q A;  4QSS A;  4NRA A;  4AKN A;  4XY9 A;  5CUG A;  5H1V A;  2E3K A;  2H60 A;  4QYD A;  2YDW A;  4N4I A;  4QSU A;  4CFK A;  5DLX A;  5E9V A;  4QUU A;  4BW2 A;  5I83 A;  5A5P A;  4MEO A;  5AMF A;  3U5K A;  5F25 A;  5ACY A;  5LVQ A;  5HQ7 A;  5CRM A;  4HXR A;  5CY9 A;  4N4H A;  4X2I A;  4O72 A;  5EWH A;  5LVR A;  5EWD A;  2RNW A;  4NS5 A;  3HMH A;  5EPS A;  4J0S A;  4PTB A;  5D3T A;  4HXN A;  4E96 A;  4YBM A;  3O36 A;  3HME A;  5CQ6 A;  3DAI A;  5ENJ A;  5FFY A;  4YYD A;  4YC9 A;  5L98 A;  4YH4 A;  4ZW1 A;  5HRX A;  4NYV A;  4CUS A;  2NXB A;  4QY4 A;  3MB3 A;  3MB4 A;  3MXF A;  5E9L A;  4YYM A;  5E73 A;  4UIY A;  4CUU A;  5C87 A;  5FE1 A;  5L96 A;  4N4G A;  4NUC A;  5D3J A;  2I7K A;  5KO4 A;  4A9J A;  5EWW A;  4ZQL A;  2YYN A;  5CQA A;  4Q0N A;  4N4F A;  5H1U A;  4PS5 A;  1JSP B;  3O33 A;  5A5S A;  3JVK A;  4QUT A;  4KV4 A;  3U5J A;  2E7O A;  4LZ2 A;  4O7C A;  4NR5 A;  4UYF A;  5DFC A;  5LJ0 A;  5E0R A;  5CP5 A;  5HJC A;  4MR3 A;  2I8N A;  5L99 A;  4UYH A;  5ENG A;  4O7B A;  4QZS A;  3UV2 A;  4F3I A;  4O75 A;  3P1F A;  5FB1 A;  5DY7 A;  5DKH A;  4A9O A;  4O74 A;  5I7X A;  3U5L A;  3G0J A;  4FLP A;  4O7F A;  5CQ8 A;  2MJV B;  5A5O A;  4YYG A;  4LRG A;  5KTX A;  3IU6 A;  4LDF A;  4TT2 A;  4C67 A;  2G4A A;  5I88 A;  5EIC A;  5IGK A;  4KV1 A;  4IR3 A;  4NYW A;  5ENF A;  5CRZ A;  4J3I A;  5BT3 A;  4TQN A;  5HRW A;  3U5M A;  4MEN A;  4YAX A;  4RVR A;  5CQ5 A;  2YW5 A;  4YYN A;  5F1H A;  5IGM A;  4HBX A;  5E9I A;  3P1C A;  5J0D A;  3P5O A;  4IOO A;  3U5O A;  5F62 A;  4QC3 A;  5F61 A;  5FH7 A;  2WP1 A;  5LKX A;  5HCL A;  5EM3 A;  4MEQ A;  5IG6 A;  5A5Q A;  5L8T A;  2RI7 A;  4QSQ A;  5FE8 A;  5ETD A;  5EPB A;  4YAT A;  4MR6 A;  5FG6 A;  5FFW A;  5A81 A;  4IR5 A;  5CUA A;  5EWC A;  2D9E A;  5EK9 A;  3UVX A;  4YAD A;  1N72 A;  4J1P A;  5FE3 A;  5FE7 A;  5LKT A;  4LYS A;  5F60 A;  3QZT A;  5F1L A;  3O37 A;  5DFD A;  5ENH A;  4A9H A;  4HXL A;  4TS8 A;  1ZS5 A;  5FFV A;  4QR5 A;  2DVQ A;  4BW1 A;  4QR4 A;  4TZ2 A;  5HEM A;  4DON A;  4WHW A;  5F36 A;  4C66 A;  2GRC A;  4TT6 A;  4LZR A;  5ENI A;  4BW4 A;  5HEL A;  4YYI A;  4UIX A;  5HRV A;  4YY4 A;  4CLB A;  4NR4 A;  2DVS A;  4PCE A;  5D3P A;  4NRB A;  4XUA A;  5F63 A;  5E3D A;  5LJ1 A;  4O71 A;  5D3H A;  4OGI A;  4A9K A;  4BHW A;  3S91 A;  3K2J A;  2OSS A;  4N3W A;  4NQN A;  4TZ8 A;  5CUD A;  2DKW A;  2DVR A;  2L85 A;  3UV5 A;  4XY8 A;  5A85 A;  3SVG A;  5DKC A;  5I86 A;  5DKD A;  4LR6 A;  4QEW A;  4CUR A;  4HXK A;  5I80 A;  5IID A;  5F2P A;  3G0L A;  4UYF B;  4UIV A;  4IR4 A;  4PY6 A;  5HLS A;  5LJ2 A;  5E7D A;  5L97 A;  4TT4 A;  4QSW A;  3RCW A;  4PCI A;  3LXJ A;  5A5R A;  5F3A A;  5E9Y A;  5CUC A;  5FB0 A;  5HFR A;  5KHM A;  2D82 A;  2E7N A;  4NUD A;  5EP7 A;  5IGL A;  5EGU A;  2WP2 A;  5E9K A;  5D3N A;  3LJW A;  4TU4 A;  4UIW A;  5ENB A;  5FH6 A;  1JM4 B;  4OUF A;  4Q0O A;  4QEU A;  5K29 A;  5HEN A;  4LYI A;  2R10 A;  4CUQ A;  5KTU A;  2L84 A;  4IOR A;  4O7E A;  4CUT A;  4HBV A;  5JWM A;  3LQH A;  4UIT A;  5H1T A;  3JVM A;  5CUE A;  5I1Q A;  4QYL A;  5CZG A;  4PKL A;  5FE4 A;  4ZC9 A;  4NQM A;  3S92 A;  4QNS A;  4MR4 A;  5EVA A;  1EQF A;  5F5Z A;  2YEM A;  5FBX A;  4UYG A;  5CQ4 A;  4A9M A;  3U5N A;  5G4S A;  4LYW A;  4CFL A;  5E3G A;  5FE9 A;  5JI8 A;  5FDZ A;  5II1 A;  5I29 A;  4A9N A;  4CL9 A;  5KTW A;  3ZYU A;  4O78 A;  5D3S A;  4Z6I A;  3SVF A;  4IOQ A;  2R0Y A;  4TYL A;  5G4R A;  1WUG A;  5EQ1 A;  2RNX A;  4CUP A;  5LKZ A;  3O35 A;  4Y03 A;  4XUB A;  5C89 A;  4QEV A;  5D24 A;  5CU8 A;  4NR9 A;  4MEP A;  3O34 A;  3UVY A;  2LSP B;  4GPJ A;  3UV4 A;  1X0J A;  2YQD A;  5CPE A;  4XYA A;  5HQ6 A;  3FKM X;  4O77 A;  5CFW A;  5A5N A;  5E74 A;  5DX4 A;  5CQT A;  4HBY A;  3AQA A;  4NXJ A;  5A7C A;  5HM0 A;  5IGN A;  3JVL A;  3AAD A;  5FG4 A;  4YY6 A;  5AD2 A;  4O76 A;  5E9M A;  4QSX A;  5DFB A;  5EPR A;  3P1D A;  3Q2E A;  2YEL A;  2L5E A;  4IR6 A;  4YBS A;  5AD3 A;  4UIZ A;  2KTB B;  4HXM A;  2OO1 A;  4A9I A;  5D3R A;  4YYK A;  4NYX A;  4QSV A;  5I7Y A;  1E6I A;  5EWV A;  5D0C A;  4YH3 A;  5KU3 A;  4J0R A;  1F68 A;  2FSA A;  3D7C A;  5ETB A;  4Z93 A;  4QSR A;  5II2 A;  2F6N A;  5DYX A;  4YYH A;  4QR3 A;  5ENE A;  5BT4 A;  4Z6H A;  4LC2 A;  3MUL A;  5DYA A;  5DBM A;  5EIS A;  5FH8 A;  5C7N A;  4QC1 A;  5EI4 A;  3QZS A;  4YYJ A;  2N9G A;  2RS9 B;  4A9E A;  4NR8 A;  4ALG A;  3LQJ A;  4WHU A;  5BT5 A;  5DYU A;  4ALH A;  5D26 A;  4HBW A;  2OUO A;  3P1E A;  4MR5 A;  2RFJ A;  4BW3 A;  5C8G A;  4A9L A;  5H85 A;  2DWW A;  4NR7 A;  2R0S A;  5DW1 A;  5FE2 A;  5D25 A;  5DW2 A;  5TCM A;  4QBM A;  4O7A A;  4BJX A;  4UYD A;  4TU6 A;  4NRC A;  4O70 A;  3LQI A;  3JVJ A;  4YAB A;  5DYC A;  3HMF A;  5DLZ A;  3UVW A;  5CTL A;  5FE0 A;  3Q2F A;  4HXS A;  5CQ7 A;  2R0V A;  5HFQ A;  3SVH A;  5C85 A;  2RNY A;  4Z1S A;  3GG3 A;  4OGJ A;  5LUU A;  5D3L A;  2DAT A;  3I3J A;  5CQ3 A;  5CUB A;  4LZS A;  5CS8 A;  5D7X A;  2RO1 A;  5A83 A;  4HXO A;  5FE5 A;  5EA1 A;  5I89 A;  5TB6 A;  4YBT A;  4KCX A;  3MUK A;  5FE6 A;  3MQM A;  3DWY A;  1WUM A;  5LKU A;  5COI A;  4A9F A;  3UVD A;  3U5P A;  5FG5 A;  3IU5 A;  4Z1Q A;  5HQ5 A;  4YK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...