5TB6A

Structure of bromodomain of crebbp with a pyrazolo[4,3-c]pyridin fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
119
Chain Sequence
b'SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Discovery of New Bromodomain Scaffolds by Biosensor Fragment Screening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 119
sequence length 119
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5tb6A00
5CUCA 5L97A 4PCEA 4QR4A 4F3IA 4BW1A 5FFVA 4TQNA 5EICA 4A9EA 2D9EA 4QSVA 4IOQA 5FE0A 5CQAA 4J1PA 3Q2EA 2L5EA 3U5PA 5KTXA 4YYNA 5ETBA 3GG3A 2DVRA 4LRGA 4QC1A 4YBTA 4BW2A 2DKWA 4NYXA 4MEQA 5D7XA 5DYAA 5AD2A 4OUFA 5F61A 1X0JA 4NR4A 5G4RA 3P1CA 5ENHA 4UIWA 5TCMA 5ENJA 5A5OA 3JVMA 5HQ6A 5A82A 5CGPA 3MQMA 4NR7A 2R0VA 5AMEA 4WIVA 5I29A 2RNYA 3P1DA 4Z6IA 5H1VA 3QZTA 5A5SA 5ACYA 5FDZA 2N9GA 5AD3A 2GRCA 4YC9A 4QSSA 5DFBA 5EV9A 4CL9A 2I7KA 4HXLA 4Z93A 4YBMA 5ETDA 5EQ1A 2DVSA 4TT2A 5D0CA 4NXJA 5FE1A 4PCIA 5EWDA 5CUEA 2KTBB 4BW3A 5HCLA 5KO4A 5D3LA 4QYLA 4MR3A 5CY9A 5CZGA 5E9YA 3DAIA 4QC3A 3U5MA 4A9IA 2WP1A 2R0SA 3HMHA 5FFWA 5F1HA 5IIDA 4UYFA 4UYDA 4NR5A 5FG4A 2D82A 4Q0OA 5DYXA 4XY9A 5CUBA 4XY8A 2F6NA 5II1A 4NS5A 4HXOA 5E9KA 3SVFA 2DATA 3K2JA 2RO1A 2YEKA 5HELA 3TLPA 4LDFA 4O7EA 5CQ6A 2YW5A 5LJ0A 4HXNA 2YYNA 4ZC9A 5FE9A 3SVHA 4A9MA 4YAXA 5IG6A 2F6JA 3MUKA 4J0SA 4MR5A 4YYGA 4YYHA 4TZ2A 3AADA 5E7DA 5HJCA 5CQ7A 4O70A 5EVAA 5A5PA 5D25A 4O7AA 4QB3A 5I1QA 4CUQA 4O7FA 3IU5A 2L85A 4QEWA 5L98A 5F2PA 4CUUA 4QYDA 3UV2A 4N4HA 5H1UA 4LYWA 5J0DA 5JI8A 5FE7A 4BW4A 4YY6A 5ENGA 5F62A 5K29A 3U5JA 5I88A 3QZSA 5HQ7A 5FB0A 4MR4A 5HFQA 4TZ8A 2YQDA 4MR6A 5EWHA 4QZSA 5FFYA 5FE4A 2OO1A 4NR9A 4IR6A 3HMEA 5L96A 4QSQA 4NUCA 5D3JA 5G4SA 3G0LA 4NUDA 4ZQLA 5FH6A 4QR3A 1JSPB 4TT6A 5DW2A 4BHWA 5E9MA 4N3WA 5ENIA 2H60A 5E3GA 4LC2A 5L8TA 5CU8A 5KTWA 3MB3A 5DW1A 4HXKA 4YBSA 5CFWA 3U5LA 5F1LA 4NQNA 5F36A 4KV4A 5F25A 3G0JA 5F63A 5LVRA 5DX4A 4O76A 5HRVA 4IR3A 5IGKA 4A9NA 4C67A 5DBMA 5FG6A 5D3TA 4UIYA 3NXBA 5DY7A 5F60A 5F5ZA 4CUSA 5CP5A 2FSAA 3UW9A 4XYAA 3AQAA 4O71A 5EPBA 4Z1QA 2E7NA 4YYMA 4OGIA 4N4FA 5BT4A 5EK9A 1WUMA 4QSTA 4QNSA 4GPJA 5A5NA 5LJ2A 2YEMA 2I8NA 4HBWA 4UIVA 5FG5A 5A5RA 5BT5A 2R0YA 3MULA 5EA1A 2L84A 2RNWA 4FLPA 4A9HA 5ENBA 4LYSA 5EWVA 4Z1SA 4LYIA 5HFRA 4MENA 5EWWA 5CRZA 5FBXA 5ENFA 5LKTA 2RI7A 3U5OA 4QSUA 2LSPB 5D26A 5D3SA 5KHMA 4A9OA 5C4QA 5AMFA 5CQ3A 5C8GA 5I40A 4C66A 5DYUA 5C87A 4A9JA 5CS8A 5DYCA 2DVVA 4UIXA 3S92A 4CLBA 3QZVA 4J3IA 4YK0A 2RNXA 5JWMA 5L8UA 3SVGA 3UVWA 2DWWA 4YATA 3U5KA 5DFDA 4XUAA 4O74A 4X2IA 4TT4A 3I3JA 4TTEA 5F3AA 5EPRA 5D24A 5CUAA 4UYHA 2E3KA 5A5QA 5ENEA 3DWYA 4OGJA 1F68A 5FE8A 5FE6A 3MB4A 5IGLA 3P5OA 3O37A 4YYIA 3P1FA 3HMFA 4O72A 5FE2A 3JVLA 5FH7A 5CUDA 2RFJA 4A9FA 5LKZA 5CTLA 5I86A 5D3PA 2YDWA 5HQ5A 3U5NA 5DLXA 4TS8A 1WUGA 3O35A 4CFLA 5II2A 2MJVB 4ALHA 5I7YA 5DFCA 4QUTA 2WP2A 5EP7A 2E7OA 1E6IA 4LZSA 4PS5A 3D7CA 4UITA 4UIZA 2RS9B 4TU6A 5A85A 1EQFA 4YYKA 5TB6A 4BJXA 3JVJA 4NUEA 4CUTA 5E9IA 4IR5A 5EM3A 3LQJA 5L99A 5C85A 4IR4A 4O7CA 4Z6HA 3LJWA 3UVDA 3LQHA 5CQ8A 5KU3A 4O77A 1ZS5A 4YH3A 3LQIA 5LKUA 4QY4A 4Y03A 5EI4A 5CUGA 4NYWA 4PKLA 5DKCA 5LVQA 4HXPA 4O78A 4QBMA 5I80A 5LKXA 4LZ2A 5H85A 4MEPA 4IORA 4QSWA 4QSRA 4O7BA 5LUUA 4IOOA 5FE3A 5FH8A 4HBVA 4KV1A 4QUUA 5HLSA 5E3DA 5CQ4A 4NR6A 5ENCA 5BT3A 5HRXA 4QSPA 5H1TA 5CQ5A 4UYEA 4NYVA 4RVRA 4PTBA 2R10A 4CFKA 5HENA 4TU4A 1JM4B 4CURA 5HM0A 4HXMA 4HXSA 4J0RA 4HXRA 5D3RA 5DKHA 5A81A 3RCWA 3Q2FA 3JVKA 4N4GA 4YABA 3FKMX 4NQMA 5HEMA 5IBNA 4LR6A 4QEVA 5A7CA 3LXJA 4YYDA 5E9VA 3P1EA 5KTUA 5E74A 4QR5A 5D3NA 4DONA 5I7XA 2DVQA 4HBXA 5E73A 4HBYA 5E9LA 3ONIA 4QEUA 4WHWA 4WHUA 4NR8A 4YYJA 1N72A 5D3HA 5EISA 5FB1A 5EWCA 3UVXA 5HRWA 4ZW1A 4NRAA 5I83A 3O33A 5IGNA 3UV5A 3MXFA 4MEOA 4E96A 4YH4A 4Q0NA 2NXBA 5CRMA 5EU1A 4CUPA 3S91A 4XUBA 5DLZA 4A9KA 5EPSA 3IU6A 4UYFB 4AKNA 3UV4A 5IGMA 4PY6A 2G4AA 4NRBA 4UYGA 5A83A 4UIUA 5FE5A 4ALGA 4O75A 5DKDA 4NRCA 5I89A 4QSXA 4YADA 5COIA 4KCXA 5E0RA 4A9LA 5C7NA 2OSSA 2YELA 3O34A 3O36A 4YY4A 5CPEA 4LZRA 5LJ1A 5EGUA 5CQTA 4N4IA 5C89A 2OUOA 3UVYA 3ZYUA 4TYLA
chains in the Genus database with same CATH superfamily
5CUCA 5L97A 4PCEA 4QR4A 4F3IA 4BW1A 5FFVA 4TQNA 5EICA 4A9EA 2D9EA 4QSVA 4IOQA 5FE0A 5CQAA 4J1PA 3Q2EA 2L5EA 3U5PA 5KTXA 4YYNA 5ETBA 3GG3A 2DVRA 4LRGA 4QC1A 4YBTA 4BW2A 2DKWA 4NYXA 4MEQA 5D7XA 5DYAA 5AD2A 4OUFA 5F61A 1X0JA 4NR4A 5G4RA 3P1CA 5ENHA 4UIWA 5TCMA 5ENJA 5A5OA 3JVMA 5HQ6A 5A82A 5CGPA 3MQMA 4NR7A 2R0VA 5AMEA 4WIVA 5I29A 2RNYA 3P1DA 4Z6IA 5H1VA 3QZTA 5A5SA 5ACYA 5FDZA 2N9GA 5AD3A 2GRCA 4YC9A 4QSSA 5DFBA 4AI6A 5EV9A 4CL9A 2I7KA 4HXLA 4Z93A 4YBMA 5ETDA 3VKGA 5EQ1A 2DVSA 4TT2A 5D0CA 4NXJA 5FE1A 4PCIA 5EWDA 5CUEA 2KTBB 4BW3A 5HCLA 5KO4A 5D3LA 4QYLA 4MR3A 5CY9A 5CZGA 5E9YA 3DAIA 4QC3A 3U5MA 4A9IA 2WP1A 2R0SA 3HMHA 5FFWA 5F1HA 5IIDA 4UYFA 4UYDA 4NR5A 5FG4A 2D82A 4Q0OA 5DYXA 4XY9A 5CUBA 4XY8A 2F6NA 5II1A 4NS5A 4HXOA 5E9KA 3SVFA 2DATA 3K2JA 2RO1A 2YEKA 5HELA 3TLPA 4LDFA 4O7EA 5CQ6A 2YW5A 5LJ0A 1ZKRA 4HXNA 2YYNA 3D1DA 4ZC9A 5FE9A 3SVHA 4A9MA 4YAXA 5IG6A 2F6JA 3MUKA 4J0SA 4MR5A 4YYGA 4YYHA 4TZ2A 3AADA 5E7DA 5HJCA 5CQ7A 4O70A 5EVAA 5A5PA 5D25A 4O7AA 4QB3A 4AKIA 5I1QA 4CUQA 4O7FA 3IU5A 2L85A 4QEWA 5L98A 5F2PA 4CUUA 4QYDA 3UV2A 4N4HA 5H1UA 4LYWA 5J0DA 5JI8A 5FE7A 3ERRA 4BW4A 4YY6A 5ENGA 5F62A 5K29A 3U5JA 5I88A 3QZSA 5HQ7A 5FB0A 4MR4A 5HFQA 4TZ8A 2YQDA 4MR6A 5EWHA 4QZSA 5FFYA 5FE4A 2OO1A 4NR9A 4IR6A 3HMEA 5L96A 4QSQA 4NUCA 5D3JA 5G4SA 3G0LA 4NUDA 4ZQLA 5FH6A 4QR3A 1JSPB 4TT6A 5DW2A 4BHWA 5E9MA 4N3WA 5ENIA 2H60A 5E3GA 4LC2A 5L8TA 5CU8A 5KTWA 3MB3A 5DW1A 4HXKA 4YBSA 5CFWA 3U5LA 5F1LA 4NQNA 5F36A 4KV4A 5F25A 3G0JA 5F63A 5LVRA 5DX4A 4O76A 5HRVA 4IR3A 5IGKA 4A9NA 4C67A 5DBMA 5FG6A 3D1BA 5D3TA 4UIYA 3NXBA 5DY7A 5F60A 5F5ZA 4CUSA 5CP5A 2FSAA 3UW9A 4XYAA 3AQAA 4O71A 5EPBA 4Z1QA 2E7NA 4YYMA 4OGIA 4N4FA 5BT4A 5EK9A 1WUMA 4QSTA 4QNSA 4GPJA 5A5NA 5LJ2A 2YEMA 2I8NA 4HBWA 4UIVA 5FG5A 5A5RA 5BT5A 2R0YA 3MULA 5EA1A 2L84A 2RNWA 4FLPA 4A9HA 5ENBA 4LYSA 5EWVA 4Z1SA 4LYIA 5HFRA 4MENA 5EWWA 5CRZA 5FBXA 5ENFA 5LKTA 2RI7A 3U5OA 4QSUA 2LSPB 5D26A 5D3SA 5KHMA 4A9OA 5C4QA 5AMFA 5CQ3A 5C8GA 5I40A 4C66A 1PUOA 5DYUA 5C87A 4A9JA 5CS8A 5DYCA 2DVVA 4UIXA 3S92A 4CLBA 3QZVA 4J3IA 4YK0A 2RNXA 5JWMA 5L8UA 3SVGA 3UVWA 2DWWA 4YATA 3U5KA 5DFDA 4XUAA 4O74A 4X2IA 4TT4A 3I3JA 4TTEA 5F3AA 5EPRA 5D24A 5CUAA 4UYHA 2E3KA 5A5QA 5ENEA 3DWYA 4OGJA 1F68A 5FE8A 5FE6A 3MB4A 5IGLA 3P5OA 3O37A 4YYIA 3P1FA 3HMFA 4O72A 5FE2A 3JVLA 5FH7A 5CUDA 2RFJA 4A9FA 5LKZA 5CTLA 5I86A 5D3PA 2YDWA 5HQ5A 3U5NA 5DLXA 4TS8A 1WUGA 3O35A 4CFLA 5II2A 2MJVB 4ALHA 5I7YA 5DFCA 4QUTA 2WP2A 5EP7A 4AKHA 2E7OA 1E6IA 4LZSA 4PS5A 3D7CA 4UITA 4UIZA 2RS9B 4AKGA 4TU6A 5A85A 1EQFA 4YYKA 5TB6A 4BJXA 3JVJA 4NUEA 4CUTA 5E9IA 2EJNA 4IR5A 5EM3A 3LQJA 5L99A 5C85A 4IR4A 4O7CA 4Z6HA 3LJWA 3UVDA 3LQHA 5CQ8A 5KU3A 4O77A 4YH3A 1ZS5A 3LQIA 5LKUA 4QY4A 4Y03A 5EI4A 5CUGA 4NYWA 4PKLA 5DKCA 5LVQA 4HXPA 4O78A 4QBMA 5I80A 5LKXA 4LZ2A 5H85A 4MEPA 4IORA 4QSWA 4QSRA 4O7BA 5LUUA 4IOOA 5FE3A 5FH8A 4HBVA 4KV1A 4QUUA 5HLSA 5E3DA 5CQ4A 4NR6A 5ENCA 5BT3A 5HRXA 4QSPA 5H1TA 5CQ5A 4UYEA 4NYVA 4RVRA 4PTBA 2R10A 4CFKA 5HENA 4TU4A 1JM4B 4CURA 5HM0A 4HXMA 4HXSA 4J0RA 4HXRA 5D3RA 5DKHA 5A81A 3RCWA 3Q2FA 3JVKA 4N4GA 4YABA 3FKMX 4NQMA 5HEMA 5IBNA 4LR6A 4QEVA 5A7CA 3LXJA 4YYDA 5E9VA 3P1EA 5KTUA 5E74A 4QR5A 5D3NA 4DONA 5I7XA 2DVQA 4HBXA 5E73A 4HBYA 5E9LA 3ONIA 4QEUA 4WHWA 4WHUA 4NR8A 4YYJA 1N72A 5D3HA 5EISA 5FB1A 5EWCA 3UVXA 5HRWA 4ZW1A 4NRAA 5I83A 3O33A 5IGNA 3UV5A 3MXFA 4MEOA 3VKHA 4E96A 4YH4A 4Q0NA 2NXBA 5CRMA 5EU1A 4CUPA 3S91A 4XUBA 5DLZA 4A9KA 5EPSA 3IU6A 4UYFB 4AKNA 3UV4A 5IGMA 4PY6A 2G4AA 4NRBA 4UYGA 5A83A 4UIUA 5FE5A 4ALGA 4O75A 5DKDA 4NRCA 5I89A 4QSXA 4YADA 5COIA 4KCXA 5E0RA 4A9LA 5C7NA 2OSSA 2YELA 3O34A 3O36A 4YY4A 5CPEA 4LZRA 5LJ1A 5EGUA 5CQTA 4N4IA 5C89A 2OUOA 3UVYA 3ZYUA 4TYLA
chains in the Genus database with same CATH topology
5CUCA 5L97A 4PCEA 4QR4A 4F3IA 4BW1A 5FFVA 4TQNA 5EICA 4A9EA 2D9EA 4QSVA 4IOQA 5FE0A 5CQAA 4J1PA 3Q2EA 2L5EA 3U5PA 5KTXA 4YYNA 5ETBA 3GG3A 2DVRA 4LRGA 4QC1A 4YBTA 4BW2A 2DKWA 4NYXA 4MEQA 5D7XA 5DYAA 5AD2A 4OUFA 5F61A 1X0JA 4NR4A 5G4RA 3P1CA 5ENHA 4UIWA 5TCMA 5ENJA 5A5OA 3JVMA 5HQ6A 5A82A 5CGPA 3MQMA 4NR7A 2R0VA 5AMEA 4WIVA 5I29A 2RNYA 3P1DA 4Z6IA 5H1VA 3QZTA 5A5SA 5ACYA 5FDZA 2N9GA 5AD3A 2GRCA 4YC9A 4QSSA 5DFBA 5EV9A 4CL9A 2I7KA 4HXLA 4Z93A 4YBMA 5ETDA 5EQ1A 2DVSA 4TT2A 5D0CA 4NXJA 5FE1A 4PCIA 5EWDA 5CUEA 2KTBB 4BW3A 5HCLA 5KO4A 5D3LA 4QYLA 4MR3A 5CY9A 5CZGA 5E9YA 3DAIA 4QC3A 3U5MA 4A9IA 2WP1A 2R0SA 3HMHA 5FFWA 5F1HA 5IIDA 4UYFA 4UYDA 4NR5A 5FG4A 2D82A 4Q0OA 5DYXA 4XY9A 5CUBA 4XY8A 2F6NA 5II1A 4NS5A 4HXOA 5E9KA 3SVFA 2DATA 3K2JA 2RO1A 2YEKA 5HELA 3TLPA 4LDFA 4O7EA 5CQ6A 2YW5A 5LJ0A 4HXNA 2YYNA 4ZC9A 5FE9A 3SVHA 4A9MA 4YAXA 5IG6A 2F6JA 3MUKA 4J0SA 4MR5A 4YYGA 4YYHA 4TZ2A 3AADA 5E7DA 5HJCA 5CQ7A 4O70A 5EVAA 5A5PA 5D25A 4O7AA 4QB3A 5I1QA 4CUQA 4O7FA 3IU5A 2L85A 4QEWA 5L98A 5F2PA 4CUUA 4QYDA 3UV2A 4N4HA 5H1UA 4LYWA 5J0DA 5JI8A 5FE7A 4BW4A 4YY6A 5ENGA 5F62A 5K29A 3U5JA 5I88A 3QZSA 5HQ7A 5FB0A 4MR4A 5HFQA 4TZ8A 2YQDA 4MR6A 5EWHA 4QZSA 5FFYA 5FE4A 2OO1A 4NR9A 4IR6A 3HMEA 5L96A 4QSQA 4NUCA 5D3JA 5G4SA 3G0LA 4NUDA 4ZQLA 5FH6A 4QR3A 1JSPB 4TT6A 5DW2A 4BHWA 5E9MA 4N3WA 5ENIA 2H60A 5E3GA 4LC2A 5L8TA 5CU8A 5KTWA 3MB3A 5DW1A 4HXKA 4YBSA 5CFWA 3U5LA 5F1LA 4NQNA 5F36A 4KV4A 5F25A 3G0JA 5F63A 5LVRA 5DX4A 4O76A 5HRVA 4IR3A 5IGKA 4A9NA 4C67A 5DBMA 5FG6A 5D3TA 4UIYA 3NXBA 5DY7A 5F60A 5F5ZA 4CUSA 5CP5A 2FSAA 3UW9A 4XYAA 3AQAA 4O71A 5EPBA 4Z1QA 2E7NA 4YYMA 4OGIA 4N4FA 5BT4A 5EK9A 1WUMA 4QSTA 4QNSA 4GPJA 5A5NA 5LJ2A 2YEMA 2I8NA 4HBWA 4UIVA 5FG5A 5A5RA 5BT5A 2R0YA 3MULA 5EA1A 2L84A 2RNWA 4FLPA 4A9HA 5ENBA 4LYSA 5EWVA 4Z1SA 4LYIA 5HFRA 4MENA 5EWWA 5CRZA 5FBXA 5ENFA 5LKTA 2RI7A 3U5OA 4QSUA 2LSPB 5D26A 5D3SA 5KHMA 4A9OA 5C4QA 5AMFA 5CQ3A 5C8GA 5I40A 4C66A 5DYUA 5C87A 4A9JA 5CS8A 5DYCA 2DVVA 4UIXA 3S92A 4CLBA 3QZVA 4J3IA 4YK0A 2RNXA 5JWMA 5L8UA 3SVGA 3UVWA 2DWWA 4YATA 3U5KA 5DFDA 4XUAA 4O74A 4X2IA 4TT4A 3I3JA 4TTEA 5F3AA 5EPRA 5D24A 5CUAA 4UYHA 2E3KA 5A5QA 5ENEA 3DWYA 4OGJA 1F68A 5FE8A 5FE6A 3MB4A 5IGLA 3P5OA 3O37A 4YYIA 3P1FA 3HMFA 4O72A 5FE2A 3JVLA 5FH7A 5CUDA 2RFJA 4A9FA 5LKZA 5CTLA 5I86A 5D3PA 2YDWA 5HQ5A 3U5NA 5DLXA 4TS8A 1WUGA 3O35A 4CFLA 5II2A 2MJVB 4ALHA 5I7YA 5DFCA 4QUTA 2WP2A 5EP7A 2E7OA 1E6IA 4LZSA 4PS5A 3D7CA 4UITA 4UIZA 2RS9B 4TU6A 5A85A 1EQFA 4YYKA 5TB6A 4BJXA 3JVJA 4NUEA 4CUTA 5E9IA 4IR5A 5EM3A 3LQJA 5L99A 5C85A 4IR4A 4O7CA 4Z6HA 3LJWA 3UVDA 3LQHA 5CQ8A 5KU3A 4O77A 1ZS5A 4YH3A 3LQIA 5LKUA 4QY4A 4Y03A 5EI4A 5CUGA 4NYWA 4PKLA 5DKCA 5LVQA 4HXPA 4O78A 4QBMA 5I80A 5LKXA 4LZ2A 5H85A 4MEPA 4IORA 4QSWA 4QSRA 4O7BA 5LUUA 4IOOA 5FE3A 5FH8A 4HBVA 4KV1A 4QUUA 5HLSA 5E3DA 5CQ4A 4NR6A 5ENCA 5BT3A 5HRXA 4QSPA 5H1TA 5CQ5A 4UYEA 4NYVA 4RVRA 4PTBA 2R10A 4CFKA 5HENA 4TU4A 1JM4B 4CURA 5HM0A 4HXMA 4HXSA 4J0RA 4HXRA 5D3RA 5DKHA 5A81A 3RCWA 3Q2FA 3JVKA 4N4GA 4YABA 3FKMX 4NQMA 5HEMA 5IBNA 4LR6A 4QEVA 5A7CA 3LXJA 4YYDA 5E9VA 3P1EA 5KTUA 5E74A 4QR5A 5D3NA 4DONA 5I7XA 2DVQA 4HBXA 5E73A 4HBYA 5E9LA 3ONIA 4QEUA 4WHWA 4WHUA 4NR8A 4YYJA 1N72A 5D3HA 5EISA 5FB1A 5EWCA 3UVXA 5HRWA 4ZW1A 4NRAA 5I83A 3O33A 5IGNA 3UV5A 3MXFA 4MEOA 4E96A 4YH4A 4Q0NA 2NXBA 5CRMA 5EU1A 4CUPA 3S91A 4XUBA 5DLZA 4A9KA 5EPSA 3IU6A 4UYFB 4AKNA 3UV4A 5IGMA 4PY6A 2G4AA 4NRBA 4UYGA 5A83A 4UIUA 5FE5A 4ALGA 4O75A 5DKDA 4NRCA 5I89A 4QSXA 4YADA 5COIA 4KCXA 5E0RA 4A9LA 5C7NA 2OSSA 2YELA 3O34A 3O36A 4YY4A 5CPEA 4LZRA 5LJ1A 5EGUA 5CQTA 4N4IA 5C89A 2OUOA 3UVYA 3ZYUA 4TYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CUC A;  5L97 A;  4PCE A;  4QR4 A;  4F3I A;  4BW1 A;  5FFV A;  4TQN A;  5EIC A;  4A9E A;  2D9E A;  4QSV A;  4IOQ A;  5FE0 A;  5CQA A;  4J1P A;  3Q2E A;  2L5E A;  3U5P A;  5KTX A;  4YYN A;  5ETB A;  3GG3 A;  2DVR A;  4LRG A;  4QC1 A;  4YBT A;  4BW2 A;  2DKW A;  4NYX A;  4MEQ A;  5D7X A;  5DYA A;  5AD2 A;  4OUF A;  5F61 A;  1X0J A;  4NR4 A;  5G4R A;  3P1C A;  5ENH A;  4UIW A;  5TCM A;  5ENJ A;  5A5O A;  3JVM A;  5HQ6 A;  5A82 A;  5CGP A;  3MQM A;  4NR7 A;  2R0V A;  5AME A;  4WIV A;  5I29 A;  2RNY A;  3P1D A;  4Z6I A;  5H1V A;  3QZT A;  5A5S A;  5ACY A;  5FDZ A;  2N9G A;  5AD3 A;  2GRC A;  4YC9 A;  4QSS A;  5DFB A;  5EV9 A;  4CL9 A;  2I7K A;  4HXL A;  4Z93 A;  4YBM A;  5ETD A;  5EQ1 A;  2DVS A;  4TT2 A;  5D0C A;  4NXJ A;  5FE1 A;  4PCI A;  5EWD A;  5CUE A;  2KTB B;  4BW3 A;  5HCL A;  5KO4 A;  5D3L A;  4QYL A;  4MR3 A;  5CY9 A;  5CZG A;  5E9Y A;  3DAI A;  4QC3 A;  3U5M A;  4A9I A;  2WP1 A;  2R0S A;  3HMH A;  5FFW A;  5F1H A;  5IID A;  4UYF A;  4UYD A;  4NR5 A;  5FG4 A;  2D82 A;  4Q0O A;  5DYX A;  4XY9 A;  5CUB A;  4XY8 A;  2F6N A;  5II1 A;  4NS5 A;  4HXO A;  5E9K A;  3SVF A;  2DAT A;  3K2J A;  2RO1 A;  2YEK A;  5HEL A;  3TLP A;  4LDF A;  4O7E A;  5CQ6 A;  2YW5 A;  5LJ0 A;  4HXN A;  2YYN A;  4ZC9 A;  5FE9 A;  3SVH A;  4A9M A;  4YAX A;  5IG6 A;  2F6J A;  3MUK A;  4J0S A;  4MR5 A;  4YYG A;  4YYH A;  4TZ2 A;  3AAD A;  5E7D A;  5HJC A;  5CQ7 A;  4O70 A;  5EVA A;  5A5P A;  5D25 A;  4O7A A;  4QB3 A;  5I1Q A;  4CUQ A;  4O7F A;  3IU5 A;  2L85 A;  4QEW A;  5L98 A;  5F2P A;  4CUU A;  4QYD A;  3UV2 A;  4N4H A;  5H1U A;  4LYW A;  5J0D A;  5JI8 A;  5FE7 A;  4BW4 A;  4YY6 A;  5ENG A;  5F62 A;  5K29 A;  3U5J A;  5I88 A;  3QZS A;  5HQ7 A;  5FB0 A;  4MR4 A;  5HFQ A;  4TZ8 A;  2YQD A;  4MR6 A;  5EWH A;  4QZS A;  5FFY A;  5FE4 A;  2OO1 A;  4NR9 A;  4IR6 A;  3HME A;  5L96 A;  4QSQ A;  4NUC A;  5D3J A;  5G4S A;  3G0L A;  4NUD A;  4ZQL A;  5FH6 A;  4QR3 A;  1JSP B;  4TT6 A;  5DW2 A;  4BHW A;  5E9M A;  4N3W A;  5ENI A;  2H60 A;  5E3G A;  4LC2 A;  5L8T A;  5CU8 A;  5KTW A;  3MB3 A;  5DW1 A;  4HXK A;  4YBS A;  5CFW A;  3U5L A;  5F1L A;  4NQN A;  5F36 A;  4KV4 A;  5F25 A;  3G0J A;  5F63 A;  5LVR A;  5DX4 A;  4O76 A;  5HRV A;  4IR3 A;  5IGK A;  4A9N A;  4C67 A;  5DBM A;  5FG6 A;  5D3T A;  4UIY A;  3NXB A;  5DY7 A;  5F60 A;  5F5Z A;  4CUS A;  5CP5 A;  2FSA A;  3UW9 A;  4XYA A;  3AQA A;  4O71 A;  5EPB A;  4Z1Q A;  2E7N A;  4YYM A;  4OGI A;  4N4F A;  5BT4 A;  5EK9 A;  1WUM A;  4QST A;  4QNS A;  4GPJ A;  5A5N A;  5LJ2 A;  2YEM A;  2I8N A;  4HBW A;  4UIV A;  5FG5 A;  5A5R A;  5BT5 A;  2R0Y A;  3MUL A;  5EA1 A;  2L84 A;  2RNW A;  4FLP A;  4A9H A;  5ENB A;  4LYS A;  5EWV A;  4Z1S A;  4LYI A;  5HFR A;  4MEN A;  5EWW A;  5CRZ A;  5FBX A;  5ENF A;  5LKT A;  2RI7 A;  3U5O A;  4QSU A;  2LSP B;  5D26 A;  5D3S A;  5KHM A;  4A9O A;  5C4Q A;  5AMF A;  5CQ3 A;  5C8G A;  5I40 A;  4C66 A;  5DYU A;  5C87 A;  4A9J A;  5CS8 A;  5DYC A;  2DVV A;  4UIX A;  3S92 A;  4CLB A;  3QZV A;  4J3I A;  4YK0 A;  2RNX A;  5JWM A;  5L8U A;  3SVG A;  3UVW A;  2DWW A;  4YAT A;  3U5K A;  5DFD A;  4XUA A;  4O74 A;  4X2I A;  4TT4 A;  3I3J A;  4TTE A;  5F3A A;  5EPR A;  5D24 A;  5CUA A;  4UYH A;  2E3K A;  5A5Q A;  5ENE A;  3DWY A;  4OGJ A;  1F68 A;  5FE8 A;  5FE6 A;  3MB4 A;  5IGL A;  3P5O A;  3O37 A;  4YYI A;  3P1F A;  3HMF A;  4O72 A;  5FE2 A;  3JVL A;  5FH7 A;  5CUD A;  2RFJ A;  4A9F A;  5LKZ A;  5CTL A;  5I86 A;  5D3P A;  2YDW A;  5HQ5 A;  3U5N A;  5DLX A;  4TS8 A;  1WUG A;  3O35 A;  4CFL A;  5II2 A;  2MJV B;  4ALH A;  5I7Y A;  5DFC A;  4QUT A;  2WP2 A;  5EP7 A;  2E7O A;  1E6I A;  4LZS A;  4PS5 A;  3D7C A;  4UIT A;  4UIZ A;  2RS9 B;  4TU6 A;  5A85 A;  1EQF A;  4YYK A;  5TB6 A;  4BJX A;  3JVJ A;  4NUE A;  4CUT A;  5E9I A;  4IR5 A;  5EM3 A;  3LQJ A;  5L99 A;  5C85 A;  4IR4 A;  4O7C A;  4Z6H A;  3LJW A;  3UVD A;  3LQH A;  5CQ8 A;  5KU3 A;  4O77 A;  1ZS5 A;  4YH3 A;  3LQI A;  5LKU A;  4QY4 A;  4Y03 A;  5EI4 A;  5CUG A;  4NYW A;  4PKL A;  5DKC A;  5LVQ A;  4HXP A;  4O78 A;  4QBM A;  5I80 A;  5LKX A;  4LZ2 A;  5H85 A;  4MEP A;  4IOR A;  4QSW A;  4QSR A;  4O7B A;  5LUU A;  4IOO A;  5FE3 A;  5FH8 A;  4HBV A;  4KV1 A;  4QUU A;  5HLS A;  5E3D A;  5CQ4 A;  4NR6 A;  5ENC A;  5BT3 A;  5HRX A;  4QSP A;  5H1T A;  5CQ5 A;  4UYE A;  4NYV A;  4RVR A;  4PTB A;  2R10 A;  4CFK A;  5HEN A;  4TU4 A;  1JM4 B;  4CUR A;  5HM0 A;  4HXM A;  4HXS A;  4J0R A;  4HXR A;  5D3R A;  5DKH A;  5A81 A;  3RCW A;  3Q2F A;  3JVK A;  4N4G A;  4YAB A;  3FKM X;  4NQM A;  5HEM A;  5IBN A;  4LR6 A;  4QEV A;  5A7C A;  3LXJ A;  4YYD A;  5E9V A;  3P1E A;  5KTU A;  5E74 A;  4QR5 A;  5D3N A;  4DON A;  5I7X A;  2DVQ A;  4HBX A;  5E73 A;  4HBY A;  5E9L A;  3ONI A;  4QEU A;  4WHW A;  4WHU A;  4NR8 A;  4YYJ A;  1N72 A;  5D3H A;  5EIS A;  5FB1 A;  5EWC A;  3UVX A;  5HRW A;  4ZW1 A;  4NRA A;  5I83 A;  3O33 A;  5IGN A;  3UV5 A;  3MXF A;  4MEO A;  4E96 A;  4YH4 A;  4Q0N A;  2NXB A;  5CRM A;  5EU1 A;  4CUP A;  3S91 A;  4XUB A;  5DLZ A;  4A9K A;  5EPS A;  3IU6 A;  4UYF B;  4AKN A;  3UV4 A;  5IGM A;  4PY6 A;  2G4A A;  4NRB A;  4UYG A;  5A83 A;  4UIU A;  5FE5 A;  4ALG A;  4O75 A;  5DKD A;  4NRC A;  5I89 A;  4QSX A;  4YAD A;  5COI A;  4KCX A;  5E0R A;  4A9L A;  5C7N A;  2OSS A;  2YEL A;  3O34 A;  3O36 A;  4YY4 A;  5CPE A;  4LZR A;  5LJ1 A;  5EGU A;  5CQT A;  4N4I A;  5C89 A;  2OUO A;  3UVY A;  3ZYU A;  4TYL A; 
#chains in the Genus database with same CATH topology
 5CUC A;  5L97 A;  4PCE A;  4QR4 A;  4F3I A;  4BW1 A;  5FFV A;  4TQN A;  5EIC A;  4A9E A;  2D9E A;  4QSV A;  4IOQ A;  5FE0 A;  5CQA A;  4J1P A;  3Q2E A;  2L5E A;  3U5P A;  5KTX A;  4YYN A;  5ETB A;  3GG3 A;  2DVR A;  4LRG A;  4QC1 A;  4YBT A;  4BW2 A;  2DKW A;  4NYX A;  4MEQ A;  5D7X A;  5DYA A;  5AD2 A;  4OUF A;  5F61 A;  1X0J A;  4NR4 A;  5G4R A;  3P1C A;  5ENH A;  4UIW A;  5TCM A;  5ENJ A;  5A5O A;  3JVM A;  5HQ6 A;  5A82 A;  5CGP A;  3MQM A;  4NR7 A;  2R0V A;  5AME A;  4WIV A;  5I29 A;  2RNY A;  3P1D A;  4Z6I A;  5H1V A;  3QZT A;  5A5S A;  5ACY A;  5FDZ A;  2N9G A;  5AD3 A;  2GRC A;  4YC9 A;  4QSS A;  5DFB A;  4AI6 A;  5EV9 A;  4CL9 A;  2I7K A;  4HXL A;  4Z93 A;  4YBM A;  5ETD A;  3VKG A;  5EQ1 A;  2DVS A;  4TT2 A;  5D0C A;  4NXJ A;  5FE1 A;  4PCI A;  5EWD A;  5CUE A;  2KTB B;  4BW3 A;  5HCL A;  5KO4 A;  5D3L A;  4QYL A;  4MR3 A;  5CY9 A;  5CZG A;  5E9Y A;  3DAI A;  4QC3 A;  3U5M A;  4A9I A;  2WP1 A;  2R0S A;  3HMH A;  5FFW A;  5F1H A;  5IID A;  4UYF A;  4UYD A;  4NR5 A;  5FG4 A;  2D82 A;  4Q0O A;  5DYX A;  4XY9 A;  5CUB A;  4XY8 A;  2F6N A;  5II1 A;  4NS5 A;  4HXO A;  5E9K A;  3SVF A;  2DAT A;  3K2J A;  2RO1 A;  2YEK A;  5HEL A;  3TLP A;  4LDF A;  4O7E A;  5CQ6 A;  2YW5 A;  5LJ0 A;  1ZKR A;  4HXN A;  2YYN A;  3D1D A;  4ZC9 A;  5FE9 A;  3SVH A;  4A9M A;  4YAX A;  5IG6 A;  2F6J A;  3MUK A;  4J0S A;  4MR5 A;  4YYG A;  4YYH A;  4TZ2 A;  3AAD A;  5E7D A;  5HJC A;  5CQ7 A;  4O70 A;  5EVA A;  5A5P A;  5D25 A;  4O7A A;  4QB3 A;  4AKI A;  5I1Q A;  4CUQ A;  4O7F A;  3IU5 A;  2L85 A;  4QEW A;  5L98 A;  5F2P A;  4CUU A;  4QYD A;  3UV2 A;  4N4H A;  5H1U A;  4LYW A;  5J0D A;  5JI8 A;  5FE7 A;  3ERR A;  4BW4 A;  4YY6 A;  5ENG A;  5F62 A;  5K29 A;  3U5J A;  5I88 A;  3QZS A;  5HQ7 A;  5FB0 A;  4MR4 A;  5HFQ A;  4TZ8 A;  2YQD A;  4MR6 A;  5EWH A;  4QZS A;  5FFY A;  5FE4 A;  2OO1 A;  4NR9 A;  4IR6 A;  3HME A;  5L96 A;  4QSQ A;  4NUC A;  5D3J A;  5G4S A;  3G0L A;  4NUD A;  4ZQL A;  5FH6 A;  4QR3 A;  1JSP B;  4TT6 A;  5DW2 A;  4BHW A;  5E9M A;  4N3W A;  5ENI A;  2H60 A;  5E3G A;  4LC2 A;  5L8T A;  5CU8 A;  5KTW A;  3MB3 A;  5DW1 A;  4HXK A;  4YBS A;  5CFW A;  3U5L A;  5F1L A;  4NQN A;  5F36 A;  4KV4 A;  5F25 A;  3G0J A;  5F63 A;  5LVR A;  5DX4 A;  4O76 A;  5HRV A;  4IR3 A;  5IGK A;  4A9N A;  4C67 A;  5DBM A;  5FG6 A;  3D1B A;  5D3T A;  4UIY A;  3NXB A;  5DY7 A;  5F60 A;  5F5Z A;  4CUS A;  5CP5 A;  2FSA A;  3UW9 A;  4XYA A;  3AQA A;  4O71 A;  5EPB A;  4Z1Q A;  2E7N A;  4YYM A;  4OGI A;  4N4F A;  5BT4 A;  5EK9 A;  1WUM A;  4QST A;  4QNS A;  4GPJ A;  5A5N A;  5LJ2 A;  2YEM A;  2I8N A;  4HBW A;  4UIV A;  5FG5 A;  5A5R A;  5BT5 A;  2R0Y A;  3MUL A;  5EA1 A;  2L84 A;  2RNW A;  4FLP A;  4A9H A;  5ENB A;  4LYS A;  5EWV A;  4Z1S A;  4LYI A;  5HFR A;  4MEN A;  5EWW A;  5CRZ A;  5FBX A;  5ENF A;  5LKT A;  2RI7 A;  3U5O A;  4QSU A;  2LSP B;  5D26 A;  5D3S A;  5KHM A;  4A9O A;  5C4Q A;  5AMF A;  5CQ3 A;  5C8G A;  5I40 A;  4C66 A;  1PUO A;  5DYU A;  5C87 A;  4A9J A;  5CS8 A;  5DYC A;  2DVV A;  4UIX A;  3S92 A;  4CLB A;  3QZV A;  4J3I A;  4YK0 A;  2RNX A;  5JWM A;  5L8U A;  3SVG A;  3UVW A;  2DWW A;  4YAT A;  3U5K A;  5DFD A;  4XUA A;  4O74 A;  4X2I A;  4TT4 A;  3I3J A;  4TTE A;  5F3A A;  5EPR A;  5D24 A;  5CUA A;  4UYH A;  2E3K A;  5A5Q A;  5ENE A;  3DWY A;  4OGJ A;  1F68 A;  5FE8 A;  5FE6 A;  3MB4 A;  5IGL A;  3P5O A;  3O37 A;  4YYI A;  3P1F A;  3HMF A;  4O72 A;  5FE2 A;  3JVL A;  5FH7 A;  5CUD A;  2RFJ A;  4A9F A;  5LKZ A;  5CTL A;  5I86 A;  5D3P A;  2YDW A;  5HQ5 A;  3U5N A;  5DLX A;  4TS8 A;  1WUG A;  3O35 A;  4CFL A;  5II2 A;  2MJV B;  4ALH A;  5I7Y A;  5DFC A;  4QUT A;  2WP2 A;  5EP7 A;  4AKH A;  2E7O A;  1E6I A;  4LZS A;  4PS5 A;  3D7C A;  4UIT A;  4UIZ A;  2RS9 B;  4AKG A;  4TU6 A;  5A85 A;  1EQF A;  4YYK A;  5TB6 A;  4BJX A;  3JVJ A;  4NUE A;  4CUT A;  5E9I A;  2EJN A;  4IR5 A;  5EM3 A;  3LQJ A;  5L99 A;  5C85 A;  4IR4 A;  4O7C A;  4Z6H A;  3LJW A;  3UVD A;  3LQH A;  5CQ8 A;  5KU3 A;  4O77 A;  4YH3 A;  1ZS5 A;  3LQI A;  5LKU A;  4QY4 A;  4Y03 A;  5EI4 A;  5CUG A;  4NYW A;  4PKL A;  5DKC A;  5LVQ A;  4HXP A;  4O78 A;  4QBM A;  5I80 A;  5LKX A;  4LZ2 A;  5H85 A;  4MEP A;  4IOR A;  4QSW A;  4QSR A;  4O7B A;  5LUU A;  4IOO A;  5FE3 A;  5FH8 A;  4HBV A;  4KV1 A;  4QUU A;  5HLS A;  5E3D A;  5CQ4 A;  4NR6 A;  5ENC A;  5BT3 A;  5HRX A;  4QSP A;  5H1T A;  5CQ5 A;  4UYE A;  4NYV A;  4RVR A;  4PTB A;  2R10 A;  4CFK A;  5HEN A;  4TU4 A;  1JM4 B;  4CUR A;  5HM0 A;  4HXM A;  4HXS A;  4J0R A;  4HXR A;  5D3R A;  5DKH A;  5A81 A;  3RCW A;  3Q2F A;  3JVK A;  4N4G A;  4YAB A;  3FKM X;  4NQM A;  5HEM A;  5IBN A;  4LR6 A;  4QEV A;  5A7C A;  3LXJ A;  4YYD A;  5E9V A;  3P1E A;  5KTU A;  5E74 A;  4QR5 A;  5D3N A;  4DON A;  5I7X A;  2DVQ A;  4HBX A;  5E73 A;  4HBY A;  5E9L A;  3ONI A;  4QEU A;  4WHW A;  4WHU A;  4NR8 A;  4YYJ A;  1N72 A;  5D3H A;  5EIS A;  5FB1 A;  5EWC A;  3UVX A;  5HRW A;  4ZW1 A;  4NRA A;  5I83 A;  3O33 A;  5IGN A;  3UV5 A;  3MXF A;  4MEO A;  3VKH A;  4E96 A;  4YH4 A;  4Q0N A;  2NXB A;  5CRM A;  5EU1 A;  4CUP A;  3S91 A;  4XUB A;  5DLZ A;  4A9K A;  5EPS A;  3IU6 A;  4UYF B;  4AKN A;  3UV4 A;  5IGM A;  4PY6 A;  2G4A A;  4NRB A;  4UYG A;  5A83 A;  4UIU A;  5FE5 A;  4ALG A;  4O75 A;  5DKD A;  4NRC A;  5I89 A;  4QSX A;  4YAD A;  5COI A;  4KCX A;  5E0R A;  4A9L A;  5C7N A;  2OSS A;  2YEL A;  3O34 A;  3O36 A;  4YY4 A;  5CPE A;  4LZR A;  5LJ1 A;  5EGU A;  5CQT A;  4N4I A;  5C89 A;  2OUO A;  3UVY A;  3ZYU A;  4TYL A; 
#chains in the Genus database with same CATH homology
 5CUC A;  5L97 A;  4PCE A;  4QR4 A;  4F3I A;  4BW1 A;  5FFV A;  4TQN A;  5EIC A;  4A9E A;  2D9E A;  4QSV A;  4IOQ A;  5FE0 A;  5CQA A;  4J1P A;  3Q2E A;  2L5E A;  3U5P A;  5KTX A;  4YYN A;  5ETB A;  3GG3 A;  2DVR A;  4LRG A;  4QC1 A;  4YBT A;  4BW2 A;  2DKW A;  4NYX A;  4MEQ A;  5D7X A;  5DYA A;  5AD2 A;  4OUF A;  5F61 A;  1X0J A;  4NR4 A;  5G4R A;  3P1C A;  5ENH A;  4UIW A;  5TCM A;  5ENJ A;  5A5O A;  3JVM A;  5HQ6 A;  5A82 A;  5CGP A;  3MQM A;  4NR7 A;  2R0V A;  5AME A;  4WIV A;  5I29 A;  2RNY A;  3P1D A;  4Z6I A;  5H1V A;  3QZT A;  5A5S A;  5ACY A;  5FDZ A;  2N9G A;  5AD3 A;  2GRC A;  4YC9 A;  4QSS A;  5DFB A;  5EV9 A;  4CL9 A;  2I7K A;  4HXL A;  4Z93 A;  4YBM A;  5ETD A;  5EQ1 A;  2DVS A;  4TT2 A;  5D0C A;  4NXJ A;  5FE1 A;  4PCI A;  5EWD A;  5CUE A;  2KTB B;  4BW3 A;  5HCL A;  5KO4 A;  5D3L A;  4QYL A;  4MR3 A;  5CY9 A;  5CZG A;  5E9Y A;  3DAI A;  4QC3 A;  3U5M A;  4A9I A;  2WP1 A;  2R0S A;  3HMH A;  5FFW A;  5F1H A;  5IID A;  4UYF A;  4UYD A;  4NR5 A;  5FG4 A;  2D82 A;  4Q0O A;  5DYX A;  4XY9 A;  5CUB A;  4XY8 A;  2F6N A;  5II1 A;  4NS5 A;  4HXO A;  5E9K A;  3SVF A;  2DAT A;  3K2J A;  2RO1 A;  2YEK A;  5HEL A;  3TLP A;  4LDF A;  4O7E A;  5CQ6 A;  2YW5 A;  5LJ0 A;  4HXN A;  2YYN A;  4ZC9 A;  5FE9 A;  3SVH A;  4A9M A;  4YAX A;  5IG6 A;  2F6J A;  3MUK A;  4J0S A;  4MR5 A;  4YYG A;  4YYH A;  4TZ2 A;  3AAD A;  5E7D A;  5HJC A;  5CQ7 A;  4O70 A;  5EVA A;  5A5P A;  5D25 A;  4O7A A;  4QB3 A;  5I1Q A;  4CUQ A;  4O7F A;  3IU5 A;  2L85 A;  4QEW A;  5L98 A;  5F2P A;  4CUU A;  4QYD A;  3UV2 A;  4N4H A;  5H1U A;  4LYW A;  5J0D A;  5JI8 A;  5FE7 A;  4BW4 A;  4YY6 A;  5ENG A;  5F62 A;  5K29 A;  3U5J A;  5I88 A;  3QZS A;  5HQ7 A;  5FB0 A;  4MR4 A;  5HFQ A;  4TZ8 A;  2YQD A;  4MR6 A;  5EWH A;  4QZS A;  5FFY A;  5FE4 A;  2OO1 A;  4NR9 A;  4IR6 A;  3HME A;  5L96 A;  4QSQ A;  4NUC A;  5D3J A;  5G4S A;  3G0L A;  4NUD A;  4ZQL A;  5FH6 A;  4QR3 A;  1JSP B;  4TT6 A;  5DW2 A;  4BHW A;  5E9M A;  4N3W A;  5ENI A;  2H60 A;  5E3G A;  4LC2 A;  5L8T A;  5CU8 A;  5KTW A;  3MB3 A;  5DW1 A;  4HXK A;  4YBS A;  5CFW A;  3U5L A;  5F1L A;  4NQN A;  5F36 A;  4KV4 A;  5F25 A;  3G0J A;  5F63 A;  5LVR A;  5DX4 A;  4O76 A;  5HRV A;  4IR3 A;  5IGK A;  4A9N A;  4C67 A;  5DBM A;  5FG6 A;  5D3T A;  4UIY A;  3NXB A;  5DY7 A;  5F60 A;  5F5Z A;  4CUS A;  5CP5 A;  2FSA A;  3UW9 A;  4XYA A;  3AQA A;  4O71 A;  5EPB A;  4Z1Q A;  2E7N A;  4YYM A;  4OGI A;  4N4F A;  5BT4 A;  5EK9 A;  1WUM A;  4QST A;  4QNS A;  4GPJ A;  5A5N A;  5LJ2 A;  2YEM A;  2I8N A;  4HBW A;  4UIV A;  5FG5 A;  5A5R A;  5BT5 A;  2R0Y A;  3MUL A;  5EA1 A;  2L84 A;  2RNW A;  4FLP A;  4A9H A;  5ENB A;  4LYS A;  5EWV A;  4Z1S A;  4LYI A;  5HFR A;  4MEN A;  5EWW A;  5CRZ A;  5FBX A;  5ENF A;  5LKT A;  2RI7 A;  3U5O A;  4QSU A;  2LSP B;  5D26 A;  5D3S A;  5KHM A;  4A9O A;  5C4Q A;  5AMF A;  5CQ3 A;  5C8G A;  5I40 A;  4C66 A;  5DYU A;  5C87 A;  4A9J A;  5CS8 A;  5DYC A;  2DVV A;  4UIX A;  3S92 A;  4CLB A;  3QZV A;  4J3I A;  4YK0 A;  2RNX A;  5JWM A;  5L8U A;  3SVG A;  3UVW A;  2DWW A;  4YAT A;  3U5K A;  5DFD A;  4XUA A;  4O74 A;  4X2I A;  4TT4 A;  3I3J A;  4TTE A;  5F3A A;  5EPR A;  5D24 A;  5CUA A;  4UYH A;  2E3K A;  5A5Q A;  5ENE A;  3DWY A;  4OGJ A;  1F68 A;  5FE8 A;  5FE6 A;  3MB4 A;  5IGL A;  3P5O A;  3O37 A;  4YYI A;  3P1F A;  3HMF A;  4O72 A;  5FE2 A;  3JVL A;  5FH7 A;  5CUD A;  2RFJ A;  4A9F A;  5LKZ A;  5CTL A;  5I86 A;  5D3P A;  2YDW A;  5HQ5 A;  3U5N A;  5DLX A;  4TS8 A;  1WUG A;  3O35 A;  4CFL A;  5II2 A;  2MJV B;  4ALH A;  5I7Y A;  5DFC A;  4QUT A;  2WP2 A;  5EP7 A;  2E7O A;  1E6I A;  4LZS A;  4PS5 A;  3D7C A;  4UIT A;  4UIZ A;  2RS9 B;  4TU6 A;  5A85 A;  1EQF A;  4YYK A;  5TB6 A;  4BJX A;  3JVJ A;  4NUE A;  4CUT A;  5E9I A;  4IR5 A;  5EM3 A;  3LQJ A;  5L99 A;  5C85 A;  4IR4 A;  4O7C A;  4Z6H A;  3LJW A;  3UVD A;  3LQH A;  5CQ8 A;  5KU3 A;  4O77 A;  1ZS5 A;  4YH3 A;  3LQI A;  5LKU A;  4QY4 A;  4Y03 A;  5EI4 A;  5CUG A;  4NYW A;  4PKL A;  5DKC A;  5LVQ A;  4HXP A;  4O78 A;  4QBM A;  5I80 A;  5LKX A;  4LZ2 A;  5H85 A;  4MEP A;  4IOR A;  4QSW A;  4QSR A;  4O7B A;  5LUU A;  4IOO A;  5FE3 A;  5FH8 A;  4HBV A;  4KV1 A;  4QUU A;  5HLS A;  5E3D A;  5CQ4 A;  4NR6 A;  5ENC A;  5BT3 A;  5HRX A;  4QSP A;  5H1T A;  5CQ5 A;  4UYE A;  4NYV A;  4RVR A;  4PTB A;  2R10 A;  4CFK A;  5HEN A;  4TU4 A;  1JM4 B;  4CUR A;  5HM0 A;  4HXM A;  4HXS A;  4J0R A;  4HXR A;  5D3R A;  5DKH A;  5A81 A;  3RCW A;  3Q2F A;  3JVK A;  4N4G A;  4YAB A;  3FKM X;  4NQM A;  5HEM A;  5IBN A;  4LR6 A;  4QEV A;  5A7C A;  3LXJ A;  4YYD A;  5E9V A;  3P1E A;  5KTU A;  5E74 A;  4QR5 A;  5D3N A;  4DON A;  5I7X A;  2DVQ A;  4HBX A;  5E73 A;  4HBY A;  5E9L A;  3ONI A;  4QEU A;  4WHW A;  4WHU A;  4NR8 A;  4YYJ A;  1N72 A;  5D3H A;  5EIS A;  5FB1 A;  5EWC A;  3UVX A;  5HRW A;  4ZW1 A;  4NRA A;  5I83 A;  3O33 A;  5IGN A;  3UV5 A;  3MXF A;  4MEO A;  4E96 A;  4YH4 A;  4Q0N A;  2NXB A;  5CRM A;  5EU1 A;  4CUP A;  3S91 A;  4XUB A;  5DLZ A;  4A9K A;  5EPS A;  3IU6 A;  4UYF B;  4AKN A;  3UV4 A;  5IGM A;  4PY6 A;  2G4A A;  4NRB A;  4UYG A;  5A83 A;  4UIU A;  5FE5 A;  4ALG A;  4O75 A;  5DKD A;  4NRC A;  5I89 A;  4QSX A;  4YAD A;  5COI A;  4KCX A;  5E0R A;  4A9L A;  5C7N A;  2OSS A;  2YEL A;  3O34 A;  3O36 A;  4YY4 A;  5CPE A;  4LZR A;  5LJ1 A;  5EGU A;  5CQT A;  4N4I A;  5C89 A;  2OUO A;  3UVY A;  3ZYU A;  4TYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...