4A9FA

N-terminal bromodomain of human brd2 with 1-methylpyrrolidin-2-one
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
108
structure length
108
Chain Sequence
VTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 2
publication title Fragment-Based Discovery of Bromodomain Inhibitors Part 1: Inhibitor Binding Modes and Implications for Lead Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 37
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4a9fA00
5A7CA 5E9IA 5FE1A 3MUKA 4YYGA 3P1EA 4A9FA 4NRAA 3SVHA 4UIVA 5CQ4A 2RS9B 3U5MA 4LZSA 3O37A 5FFWA 4PS5A 4YYKA 4Z1SA 5ETBA 4Y03A 5K29A 3QZTA 4MR5A 4QYDA 4QBMA 5ETDA 4CUUA 5FFYA 4IR6A 5D3JA 5L8TA 2I7KA 4YH4A 4C66A 5HQ7A 4QSPA 5A82A 5FE4A 2YW5A 4QC3A 4UYEA 2DVQA 4O7EA 4NQNA 4QUTA 3P1CA 4QSVA 5A83A 2YDWA 3IU5A 4UIYA 5AD3A 4XUAA 3NXBA 4YC9A 3MXFA 5BT5A 5EWWA 3JVMA 5JWMA 4QEWA 5F25A 4TT6A 3MULA 4YADA 3JVKA 4NYWA 3G0JA 5FH6A 4QC1A 4LZ2A 5EPRA 5DY7A 5CGPA 1E6IA 4O7FA 5HCLA 4HBWA 5HRVA 5I7XA 5CUDA 4N4FA 4J0RA 5EA1A 4Z6IA 5TB6A 3UVWA 4QSXA 4UITA 5FG4A 4Z6HA 4QR5A 5FG5A 3IU6A 3I3JA 4UIUA 4LYSA 3FKMX 4ALHA 5IGNA 4LYIA 4KCXA 3S91A 4TU4A 5FFVA 5ENFA 4IR5A 4NR6A 3AADA 5E9KA 4QSTA 5TCMA 5LUUA 4QSWA 1N72A 5EI4A 5H1TA 5L8UA 5LJ1A 3LQIA 3LQJA 5EWHA 3U5NA 5F61A 4E96A 5CFWA 2WP2A 5KU3A 5FE9A 5G4RA 5IG6A 4NRBA 4ZC9A 5EU1A 5DW1A 5F5ZA 3UVDA 3MQMA 4A9NA 5D0CA 5E3GA 4LR6A 4PKLA 3LJWA 2E7OA 5D3SA 4O7BA 5LVQA 4QR4A 5D3HA 5DFDA 2YEKA 5D26A 5EPBA 4YYJA 4QY4A 5DKHA 4F3IA 3D7CA 4HXLA 4YYMA 4NR7A 5F60A 3Q2EA 4NS5A 4HBXA 4YY6A 4O70A 5E74A 5II1A 5A5PA 2E3KA 4A9LA 5L99A 4YK0A 4XYAA 4YBMA 5DKDA 4XUBA 5ENJA 4QB3A 4BJXA 5I89A 5FE0A 4NR4A 5KHMA 4HBYA 4LRGA 2DKWA 4OGIA 4NYVA 4QR3A 4O7CA 5IGKA 5LKUA 2F6NA 5DYUA 3MB4A 2DVSA 5ENEA 5LVRA 4Q0OA 4UYHA 5CPEA 4AKNA 2G4AA 4A9HA 4CUPA 5EPSA 2RI7A 4BW2A 4NUEA 3K2JA 5F36A 5H1UA 4YAXA 4UYFB 2DVRA 5E9VA 5L96A 5FE7A 5A5RA 4LDFA 3DWYA 5DYXA 5DFCA 5CQ7A 3U5JA 3SVGA 5AD2A 5D3LA 1JSPB 4TYLA 3JVJA 4LC2A 4QZSA 4A9OA 5JI8A 5L97A 4BW1A 4O77A 5CUGA 5I1QA 5A81A 4A9KA 3AQAA 5EICA 2YYNA 4QEUA 5HJCA 5CUCA 4BW4A 5CQTA 2R0SA 5AMFA 5DLXA 2L84A 5BT4A 3S92A 4YYNA 2OO1A 4O72A 5D3RA 5IGLA 2GRCA 5F3AA 1F68A 5KTWA 5A5OA 5CQ3A 5D3NA 4WHWA 5E7DA 5ENCA 5D7XA 4TU6A 3QZSA 5D3TA 5A5QA 5FB0A 5I86A 3UW9A 5EGUA 4QEVA 5C4QA 4UIXA 5ENBA 5CQ8A 2L5EA 3HMEA 3TLPA 4IR3A 3QZVA 4MR3A 5J0DA 5EISA 4X2IA 5DYAA 5DYCA 5DBMA 4YYHA 1JM4B 4KV1A 4TS8A 4LYWA 5AMEA 4BW3A 5CRZA 5CUAA 5KTXA 5CUEA 5I29A 4CLBA 4PCEA 3UVXA 5HQ6A 2R0VA 5HQ5A 4YYIA 5ACYA 5CUBA 4CUTA 4PY6A 5IIDA 3SVFA 4GPJA 4ZQLA 5DX4A 5F1HA 5H1VA 4QSQA 5LJ0A 5ENIA 4ALGA 4O7AA 4FLPA 2RFJA 4MEQA 2I8NA 5E9YA 3ONIA 2RNXA 2FSAA 4J3IA 4Q0NA 5HEMA 5A85A 5COIA 5DW2A 3U5KA 3HMHA 3O34A 5I88A 2YELA 5CQ6A 4NXJA 2DVVA 4NYXA 5H85A 4MEOA 4OUFA 4CL9A 5HFQA 5EWVA 2OUOA 4WIVA 4MR4A 3UV5A 5FE3A 2DWWA 4UYDA 5CZGA 5LKZA 2D9EA 5FE6A 5FG6A 4NUCA 4N4IA 5II2A 2N9GA 4J0SA 5I7YA 1X0JA 4YBTA 4TT2A 5HENA 4LZRA 2LSPB 4HXPA 4UYFA 5EWCA 3LQHA 4IORA 5EP7A 5HFRA 4CFLA 4O75A 2WP1A 5I40A 4Z1QA 5EV9A 3RCWA 5FBXA 5DLZA 5E9MA 5F2PA 5D25A 4N3WA 5ENHA 2RNWA 5C85A 4XY9A 4RVRA 4O78A 2YQDA 5DKCA 5FDZA 4ZW1A 4TZ8A 5EQ1A 5A5NA 2NXBA 4NR5A 5C7NA 5IBNA 4Z93A 5EWDA 5CU8A 4NR9A 5FH8A 5CRMA 4HXRA 3DAIA 4O76A 4YY4A 2MJVB 4A9MA 3GG3A 5C87A 4QSRA 1EQFA 4UYGA 5FE5A 4MENA 3G0LA 3P5OA 4N4GA 3O36A 5CQAA 4A9IA 5BT3A 4TQNA 4N4HA 4UIWA 2D82A 5HRWA 5CY9A 4YH3A 5A5SA 5ENGA 1WUMA 4MEPA 5HELA 4HXOA 5CTLA 3UVYA 5E3DA 4HXNA 4HXMA 5CP5A 5EVAA 4QSSA 5FE8A 5FB1A 5DFBA 4YABA 5F1LA 2OSSA 3UV2A 3HMFA 5E9LA 3MB3A 3LXJA 4KV4A 3O35A 3JVLA 5C8GA 4OGJA 5D24A 4CFKA 5KO4A 2RO1A 5E73A 2DATA 1ZS5A 3P1FA 4XY8A 4J1PA 4YATA 5G4SA 3UV4A 2R0YA 5EM3A 4QYLA 4TTEA 5I83A 4UIZA 5L98A 4DONA 4IOQA 4YBSA 2R10A 3U5LA 3ZYUA 5LKXA 1WUGA 3O33A 2YEMA 4PTBA 4A9EA 5FE2A 5EK9A 2F6JA 5F62A 2RNYA 5LKTA 4NUDA 4WHUA 4CURA 4HBVA 4TT4A 2KTBB 5HRXA 5D3PA 5HLSA 4A9JA 4QNSA 5LJ2A 2E7NA 5I80A 3U5PA 5CQ5A 4BHWA 3Q2FA 4IR4A 5E0RA 5C89A 3P1DA 5CS8A 2L85A 4TZ2A 4QSUA 4NQMA 4MR6A 4O74A 5FH7A 4HXSA 5HM0A 4O71A 4CUQA 4NRCA 2H60A 5IGMA 4QUUA 4IOOA 5F63A 3U5OA 4CUSA 4C67A 4NR8A 4PCIA 5KTUA 4HXKA 4YYDA
chains in the Genus database with same CATH superfamily
5A7CA 5E9IA 5FE1A 3MUKA 4YYGA 3P1EA 4A9FA 4NRAA 3SVHA 4UIVA 5CQ4A 2RS9B 3U5MA 4LZSA 3O37A 5FFWA 4PS5A 4YYKA 4Z1SA 5ETBA 4Y03A 5K29A 3QZTA 4MR5A 4QYDA 4QBMA 5ETDA 4CUUA 5FFYA 4IR6A 5D3JA 5L8TA 2I7KA 4YH4A 4C66A 5HQ7A 4QSPA 5A82A 5FE4A 2YW5A 4QC3A 4UYEA 2DVQA 4O7EA 3D1DA 4NQNA 4QUTA 3P1CA 4QSVA 5A83A 2YDWA 3IU5A 4UIYA 5AD3A 4XUAA 3NXBA 4YC9A 3MXFA 5BT5A 5EWWA 3JVMA 5JWMA 4QEWA 5F25A 4TT6A 3MULA 4YADA 3JVKA 4NYWA 3G0JA 5FH6A 4QC1A 4LZ2A 5EPRA 5DY7A 5CGPA 1E6IA 4O7FA 5HCLA 4HBWA 5HRVA 5I7XA 5CUDA 4N4FA 4J0RA 5EA1A 4Z6IA 5TB6A 3UVWA 4QSXA 4UITA 5FG4A 4Z6HA 4QR5A 5FG5A 3IU6A 3I3JA 4UIUA 4LYSA 3FKMX 4ALHA 5IGNA 4LYIA 4KCXA 3S91A 4TU4A 5FFVA 5ENFA 4IR5A 4NR6A 3AADA 5E9KA 4QSTA 5TCMA 5LUUA 4QSWA 3D1BA 1N72A 5EI4A 5H1TA 5L8UA 5LJ1A 3LQIA 3LQJA 5EWHA 3U5NA 5F61A 4E96A 5CFWA 2WP2A 5KU3A 5FE9A 5G4RA 5IG6A 4NRBA 4ZC9A 5EU1A 5DW1A 5F5ZA 3UVDA 3MQMA 4A9NA 5D0CA 5E3GA 4LR6A 4PKLA 3LJWA 2E7OA 5D3SA 4O7BA 5LVQA 4QR4A 5D3HA 5DFDA 2YEKA 5D26A 5EPBA 4YYJA 4QY4A 5DKHA 4F3IA 3D7CA 4HXLA 4YYMA 4NR7A 5F60A 3Q2EA 4NS5A 4HBXA 4YY6A 4O70A 5E74A 5II1A 5A5PA 2E3KA 4A9LA 5L99A 4YK0A 4XYAA 4YBMA 5DKDA 4XUBA 5ENJA 4QB3A 4BJXA 5I89A 5FE0A 4NR4A 5KHMA 4HBYA 4LRGA 2DKWA 4OGIA 4NYVA 4QR3A 4O7CA 5IGKA 5LKUA 2F6NA 5DYUA 3MB4A 2DVSA 5ENEA 5LVRA 4Q0OA 4UYHA 5CPEA 4AKNA 2G4AA 4A9HA 4CUPA 5EPSA 2RI7A 4BW2A 4NUEA 3K2JA 5F36A 5H1UA 4YAXA 4UYFB 2DVRA 5E9VA 5L96A 5FE7A 5A5RA 4LDFA 3DWYA 5DYXA 5DFCA 5CQ7A 3U5JA 3SVGA 5AD2A 5D3LA 1JSPB 4TYLA 3JVJA 1PUOA 4LC2A 4QZSA 4A9OA 5JI8A 5L97A 4BW1A 2EJNA 4O77A 5CUGA 5I1QA 5A81A 4A9KA 3AQAA 5EICA 2YYNA 4QEUA 5HJCA 5CUCA 4BW4A 5CQTA 2R0SA 5AMFA 5DLXA 2L84A 5BT4A 3S92A 4YYNA 4AI6A 2OO1A 4O72A 5D3RA 5IGLA 2GRCA 5F3AA 1F68A 5KTWA 5A5OA 5CQ3A 5D3NA 4WHWA 5E7DA 5ENCA 5D7XA 4TU6A 3QZSA 5D3TA 5A5QA 5FB0A 5I86A 3UW9A 5EGUA 4QEVA 5C4QA 4UIXA 5ENBA 5CQ8A 2L5EA 3HMEA 3TLPA 4IR3A 3QZVA 4MR3A 5J0DA 5EISA 4X2IA 5DYAA 5DYCA 5DBMA 4YYHA 1JM4B 4KV1A 4TS8A 4LYWA 5AMEA 4BW3A 5CRZA 5CUAA 5KTXA 5CUEA 5I29A 4CLBA 4PCEA 3UVXA 5HQ6A 2R0VA 5HQ5A 4YYIA 5ACYA 5CUBA 4CUTA 4PY6A 5IIDA 3SVFA 4GPJA 4ZQLA 5DX4A 5F1HA 5H1VA 4QSQA 5LJ0A 5ENIA 4ALGA 4O7AA 4FLPA 2RFJA 4MEQA 2I8NA 5E9YA 3ONIA 2RNXA 2FSAA 4J3IA 4Q0NA 5HEMA 5A85A 5COIA 5DW2A 3U5KA 3HMHA 3O34A 5I88A 2YELA 5CQ6A 4NXJA 2DVVA 4NYXA 5H85A 4MEOA 4OUFA 4CL9A 5HFQA 5EWVA 2OUOA 4WIVA 4MR4A 3UV5A 5FE3A 2DWWA 4UYDA 5CZGA 5LKZA 2D9EA 5FE6A 5FG6A 4NUCA 4N4IA 5II2A 2N9GA 3ERRA 4J0SA 5I7YA 1X0JA 4YBTA 4TT2A 5HENA 4LZRA 2LSPB 4HXPA 4UYFA 5EWCA 3LQHA 4IORA 5EP7A 5HFRA 4CFLA 4O75A 2WP1A 5I40A 4Z1QA 5EV9A 3RCWA 5FBXA 5DLZA 5E9MA 5F2PA 5D25A 4N3WA 5ENHA 2RNWA 5C85A 4XY9A 4RVRA 4O78A 2YQDA 5DKCA 5FDZA 4ZW1A 4TZ8A 5EQ1A 5A5NA 2NXBA 4NR5A 5C7NA 5IBNA 4Z93A 5EWDA 3VKGA 5CU8A 1ZKRA 4NR9A 5FH8A 5CRMA 4HXRA 3DAIA 4O76A 4YY4A 2MJVB 4A9MA 3GG3A 5C87A 4QSRA 1EQFA 4UYGA 5FE5A 4MENA 3G0LA 3P5OA 4N4GA 3O36A 5CQAA 4A9IA 5BT3A 4TQNA 4N4HA 4UIWA 2D82A 5HRWA 5CY9A 4YH3A 5A5SA 5ENGA 1WUMA 4MEPA 5HELA 4HXOA 5CTLA 3UVYA 5E3DA 4HXNA 4HXMA 5CP5A 5EVAA 4QSSA 5FE8A 5FB1A 5DFBA 4YABA 5F1LA 2OSSA 3UV2A 3HMFA 5E9LA 3MB3A 3LXJA 4KV4A 3VKHA 3O35A 3JVLA 5C8GA 4OGJA 5D24A 4CFKA 5KO4A 2RO1A 5E73A 2DATA 1ZS5A 3P1FA 4XY8A 4J1PA 4YATA 5G4SA 3UV4A 2R0YA 5EM3A 4QYLA 4TTEA 5I83A 4AKGA 4UIZA 5L98A 4DONA 4IOQA 4YBSA 2R10A 3U5LA 3ZYUA 5LKXA 1WUGA 3O33A 2YEMA 4PTBA 4A9EA 5FE2A 5EK9A 2F6JA 5F62A 2RNYA 5LKTA 4NUDA 4WHUA 4AKHA 4CURA 4HBVA 4TT4A 2KTBB 5HRXA 5D3PA 5HLSA 4A9JA 4QNSA 5LJ2A 2E7NA 4AKIA 5I80A 3U5PA 5CQ5A 4BHWA 3Q2FA 4IR4A 5E0RA 5C89A 3P1DA 5CS8A 2L85A 4TZ2A 4QSUA 4NQMA 4MR6A 4O74A 5FH7A 4HXSA 5HM0A 4O71A 4CUQA 4NRCA 2H60A 5IGMA 4QUUA 4IOOA 5F63A 3U5OA 4CUSA 4C67A 4NR8A 4PCIA 5KTUA 4HXKA 4YYDA
chains in the Genus database with same CATH topology
5A7CA 5E9IA 5FE1A 3MUKA 4YYGA 3P1EA 4A9FA 4NRAA 3SVHA 4UIVA 5CQ4A 2RS9B 3U5MA 4LZSA 3O37A 5FFWA 4PS5A 4YYKA 4Z1SA 5ETBA 4Y03A 5K29A 3QZTA 4MR5A 4QYDA 4QBMA 5ETDA 4CUUA 5FFYA 4IR6A 5D3JA 5L8TA 2I7KA 4YH4A 4C66A 5HQ7A 4QSPA 5A82A 5FE4A 2YW5A 4QC3A 4UYEA 2DVQA 4O7EA 4NQNA 4QUTA 3P1CA 4QSVA 5A83A 2YDWA 3IU5A 4UIYA 5AD3A 4XUAA 3NXBA 4YC9A 3MXFA 5BT5A 5EWWA 3JVMA 5JWMA 4QEWA 5F25A 4TT6A 3MULA 4YADA 3JVKA 4NYWA 3G0JA 5FH6A 4QC1A 4LZ2A 5EPRA 5DY7A 5CGPA 1E6IA 4O7FA 5HCLA 4HBWA 5HRVA 5I7XA 5CUDA 4N4FA 4J0RA 5EA1A 4Z6IA 5TB6A 3UVWA 4QSXA 4UITA 5FG4A 4Z6HA 4QR5A 5FG5A 3IU6A 3I3JA 4UIUA 4LYSA 3FKMX 4ALHA 5IGNA 4LYIA 4KCXA 3S91A 4TU4A 5FFVA 5ENFA 4IR5A 4NR6A 3AADA 5E9KA 4QSTA 5TCMA 5LUUA 4QSWA 1N72A 5EI4A 5H1TA 5L8UA 5LJ1A 3LQIA 3LQJA 5EWHA 3U5NA 5F61A 4E96A 5CFWA 2WP2A 5KU3A 5FE9A 5G4RA 5IG6A 4NRBA 4ZC9A 5EU1A 5DW1A 5F5ZA 3UVDA 3MQMA 4A9NA 5D0CA 5E3GA 4LR6A 4PKLA 3LJWA 2E7OA 5D3SA 4O7BA 5LVQA 4QR4A 5D3HA 5DFDA 2YEKA 5D26A 5EPBA 4YYJA 4QY4A 5DKHA 4F3IA 3D7CA 4HXLA 4YYMA 4NR7A 5F60A 3Q2EA 4NS5A 4HBXA 4YY6A 4O70A 5E74A 5II1A 5A5PA 2E3KA 4A9LA 5L99A 4YK0A 4XYAA 4YBMA 5DKDA 4XUBA 5ENJA 4QB3A 4BJXA 5I89A 5FE0A 4NR4A 5KHMA 4HBYA 4LRGA 2DKWA 4OGIA 4NYVA 4QR3A 4O7CA 5IGKA 5LKUA 2F6NA 5DYUA 3MB4A 2DVSA 5ENEA 5LVRA 4Q0OA 4UYHA 5CPEA 4AKNA 2G4AA 4A9HA 4CUPA 5EPSA 2RI7A 4BW2A 4NUEA 3K2JA 5F36A 5H1UA 4YAXA 4UYFB 2DVRA 5E9VA 5L96A 5FE7A 5A5RA 4LDFA 3DWYA 5DYXA 5DFCA 5CQ7A 3U5JA 3SVGA 5AD2A 5D3LA 1JSPB 4TYLA 3JVJA 4LC2A 4QZSA 4A9OA 5JI8A 5L97A 4BW1A 4O77A 5CUGA 5I1QA 5A81A 4A9KA 3AQAA 5EICA 2YYNA 4QEUA 5HJCA 5CUCA 4BW4A 5CQTA 2R0SA 5AMFA 5DLXA 2L84A 5BT4A 3S92A 4YYNA 2OO1A 4O72A 5D3RA 5IGLA 2GRCA 5F3AA 1F68A 5KTWA 5A5OA 5CQ3A 5D3NA 4WHWA 5E7DA 5ENCA 5D7XA 4TU6A 3QZSA 5D3TA 5A5QA 5FB0A 5I86A 3UW9A 5EGUA 4QEVA 5C4QA 4UIXA 5ENBA 5CQ8A 2L5EA 3HMEA 3TLPA 4IR3A 3QZVA 4MR3A 5J0DA 5EISA 4X2IA 5DYAA 5DYCA 5DBMA 4YYHA 1JM4B 4KV1A 4TS8A 4LYWA 5AMEA 4BW3A 5CRZA 5CUAA 5KTXA 5CUEA 5I29A 4CLBA 4PCEA 3UVXA 5HQ6A 2R0VA 5HQ5A 4YYIA 5ACYA 5CUBA 4CUTA 4PY6A 5IIDA 3SVFA 4GPJA 4ZQLA 5DX4A 5F1HA 5H1VA 4QSQA 5LJ0A 5ENIA 4ALGA 4O7AA 4FLPA 2RFJA 4MEQA 2I8NA 5E9YA 3ONIA 2RNXA 2FSAA 4J3IA 4Q0NA 5HEMA 5A85A 5COIA 5DW2A 3U5KA 3HMHA 3O34A 5I88A 2YELA 5CQ6A 4NXJA 2DVVA 4NYXA 5H85A 4MEOA 4OUFA 4CL9A 5HFQA 5EWVA 2OUOA 4WIVA 4MR4A 3UV5A 5FE3A 2DWWA 4UYDA 5CZGA 5LKZA 2D9EA 5FE6A 5FG6A 4NUCA 4N4IA 5II2A 2N9GA 4J0SA 5I7YA 1X0JA 4YBTA 4TT2A 5HENA 4LZRA 2LSPB 4HXPA 4UYFA 5EWCA 3LQHA 4IORA 5EP7A 5HFRA 4CFLA 4O75A 2WP1A 5I40A 4Z1QA 5EV9A 3RCWA 5FBXA 5DLZA 5E9MA 5F2PA 5D25A 4N3WA 5ENHA 2RNWA 5C85A 4XY9A 4RVRA 4O78A 2YQDA 5DKCA 5FDZA 4ZW1A 4TZ8A 5EQ1A 5A5NA 2NXBA 4NR5A 5C7NA 5IBNA 4Z93A 5EWDA 5CU8A 4NR9A 5FH8A 5CRMA 4HXRA 3DAIA 4O76A 4YY4A 2MJVB 4A9MA 3GG3A 5C87A 4QSRA 1EQFA 4UYGA 5FE5A 4MENA 3G0LA 3P5OA 4N4GA 3O36A 5CQAA 4A9IA 5BT3A 4TQNA 4N4HA 4UIWA 2D82A 5HRWA 5CY9A 4YH3A 5A5SA 5ENGA 1WUMA 4MEPA 5HELA 4HXOA 5CTLA 3UVYA 5E3DA 4HXNA 4HXMA 5CP5A 5EVAA 4QSSA 5FE8A 5FB1A 5DFBA 4YABA 5F1LA 2OSSA 3UV2A 3HMFA 5E9LA 3MB3A 3LXJA 4KV4A 3O35A 3JVLA 5C8GA 4OGJA 5D24A 4CFKA 5KO4A 2RO1A 5E73A 2DATA 1ZS5A 3P1FA 4XY8A 4J1PA 4YATA 5G4SA 3UV4A 2R0YA 5EM3A 4QYLA 4TTEA 5I83A 4UIZA 5L98A 4DONA 4IOQA 4YBSA 2R10A 3U5LA 3ZYUA 5LKXA 1WUGA 3O33A 2YEMA 4PTBA 4A9EA 5FE2A 5EK9A 2F6JA 5F62A 2RNYA 5LKTA 4NUDA 4WHUA 4CURA 4HBVA 4TT4A 2KTBB 5HRXA 5D3PA 5HLSA 4A9JA 4QNSA 5LJ2A 2E7NA 5I80A 3U5PA 5CQ5A 4BHWA 3Q2FA 4IR4A 5E0RA 5C89A 3P1DA 5CS8A 2L85A 4TZ2A 4QSUA 4NQMA 4MR6A 4O74A 5FH7A 4HXSA 5HM0A 4O71A 4CUQA 4NRCA 2H60A 5IGMA 4QUUA 4IOOA 5F63A 3U5OA 4CUSA 4C67A 4NR8A 4PCIA 5KTUA 4HXKA 4YYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A7C A;  5E9I A;  5FE1 A;  3MUK A;  4YYG A;  3P1E A;  4A9F A;  4NRA A;  3SVH A;  4UIV A;  5CQ4 A;  2RS9 B;  3U5M A;  4LZS A;  3O37 A;  5FFW A;  4PS5 A;  4YYK A;  4Z1S A;  5ETB A;  4Y03 A;  5K29 A;  3QZT A;  4MR5 A;  4QYD A;  4QBM A;  5ETD A;  4CUU A;  5FFY A;  4IR6 A;  5D3J A;  5L8T A;  2I7K A;  4YH4 A;  4C66 A;  5HQ7 A;  4QSP A;  5A82 A;  5FE4 A;  2YW5 A;  4QC3 A;  4UYE A;  2DVQ A;  4O7E A;  4NQN A;  4QUT A;  3P1C A;  4QSV A;  5A83 A;  2YDW A;  3IU5 A;  4UIY A;  5AD3 A;  4XUA A;  3NXB A;  4YC9 A;  3MXF A;  5BT5 A;  5EWW A;  3JVM A;  5JWM A;  4QEW A;  5F25 A;  4TT6 A;  3MUL A;  4YAD A;  3JVK A;  4NYW A;  3G0J A;  5FH6 A;  4QC1 A;  4LZ2 A;  5EPR A;  5DY7 A;  5CGP A;  1E6I A;  4O7F A;  5HCL A;  4HBW A;  5HRV A;  5I7X A;  5CUD A;  4N4F A;  4J0R A;  5EA1 A;  4Z6I A;  5TB6 A;  3UVW A;  4QSX A;  4UIT A;  5FG4 A;  4Z6H A;  4QR5 A;  5FG5 A;  3IU6 A;  3I3J A;  4UIU A;  4LYS A;  3FKM X;  4ALH A;  5IGN A;  4LYI A;  4KCX A;  3S91 A;  4TU4 A;  5FFV A;  5ENF A;  4IR5 A;  4NR6 A;  3AAD A;  5E9K A;  4QST A;  5TCM A;  5LUU A;  4QSW A;  1N72 A;  5EI4 A;  5H1T A;  5L8U A;  5LJ1 A;  3LQI A;  3LQJ A;  5EWH A;  3U5N A;  5F61 A;  4E96 A;  5CFW A;  2WP2 A;  5KU3 A;  5FE9 A;  5G4R A;  5IG6 A;  4NRB A;  4ZC9 A;  5EU1 A;  5DW1 A;  5F5Z A;  3UVD A;  3MQM A;  4A9N A;  5D0C A;  5E3G A;  4LR6 A;  4PKL A;  3LJW A;  2E7O A;  5D3S A;  4O7B A;  5LVQ A;  4QR4 A;  5D3H A;  5DFD A;  2YEK A;  5D26 A;  5EPB A;  4YYJ A;  4QY4 A;  5DKH A;  4F3I A;  3D7C A;  4HXL A;  4YYM A;  4NR7 A;  5F60 A;  3Q2E A;  4NS5 A;  4HBX A;  4YY6 A;  4O70 A;  5E74 A;  5II1 A;  5A5P A;  2E3K A;  4A9L A;  5L99 A;  4YK0 A;  4XYA A;  4YBM A;  5DKD A;  4XUB A;  5ENJ A;  4QB3 A;  4BJX A;  5I89 A;  5FE0 A;  4NR4 A;  5KHM A;  4HBY A;  4LRG A;  2DKW A;  4OGI A;  4NYV A;  4QR3 A;  4O7C A;  5IGK A;  5LKU A;  2F6N A;  5DYU A;  3MB4 A;  2DVS A;  5ENE A;  5LVR A;  4Q0O A;  4UYH A;  5CPE A;  4AKN A;  2G4A A;  4A9H A;  4CUP A;  5EPS A;  2RI7 A;  4BW2 A;  4NUE A;  3K2J A;  5F36 A;  5H1U A;  4YAX A;  4UYF B;  2DVR A;  5E9V A;  5L96 A;  5FE7 A;  5A5R A;  4LDF A;  3DWY A;  5DYX A;  5DFC A;  5CQ7 A;  3U5J A;  3SVG A;  5AD2 A;  5D3L A;  1JSP B;  4TYL A;  3JVJ A;  4LC2 A;  4QZS A;  4A9O A;  5JI8 A;  5L97 A;  4BW1 A;  4O77 A;  5CUG A;  5I1Q A;  5A81 A;  4A9K A;  3AQA A;  5EIC A;  2YYN A;  4QEU A;  5HJC A;  5CUC A;  4BW4 A;  5CQT A;  2R0S A;  5AMF A;  5DLX A;  2L84 A;  5BT4 A;  3S92 A;  4YYN A;  2OO1 A;  4O72 A;  5D3R A;  5IGL A;  2GRC A;  5F3A A;  1F68 A;  5KTW A;  5A5O A;  5CQ3 A;  5D3N A;  4WHW A;  5E7D A;  5ENC A;  5D7X A;  4TU6 A;  3QZS A;  5D3T A;  5A5Q A;  5FB0 A;  5I86 A;  3UW9 A;  5EGU A;  4QEV A;  5C4Q A;  4UIX A;  5ENB A;  5CQ8 A;  2L5E A;  3HME A;  3TLP A;  4IR3 A;  3QZV A;  4MR3 A;  5J0D A;  5EIS A;  4X2I A;  5DYA A;  5DYC A;  5DBM A;  4YYH A;  1JM4 B;  4KV1 A;  4TS8 A;  4LYW A;  5AME A;  4BW3 A;  5CRZ A;  5CUA A;  5KTX A;  5CUE A;  5I29 A;  4CLB A;  4PCE A;  3UVX A;  5HQ6 A;  2R0V A;  5HQ5 A;  4YYI A;  5ACY A;  5CUB A;  4CUT A;  4PY6 A;  5IID A;  3SVF A;  4GPJ A;  4ZQL A;  5DX4 A;  5F1H A;  5H1V A;  4QSQ A;  5LJ0 A;  5ENI A;  4ALG A;  4O7A A;  4FLP A;  2RFJ A;  4MEQ A;  2I8N A;  5E9Y A;  3ONI A;  2RNX A;  2FSA A;  4J3I A;  4Q0N A;  5HEM A;  5A85 A;  5COI A;  5DW2 A;  3U5K A;  3HMH A;  3O34 A;  5I88 A;  2YEL A;  5CQ6 A;  4NXJ A;  2DVV A;  4NYX A;  5H85 A;  4MEO A;  4OUF A;  4CL9 A;  5HFQ A;  5EWV A;  2OUO A;  4WIV A;  4MR4 A;  3UV5 A;  5FE3 A;  2DWW A;  4UYD A;  5CZG A;  5LKZ A;  2D9E A;  5FE6 A;  5FG6 A;  4NUC A;  4N4I A;  5II2 A;  2N9G A;  4J0S A;  5I7Y A;  1X0J A;  4YBT A;  4TT2 A;  5HEN A;  4LZR A;  2LSP B;  4HXP A;  4UYF A;  5EWC A;  3LQH A;  4IOR A;  5EP7 A;  5HFR A;  4CFL A;  4O75 A;  2WP1 A;  5I40 A;  4Z1Q A;  5EV9 A;  3RCW A;  5FBX A;  5DLZ A;  5E9M A;  5F2P A;  5D25 A;  4N3W A;  5ENH A;  2RNW A;  5C85 A;  4XY9 A;  4RVR A;  4O78 A;  2YQD A;  5DKC A;  5FDZ A;  4ZW1 A;  4TZ8 A;  5EQ1 A;  5A5N A;  2NXB A;  4NR5 A;  5C7N A;  5IBN A;  4Z93 A;  5EWD A;  5CU8 A;  4NR9 A;  5FH8 A;  5CRM A;  4HXR A;  3DAI A;  4O76 A;  4YY4 A;  2MJV B;  4A9M A;  3GG3 A;  5C87 A;  4QSR A;  1EQF A;  4UYG A;  5FE5 A;  4MEN A;  3G0L A;  3P5O A;  4N4G A;  3O36 A;  5CQA A;  4A9I A;  5BT3 A;  4TQN A;  4N4H A;  4UIW A;  2D82 A;  5HRW A;  5CY9 A;  4YH3 A;  5A5S A;  5ENG A;  1WUM A;  4MEP A;  5HEL A;  4HXO A;  5CTL A;  3UVY A;  5E3D A;  4HXN A;  4HXM A;  5CP5 A;  5EVA A;  4QSS A;  5FE8 A;  5FB1 A;  5DFB A;  4YAB A;  5F1L A;  2OSS A;  3UV2 A;  3HMF A;  5E9L A;  3MB3 A;  3LXJ A;  4KV4 A;  3O35 A;  3JVL A;  5C8G A;  4OGJ A;  5D24 A;  4CFK A;  5KO4 A;  2RO1 A;  5E73 A;  2DAT A;  1ZS5 A;  3P1F A;  4XY8 A;  4J1P A;  4YAT A;  5G4S A;  3UV4 A;  2R0Y A;  5EM3 A;  4QYL A;  4TTE A;  5I83 A;  4UIZ A;  5L98 A;  4DON A;  4IOQ A;  4YBS A;  2R10 A;  3U5L A;  3ZYU A;  5LKX A;  1WUG A;  3O33 A;  2YEM A;  4PTB A;  4A9E A;  5FE2 A;  5EK9 A;  2F6J A;  5F62 A;  2RNY A;  5LKT A;  4NUD A;  4WHU A;  4CUR A;  4HBV A;  4TT4 A;  2KTB B;  5HRX A;  5D3P A;  5HLS A;  4A9J A;  4QNS A;  5LJ2 A;  2E7N A;  5I80 A;  3U5P A;  5CQ5 A;  4BHW A;  3Q2F A;  4IR4 A;  5E0R A;  5C89 A;  3P1D A;  5CS8 A;  2L85 A;  4TZ2 A;  4QSU A;  4NQM A;  4MR6 A;  4O74 A;  5FH7 A;  4HXS A;  5HM0 A;  4O71 A;  4CUQ A;  4NRC A;  2H60 A;  5IGM A;  4QUU A;  4IOO A;  5F63 A;  3U5O A;  4CUS A;  4C67 A;  4NR8 A;  4PCI A;  5KTU A;  4HXK A;  4YYD A; 
#chains in the Genus database with same CATH topology
 5A7C A;  5E9I A;  5FE1 A;  3MUK A;  4YYG A;  3P1E A;  4A9F A;  4NRA A;  3SVH A;  4UIV A;  5CQ4 A;  2RS9 B;  3U5M A;  4LZS A;  3O37 A;  5FFW A;  4PS5 A;  4YYK A;  4Z1S A;  5ETB A;  4Y03 A;  5K29 A;  3QZT A;  4MR5 A;  4QYD A;  4QBM A;  5ETD A;  4CUU A;  5FFY A;  4IR6 A;  5D3J A;  5L8T A;  2I7K A;  4YH4 A;  4C66 A;  5HQ7 A;  4QSP A;  5A82 A;  5FE4 A;  2YW5 A;  4QC3 A;  4UYE A;  2DVQ A;  4O7E A;  3D1D A;  4NQN A;  4QUT A;  3P1C A;  4QSV A;  5A83 A;  2YDW A;  3IU5 A;  4UIY A;  5AD3 A;  4XUA A;  3NXB A;  4YC9 A;  3MXF A;  5BT5 A;  5EWW A;  3JVM A;  5JWM A;  4QEW A;  5F25 A;  4TT6 A;  3MUL A;  4YAD A;  3JVK A;  4NYW A;  3G0J A;  5FH6 A;  4QC1 A;  4LZ2 A;  5EPR A;  5DY7 A;  5CGP A;  1E6I A;  4O7F A;  5HCL A;  4HBW A;  5HRV A;  5I7X A;  5CUD A;  4N4F A;  4J0R A;  5EA1 A;  4Z6I A;  5TB6 A;  3UVW A;  4QSX A;  4UIT A;  5FG4 A;  4Z6H A;  4QR5 A;  5FG5 A;  3IU6 A;  3I3J A;  4UIU A;  4LYS A;  3FKM X;  4ALH A;  5IGN A;  4LYI A;  4KCX A;  3S91 A;  4TU4 A;  5FFV A;  5ENF A;  4IR5 A;  4NR6 A;  3AAD A;  5E9K A;  4QST A;  5TCM A;  5LUU A;  4QSW A;  3D1B A;  1N72 A;  5EI4 A;  5H1T A;  5L8U A;  5LJ1 A;  3LQI A;  3LQJ A;  5EWH A;  3U5N A;  5F61 A;  4E96 A;  5CFW A;  2WP2 A;  5KU3 A;  5FE9 A;  5G4R A;  5IG6 A;  4NRB A;  4ZC9 A;  5EU1 A;  5DW1 A;  5F5Z A;  3UVD A;  3MQM A;  4A9N A;  5D0C A;  5E3G A;  4LR6 A;  4PKL A;  3LJW A;  2E7O A;  5D3S A;  4O7B A;  5LVQ A;  4QR4 A;  5D3H A;  5DFD A;  2YEK A;  5D26 A;  5EPB A;  4YYJ A;  4QY4 A;  5DKH A;  4F3I A;  3D7C A;  4HXL A;  4YYM A;  4NR7 A;  5F60 A;  3Q2E A;  4NS5 A;  4HBX A;  4YY6 A;  4O70 A;  5E74 A;  5II1 A;  5A5P A;  2E3K A;  4A9L A;  5L99 A;  4YK0 A;  4XYA A;  4YBM A;  5DKD A;  4XUB A;  5ENJ A;  4QB3 A;  4BJX A;  5I89 A;  5FE0 A;  4NR4 A;  5KHM A;  4HBY A;  4LRG A;  2DKW A;  4OGI A;  4NYV A;  4QR3 A;  4O7C A;  5IGK A;  5LKU A;  2F6N A;  5DYU A;  3MB4 A;  2DVS A;  5ENE A;  5LVR A;  4Q0O A;  4UYH A;  5CPE A;  4AKN A;  2G4A A;  4A9H A;  4CUP A;  5EPS A;  2RI7 A;  4BW2 A;  4NUE A;  3K2J A;  5F36 A;  5H1U A;  4YAX A;  4UYF B;  2DVR A;  5E9V A;  5L96 A;  5FE7 A;  5A5R A;  4LDF A;  3DWY A;  5DYX A;  5DFC A;  5CQ7 A;  3U5J A;  3SVG A;  5AD2 A;  5D3L A;  1JSP B;  4TYL A;  3JVJ A;  1PUO A;  4LC2 A;  4QZS A;  4A9O A;  5JI8 A;  5L97 A;  4BW1 A;  2EJN A;  4O77 A;  5CUG A;  5I1Q A;  5A81 A;  4A9K A;  3AQA A;  5EIC A;  2YYN A;  4QEU A;  5HJC A;  5CUC A;  4BW4 A;  5CQT A;  2R0S A;  5AMF A;  5DLX A;  2L84 A;  5BT4 A;  3S92 A;  4YYN A;  4AI6 A;  2OO1 A;  4O72 A;  5D3R A;  5IGL A;  2GRC A;  5F3A A;  1F68 A;  5KTW A;  5A5O A;  5CQ3 A;  5D3N A;  4WHW A;  5E7D A;  5ENC A;  5D7X A;  4TU6 A;  3QZS A;  5D3T A;  5A5Q A;  5FB0 A;  5I86 A;  3UW9 A;  5EGU A;  4QEV A;  5C4Q A;  4UIX A;  5ENB A;  5CQ8 A;  2L5E A;  3HME A;  3TLP A;  4IR3 A;  3QZV A;  4MR3 A;  5J0D A;  5EIS A;  4X2I A;  5DYA A;  5DYC A;  5DBM A;  4YYH A;  1JM4 B;  4KV1 A;  4TS8 A;  4LYW A;  5AME A;  4BW3 A;  5CRZ A;  5CUA A;  5KTX A;  5CUE A;  5I29 A;  4CLB A;  4PCE A;  3UVX A;  5HQ6 A;  2R0V A;  5HQ5 A;  4YYI A;  5ACY A;  5CUB A;  4CUT A;  4PY6 A;  5IID A;  3SVF A;  4GPJ A;  4ZQL A;  5DX4 A;  5F1H A;  5H1V A;  4QSQ A;  5LJ0 A;  5ENI A;  4ALG A;  4O7A A;  4FLP A;  2RFJ A;  4MEQ A;  2I8N A;  5E9Y A;  3ONI A;  2RNX A;  2FSA A;  4J3I A;  4Q0N A;  5HEM A;  5A85 A;  5COI A;  5DW2 A;  3U5K A;  3HMH A;  3O34 A;  5I88 A;  2YEL A;  5CQ6 A;  4NXJ A;  2DVV A;  4NYX A;  5H85 A;  4MEO A;  4OUF A;  4CL9 A;  5HFQ A;  5EWV A;  2OUO A;  4WIV A;  4MR4 A;  3UV5 A;  5FE3 A;  2DWW A;  4UYD A;  5CZG A;  5LKZ A;  2D9E A;  5FE6 A;  5FG6 A;  4NUC A;  4N4I A;  5II2 A;  2N9G A;  3ERR A;  4J0S A;  5I7Y A;  1X0J A;  4YBT A;  4TT2 A;  5HEN A;  4LZR A;  2LSP B;  4HXP A;  4UYF A;  5EWC A;  3LQH A;  4IOR A;  5EP7 A;  5HFR A;  4CFL A;  4O75 A;  2WP1 A;  5I40 A;  4Z1Q A;  5EV9 A;  3RCW A;  5FBX A;  5DLZ A;  5E9M A;  5F2P A;  5D25 A;  4N3W A;  5ENH A;  2RNW A;  5C85 A;  4XY9 A;  4RVR A;  4O78 A;  2YQD A;  5DKC A;  5FDZ A;  4ZW1 A;  4TZ8 A;  5EQ1 A;  5A5N A;  2NXB A;  4NR5 A;  5C7N A;  5IBN A;  4Z93 A;  5EWD A;  3VKG A;  5CU8 A;  1ZKR A;  4NR9 A;  5FH8 A;  5CRM A;  4HXR A;  3DAI A;  4O76 A;  4YY4 A;  2MJV B;  4A9M A;  3GG3 A;  5C87 A;  4QSR A;  1EQF A;  4UYG A;  5FE5 A;  4MEN A;  3G0L A;  3P5O A;  4N4G A;  3O36 A;  5CQA A;  4A9I A;  5BT3 A;  4TQN A;  4N4H A;  4UIW A;  2D82 A;  5HRW A;  5CY9 A;  4YH3 A;  5A5S A;  5ENG A;  1WUM A;  4MEP A;  5HEL A;  4HXO A;  5CTL A;  3UVY A;  5E3D A;  4HXN A;  4HXM A;  5CP5 A;  5EVA A;  4QSS A;  5FE8 A;  5FB1 A;  5DFB A;  4YAB A;  5F1L A;  2OSS A;  3UV2 A;  3HMF A;  5E9L A;  3MB3 A;  3LXJ A;  4KV4 A;  3VKH A;  3O35 A;  3JVL A;  5C8G A;  4OGJ A;  5D24 A;  4CFK A;  5KO4 A;  2RO1 A;  5E73 A;  2DAT A;  1ZS5 A;  3P1F A;  4XY8 A;  4J1P A;  4YAT A;  5G4S A;  3UV4 A;  2R0Y A;  5EM3 A;  4QYL A;  4TTE A;  5I83 A;  4AKG A;  4UIZ A;  5L98 A;  4DON A;  4IOQ A;  4YBS A;  2R10 A;  3U5L A;  3ZYU A;  5LKX A;  1WUG A;  3O33 A;  2YEM A;  4PTB A;  4A9E A;  5FE2 A;  5EK9 A;  2F6J A;  5F62 A;  2RNY A;  5LKT A;  4NUD A;  4WHU A;  4AKH A;  4CUR A;  4HBV A;  4TT4 A;  2KTB B;  5HRX A;  5D3P A;  5HLS A;  4A9J A;  4QNS A;  5LJ2 A;  2E7N A;  4AKI A;  5I80 A;  3U5P A;  5CQ5 A;  4BHW A;  3Q2F A;  4IR4 A;  5E0R A;  5C89 A;  3P1D A;  5CS8 A;  2L85 A;  4TZ2 A;  4QSU A;  4NQM A;  4MR6 A;  4O74 A;  5FH7 A;  4HXS A;  5HM0 A;  4O71 A;  4CUQ A;  4NRC A;  2H60 A;  5IGM A;  4QUU A;  4IOO A;  5F63 A;  3U5O A;  4CUS A;  4C67 A;  4NR8 A;  4PCI A;  5KTU A;  4HXK A;  4YYD A; 
#chains in the Genus database with same CATH homology
 5A7C A;  5E9I A;  5FE1 A;  3MUK A;  4YYG A;  3P1E A;  4A9F A;  4NRA A;  3SVH A;  4UIV A;  5CQ4 A;  2RS9 B;  3U5M A;  4LZS A;  3O37 A;  5FFW A;  4PS5 A;  4YYK A;  4Z1S A;  5ETB A;  4Y03 A;  5K29 A;  3QZT A;  4MR5 A;  4QYD A;  4QBM A;  5ETD A;  4CUU A;  5FFY A;  4IR6 A;  5D3J A;  5L8T A;  2I7K A;  4YH4 A;  4C66 A;  5HQ7 A;  4QSP A;  5A82 A;  5FE4 A;  2YW5 A;  4QC3 A;  4UYE A;  2DVQ A;  4O7E A;  4NQN A;  4QUT A;  3P1C A;  4QSV A;  5A83 A;  2YDW A;  3IU5 A;  4UIY A;  5AD3 A;  4XUA A;  3NXB A;  4YC9 A;  3MXF A;  5BT5 A;  5EWW A;  3JVM A;  5JWM A;  4QEW A;  5F25 A;  4TT6 A;  3MUL A;  4YAD A;  3JVK A;  4NYW A;  3G0J A;  5FH6 A;  4QC1 A;  4LZ2 A;  5EPR A;  5DY7 A;  5CGP A;  1E6I A;  4O7F A;  5HCL A;  4HBW A;  5HRV A;  5I7X A;  5CUD A;  4N4F A;  4J0R A;  5EA1 A;  4Z6I A;  5TB6 A;  3UVW A;  4QSX A;  4UIT A;  5FG4 A;  4Z6H A;  4QR5 A;  5FG5 A;  3IU6 A;  3I3J A;  4UIU A;  4LYS A;  3FKM X;  4ALH A;  5IGN A;  4LYI A;  4KCX A;  3S91 A;  4TU4 A;  5FFV A;  5ENF A;  4IR5 A;  4NR6 A;  3AAD A;  5E9K A;  4QST A;  5TCM A;  5LUU A;  4QSW A;  1N72 A;  5EI4 A;  5H1T A;  5L8U A;  5LJ1 A;  3LQI A;  3LQJ A;  5EWH A;  3U5N A;  5F61 A;  4E96 A;  5CFW A;  2WP2 A;  5KU3 A;  5FE9 A;  5G4R A;  5IG6 A;  4NRB A;  4ZC9 A;  5EU1 A;  5DW1 A;  5F5Z A;  3UVD A;  3MQM A;  4A9N A;  5D0C A;  5E3G A;  4LR6 A;  4PKL A;  3LJW A;  2E7O A;  5D3S A;  4O7B A;  5LVQ A;  4QR4 A;  5D3H A;  5DFD A;  2YEK A;  5D26 A;  5EPB A;  4YYJ A;  4QY4 A;  5DKH A;  4F3I A;  3D7C A;  4HXL A;  4YYM A;  4NR7 A;  5F60 A;  3Q2E A;  4NS5 A;  4HBX A;  4YY6 A;  4O70 A;  5E74 A;  5II1 A;  5A5P A;  2E3K A;  4A9L A;  5L99 A;  4YK0 A;  4XYA A;  4YBM A;  5DKD A;  4XUB A;  5ENJ A;  4QB3 A;  4BJX A;  5I89 A;  5FE0 A;  4NR4 A;  5KHM A;  4HBY A;  4LRG A;  2DKW A;  4OGI A;  4NYV A;  4QR3 A;  4O7C A;  5IGK A;  5LKU A;  2F6N A;  5DYU A;  3MB4 A;  2DVS A;  5ENE A;  5LVR A;  4Q0O A;  4UYH A;  5CPE A;  4AKN A;  2G4A A;  4A9H A;  4CUP A;  5EPS A;  2RI7 A;  4BW2 A;  4NUE A;  3K2J A;  5F36 A;  5H1U A;  4YAX A;  4UYF B;  2DVR A;  5E9V A;  5L96 A;  5FE7 A;  5A5R A;  4LDF A;  3DWY A;  5DYX A;  5DFC A;  5CQ7 A;  3U5J A;  3SVG A;  5AD2 A;  5D3L A;  1JSP B;  4TYL A;  3JVJ A;  4LC2 A;  4QZS A;  4A9O A;  5JI8 A;  5L97 A;  4BW1 A;  4O77 A;  5CUG A;  5I1Q A;  5A81 A;  4A9K A;  3AQA A;  5EIC A;  2YYN A;  4QEU A;  5HJC A;  5CUC A;  4BW4 A;  5CQT A;  2R0S A;  5AMF A;  5DLX A;  2L84 A;  5BT4 A;  3S92 A;  4YYN A;  2OO1 A;  4O72 A;  5D3R A;  5IGL A;  2GRC A;  5F3A A;  1F68 A;  5KTW A;  5A5O A;  5CQ3 A;  5D3N A;  4WHW A;  5E7D A;  5ENC A;  5D7X A;  4TU6 A;  3QZS A;  5D3T A;  5A5Q A;  5FB0 A;  5I86 A;  3UW9 A;  5EGU A;  4QEV A;  5C4Q A;  4UIX A;  5ENB A;  5CQ8 A;  2L5E A;  3HME A;  3TLP A;  4IR3 A;  3QZV A;  4MR3 A;  5J0D A;  5EIS A;  4X2I A;  5DYA A;  5DYC A;  5DBM A;  4YYH A;  1JM4 B;  4KV1 A;  4TS8 A;  4LYW A;  5AME A;  4BW3 A;  5CRZ A;  5CUA A;  5KTX A;  5CUE A;  5I29 A;  4CLB A;  4PCE A;  3UVX A;  5HQ6 A;  2R0V A;  5HQ5 A;  4YYI A;  5ACY A;  5CUB A;  4CUT A;  4PY6 A;  5IID A;  3SVF A;  4GPJ A;  4ZQL A;  5DX4 A;  5F1H A;  5H1V A;  4QSQ A;  5LJ0 A;  5ENI A;  4ALG A;  4O7A A;  4FLP A;  2RFJ A;  4MEQ A;  2I8N A;  5E9Y A;  3ONI A;  2RNX A;  2FSA A;  4J3I A;  4Q0N A;  5HEM A;  5A85 A;  5COI A;  5DW2 A;  3U5K A;  3HMH A;  3O34 A;  5I88 A;  2YEL A;  5CQ6 A;  4NXJ A;  2DVV A;  4NYX A;  5H85 A;  4MEO A;  4OUF A;  4CL9 A;  5HFQ A;  5EWV A;  2OUO A;  4WIV A;  4MR4 A;  3UV5 A;  5FE3 A;  2DWW A;  4UYD A;  5CZG A;  5LKZ A;  2D9E A;  5FE6 A;  5FG6 A;  4NUC A;  4N4I A;  5II2 A;  2N9G A;  4J0S A;  5I7Y A;  1X0J A;  4YBT A;  4TT2 A;  5HEN A;  4LZR A;  2LSP B;  4HXP A;  4UYF A;  5EWC A;  3LQH A;  4IOR A;  5EP7 A;  5HFR A;  4CFL A;  4O75 A;  2WP1 A;  5I40 A;  4Z1Q A;  5EV9 A;  3RCW A;  5FBX A;  5DLZ A;  5E9M A;  5F2P A;  5D25 A;  4N3W A;  5ENH A;  2RNW A;  5C85 A;  4XY9 A;  4RVR A;  4O78 A;  2YQD A;  5DKC A;  5FDZ A;  4ZW1 A;  4TZ8 A;  5EQ1 A;  5A5N A;  2NXB A;  4NR5 A;  5C7N A;  5IBN A;  4Z93 A;  5EWD A;  5CU8 A;  4NR9 A;  5FH8 A;  5CRM A;  4HXR A;  3DAI A;  4O76 A;  4YY4 A;  2MJV B;  4A9M A;  3GG3 A;  5C87 A;  4QSR A;  1EQF A;  4UYG A;  5FE5 A;  4MEN A;  3G0L A;  3P5O A;  4N4G A;  3O36 A;  5CQA A;  4A9I A;  5BT3 A;  4TQN A;  4N4H A;  4UIW A;  2D82 A;  5HRW A;  5CY9 A;  4YH3 A;  5A5S A;  5ENG A;  1WUM A;  4MEP A;  5HEL A;  4HXO A;  5CTL A;  3UVY A;  5E3D A;  4HXN A;  4HXM A;  5CP5 A;  5EVA A;  4QSS A;  5FE8 A;  5FB1 A;  5DFB A;  4YAB A;  5F1L A;  2OSS A;  3UV2 A;  3HMF A;  5E9L A;  3MB3 A;  3LXJ A;  4KV4 A;  3O35 A;  3JVL A;  5C8G A;  4OGJ A;  5D24 A;  4CFK A;  5KO4 A;  2RO1 A;  5E73 A;  2DAT A;  1ZS5 A;  3P1F A;  4XY8 A;  4J1P A;  4YAT A;  5G4S A;  3UV4 A;  2R0Y A;  5EM3 A;  4QYL A;  4TTE A;  5I83 A;  4UIZ A;  5L98 A;  4DON A;  4IOQ A;  4YBS A;  2R10 A;  3U5L A;  3ZYU A;  5LKX A;  1WUG A;  3O33 A;  2YEM A;  4PTB A;  4A9E A;  5FE2 A;  5EK9 A;  2F6J A;  5F62 A;  2RNY A;  5LKT A;  4NUD A;  4WHU A;  4CUR A;  4HBV A;  4TT4 A;  2KTB B;  5HRX A;  5D3P A;  5HLS A;  4A9J A;  4QNS A;  5LJ2 A;  2E7N A;  5I80 A;  3U5P A;  5CQ5 A;  4BHW A;  3Q2F A;  4IR4 A;  5E0R A;  5C89 A;  3P1D A;  5CS8 A;  2L85 A;  4TZ2 A;  4QSU A;  4NQM A;  4MR6 A;  4O74 A;  5FH7 A;  4HXS A;  5HM0 A;  4O71 A;  4CUQ A;  4NRC A;  2H60 A;  5IGM A;  4QUU A;  4IOO A;  5F63 A;  3U5O A;  4CUS A;  4C67 A;  4NR8 A;  4PCI A;  5KTU A;  4HXK A;  4YYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...