4A9FA

N-terminal bromodomain of human brd2 with 1-methylpyrrolidin-2-one
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
108
structure length
108
Chain Sequence
VTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 2
publication title Fragment-Based Discovery of Bromodomain Inhibitors Part 1: Inhibitor Binding Modes and Implications for Lead Discovery.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4a9fA00
4QSQA 5L8TA 4BHWA 5DKDA 5HRVA 5A82A 5LVRA 4NYWA 4UYFA 2OUOA 5H1TA 4YYNA 3JVJA 4KV4A 4YH3A 4DONA 4PS5A 3UVXA 5LJ2A 5ENHA 5HELA 5KU3A 5FE0A 3O33A 5CUBA 5II2A 4N3WA 2I7KA 5CY9A 4NQMA 5ETBA 4O76A 4UYFB 5EWVA 5I86A 4MEOA 4TZ2A 5G4SA 4QSWA 4WIVA 5IIDA 4PTBA 5I80A 4QR3A 5HRWA 5DYXA 3U5NA 5ETDA 5F2PA 5HLSA 4NR8A 4NR9A 4UIUA 2F6JA 2N9GA 5HCLA 4OGIA 4HBWA 4O7EA 3U5JA 5JWMA 5HEMA 4BW3A 4YY4A 3QZTA 2RS9B 4NR5A 5ENIA 4OUFA 4LDFA 3DWYA 5D3TA 4YYGA 3U5MA 5CRMA 5E7DA 4O72A 5HFQA 5A85A 5CUCA 2R0YA 4YH4A 3UW9A 2YW5A 5CTLA 5FBXA 5F1HA 5J0DA 2MJVB 5A5OA 5HJCA 5FB1A 4A9LA 4QSRA 2DKWA 4RVRA 4A9JA 5KTXA 4O71A 5EISA 5IG6A 4NUCA 4YYJA 4PY6A 5FH7A 3JVKA 5BT4A 5CFWA 5EPBA 2E3KA 4XY9A 3D7CA 4HXMA 4UITA 5CP5A 5CQ8A 4MEQA 2RNXA 5D3SA 5HQ5A 3S91A 4NR7A 5A83A 4YYHA 5D3NA 4YBMA 1WUGA 5A5SA 5DW2A 1ZS5A 4UIWA 4TTEA 5FE3A 4TYLA 4NR4A 5II1A 5FG4A 3MXFA 1JSPB 3MB4A 5F5ZA 4GPJA 5FE7A 5C89A 1EQFA 4HXLA 4MEPA 3U5PA 3P1EA 4UYHA 5EU1A 2DVRA 5E9LA 3AQAA 5HENA 5CZGA 2WP2A 2YELA 4HXPA 5A5RA 5EPRA 1X0JA 4A9EA 3MQMA 4O78A 5COIA 4IR4A 4MR6A 4LYWA 5FG5A 3QZSA 5D0CA 2RFJA 5AD3A 5IGMA 4TU6A 3P5OA 4CURA 5TB6A 2R0SA 4A9MA 4CL9A 4NYVA 4UYGA 3HMEA 3UV2A 4NQNA 5F25A 4PKLA 5L8UA 4Z6IA 4WHUA 5EM3A 5I7XA 4BJXA 5EWDA 2DWWA 4A9KA 5E9KA 5EWCA 5FH8A 3O35A 3TLPA 5C8GA 3P1DA 4QSVA 5CUGA 5CQAA 5FFYA 5E3GA 4HBVA 4UIXA 2F6NA 5AMFA 4UYDA 4LYIA 4LZRA 5IGNA 4MR5A 5DLXA 4CUTA 4YC9A 4ZC9A 3O36A 4TT2A 3G0LA 4YYMA 5HM0A 4TT6A 4O7FA 3JVLA 4NRBA 5CQ6A 3P1FA 5D3JA 5FFVA 4C66A 4NUEA 5H1VA 3DAIA 3IU6A 4LRGA 5FE2A 2DVQA 4QSUA 5D7XA 3LJWA 2DVVA 4QSTA 4IR3A 3IU5A 3UV4A 4IR5A 4NS5A 4QR5A 5IGKA 4O7AA 3NXBA 5FE8A 4LZ2A 4A9HA 4PCIA 4QNSA 4TU4A 3FKMX 4UIVA 4Y03A 3ZYUA 5FE9A 4QYDA 5CQTA 5HFRA 4NR6A 5DY7A 5AMEA 4XUAA 2OO1A 3O34A 5JI8A 5I89A 5DLZA 3UVDA 4O7BA 4MENA 2RNWA 2YEKA 3SVGA 4YBSA 5C87A 5CQ7A 3MB3A 5EK9A 4O7CA 2L5EA 4HXSA 2WP1A 5E74A 4TS8A 2YDWA 4O77A 5FB0A 2G4AA 4QC1A 5FDZA 1F68A 5CU8A 5I7YA 5FH6A 5H1UA 4BW2A 2DVSA 2NXBA 4NXJA 4O74A 5D24A 4XUBA 5E0RA 4PCEA 4QEWA 4A9NA 5I1QA 4LYSA 1WUMA 2L84A 5LJ0A 4UIZA 4BW1A 4A9FA 4LR6A 1N72A 5ENCA 4Q0NA 5F60A 4QY4A 5LUUA 4N4HA 4FLPA 5EI4A 5EWHA 4QSPA 2YQDA 5DX4A 5ENFA 2R10A 5LKXA 5CS8A 5L96A 3LXJA 1E6IA 3QZVA 5F1LA 4NUDA 4N4IA 4J0RA 5ENBA 2RNYA 4KCXA 3U5LA 5ACYA 4XY8A 4TZ8A 5CQ3A 5EQ1A 5HQ7A 4E96A 5F61A 5DFBA 4QBMA 3K2JA 4QYLA 4MR4A 4TQNA 4YYIA 3JVMA 5A7CA 4KV1A 5DFDA 4QB3A 3U5KA 4LZSA 3UVWA 5I83A 3Q2EA 4NYXA 5EVAA 4QSXA 4N4GA 5L99A 4X2IA 5E9IA 5DYAA 5A5QA 5ENJA 2H60A 2D82A 4J1PA 4YATA 5E73A 4ALHA 2LSPB 5EWWA 5CUEA 3UVYA 5LKTA 5DFCA 5CUAA 4CFLA 5CRZA 1JM4B 5IBNA 4O70A 4Z93A 5E9VA 4YBTA 2R0VA 5I40A 4Q0OA 5DW1A 3Q2FA 4LC2A 5F62A 4QEVA 4OGJA 4IR6A 5FFWA 5IGLA 5C4QA 4YAXA 5E9YA 4HXOA 4CUPA 5E9MA 4CUQA 2KTBB 5LKUA 3LQJA 5D25A 4F3IA 3S92A 4C67A 4YY6A 5FG6A 2DATA 4WHWA 5K29A 5EICA 5E3DA 5LVQA 4A9IA 4ZQLA 4Z1QA 4IOQA 3P1CA 4HXNA 3GG3A 4IORA 3MUKA 5AD2A 5D3RA 4QEUA 3I3JA 4IOOA 4CUSA 2YYNA 5CUDA 5D3HA 5FE5A 5C7NA 4A9OA 2RO1A 5FE1A 5CQ5A 4MR3A 2GRCA 4QUUA 4YK0A 5DKCA 2YEMA 5DYCA 5D26A 5F63A 3HMHA 5KO4A 5KHMA 5A5NA 4QC3A 2E7OA 4HXKA 3MULA 5H85A 4CUUA 4Z6HA 3SVFA 5EA1A 4NRCA 4BW4A 4ZW1A 2E7NA 5FE4A 4Z1SA 4HXRA 5A81A 5BT3A 2L85A 4ALGA 4QR4A 4J3IA 5G4RA 4HBXA 2RI7A 3HMFA 5HQ6A 5CPEA 5L97A 4UIYA 5I88A 4N4FA 5I29A 5BT5A 5C85A 4TT4A 3U5OA 4QSSA 5D3LA 5EPSA 4CLBA 4HBYA 3LQIA 3UV5A 4AKNA 2I8NA 4YADA 5CQ4A 5F36A 2OSSA 4QZSA 4UYEA 5DKHA 5DYUA 4O75A 5L98A 5KTWA 5DBMA 5D3PA 2D9EA 4J0SA 5ENEA 3SVHA 5EP7A 5CGPA 3RCWA 4XYAA 4CFKA 5A5PA 5EGUA 4NRAA 5KTUA 4YYKA 3ONIA 4QUTA 5TCMA 5LKZA 5FE6A 3LQHA 3O37A 5ENGA 5HRXA 3AADA 3G0JA 4YYDA 5F3AA 5EV9A 4YABA 5LJ1A 2FSAA
chains in the Genus database with same CATH superfamily
4QSQA 5L8TA 4BHWA 5DKDA 5HRVA 5A82A 5LVRA 4NYWA 4UYFA 2OUOA 5H1TA 4YYNA 3JVJA 4KV4A 4YH3A 4DONA 4PS5A 3UVXA 5LJ2A 5ENHA 5HELA 5KU3A 5FE0A 3O33A 5CUBA 5II2A 4N3WA 2I7KA 5CY9A 4NQMA 5ETBA 4O76A 4UYFB 5EWVA 5I86A 4MEOA 4TZ2A 5G4SA 4QSWA 4WIVA 5IIDA 4PTBA 5I80A 4QR3A 5HRWA 5DYXA 3U5NA 5ETDA 5F2PA 5HLSA 4NR8A 4NR9A 4UIUA 2F6JA 2N9GA 5HCLA 4OGIA 4HBWA 4O7EA 3U5JA 5JWMA 4AKIA 5HEMA 4BW3A 4YY4A 3QZTA 2RS9B 4NR5A 5ENIA 4OUFA 4LDFA 3DWYA 1ZKRA 5D3TA 4YYGA 3U5MA 5CRMA 5E7DA 4O72A 5HFQA 5A85A 5CUCA 2R0YA 4YH4A 3UW9A 2YW5A 5CTLA 5FBXA 5F1HA 5J0DA 2MJVB 5A5OA 5HJCA 5FB1A 4A9LA 4QSRA 2DKWA 4RVRA 4A9JA 5KTXA 4O71A 5EISA 5IG6A 4NUCA 4YYJA 4PY6A 5FH7A 3JVKA 5BT4A 5CFWA 5EPBA 2E3KA 4XY9A 3D7CA 4HXMA 4UITA 5CP5A 5CQ8A 4MEQA 2RNXA 5D3SA 5HQ5A 3S91A 4NR7A 5A83A 4YYHA 5D3NA 4YBMA 1WUGA 5A5SA 5DW2A 1ZS5A 4UIWA 4TTEA 5FE3A 4TYLA 4NR4A 5II1A 5FG4A 3MXFA 1JSPB 3MB4A 5F5ZA 4GPJA 5FE7A 5C89A 1EQFA 4HXLA 4MEPA 3U5PA 3P1EA 4UYHA 5EU1A 2DVRA 5E9LA 3AQAA 2EJNA 5HENA 5CZGA 2WP2A 2YELA 4HXPA 5A5RA 5EPRA 1X0JA 4A9EA 3MQMA 4O78A 5COIA 4IR4A 4MR6A 4LYWA 5FG5A 3QZSA 5D0CA 2RFJA 5AD3A 5IGMA 4AI6A 4TU6A 3P5OA 4CURA 5TB6A 2R0SA 4A9MA 4CL9A 4NYVA 4UYGA 3HMEA 3UV2A 4NQNA 5F25A 4PKLA 5L8UA 4Z6IA 4WHUA 5EM3A 5I7XA 4BJXA 5EWDA 2DWWA 4A9KA 5E9KA 5EWCA 5FH8A 3O35A 3TLPA 5C8GA 3P1DA 4QSVA 5CUGA 5CQAA 5FFYA 5E3GA 4HBVA 4UIXA 2F6NA 5AMFA 4UYDA 4LYIA 4LZRA 5IGNA 4MR5A 5DLXA 4CUTA 4YC9A 1PUOA 4ZC9A 3O36A 4TT2A 3G0LA 4YYMA 5HM0A 4TT6A 4O7FA 3JVLA 4NRBA 5CQ6A 3P1FA 5D3JA 5FFVA 4C66A 4NUEA 5H1VA 3DAIA 3IU6A 4LRGA 5FE2A 2DVQA 4QSUA 5D7XA 3LJWA 2DVVA 4QSTA 4IR3A 3IU5A 3UV4A 4IR5A 4NS5A 4QR5A 5IGKA 4O7AA 3NXBA 5FE8A 4LZ2A 4A9HA 4PCIA 4QNSA 4AKHA 4TU4A 3FKMX 4UIVA 4Y03A 3ZYUA 5FE9A 4QYDA 5CQTA 5HFRA 4NR6A 5DY7A 5AMEA 4XUAA 2OO1A 3O34A 5JI8A 5I89A 5DLZA 3UVDA 4O7BA 4MENA 2RNWA 2YEKA 3SVGA 4YBSA 5C87A 5CQ7A 3MB3A 5EK9A 4O7CA 2L5EA 4HXSA 2WP1A 5E74A 4TS8A 2YDWA 4O77A 5FB0A 2G4AA 4QC1A 5FDZA 1F68A 5CU8A 5I7YA 5FH6A 5H1UA 4BW2A 2DVSA 2NXBA 4NXJA 4O74A 5D24A 4XUBA 5E0RA 4PCEA 4QEWA 4A9NA 5I1QA 4LYSA 1WUMA 2L84A 5LJ0A 4UIZA 4BW1A 4A9FA 4LR6A 1N72A 5ENCA 4Q0NA 5F60A 4QY4A 5LUUA 4N4HA 4FLPA 5EI4A 5EWHA 4QSPA 2YQDA 5DX4A 5ENFA 2R10A 5LKXA 5CS8A 5L96A 3LXJA 1E6IA 3QZVA 5F1LA 4NUDA 4N4IA 4J0RA 5ENBA 2RNYA 4KCXA 3U5LA 4AKGA 5ACYA 4XY8A 4TZ8A 5CQ3A 5EQ1A 5HQ7A 4E96A 5F61A 5DFBA 4QBMA 3K2JA 4QYLA 3ERRA 4MR4A 4TQNA 4YYIA 3JVMA 5A7CA 4KV1A 5DFDA 4QB3A 3U5KA 4LZSA 3UVWA 5I83A 3Q2EA 4NYXA 5EVAA 4QSXA 4N4GA 5L99A 4X2IA 5E9IA 5DYAA 5A5QA 5ENJA 2H60A 2D82A 4J1PA 4YATA 5E73A 4ALHA 2LSPB 5EWWA 5CUEA 3D1BA 3UVYA 5LKTA 5DFCA 5CUAA 4CFLA 5CRZA 1JM4B 5IBNA 4O70A 4Z93A 5E9VA 4YBTA 2R0VA 5I40A 4Q0OA 5DW1A 3Q2FA 4LC2A 5F62A 4QEVA 4OGJA 4IR6A 5FFWA 5IGLA 5C4QA 4YAXA 3VKHA 3VKGA 5E9YA 4HXOA 4CUPA 5E9MA 4CUQA 2KTBB 5LKUA 3LQJA 5D25A 4F3IA 3S92A 4C67A 4YY6A 5FG6A 2DATA 4WHWA 5K29A 5EICA 5E3DA 5LVQA 4A9IA 4ZQLA 4Z1QA 4IOQA 3P1CA 4HXNA 3GG3A 4IORA 3MUKA 5AD2A 5D3RA 4QEUA 3I3JA 4IOOA 4CUSA 2YYNA 5CUDA 5D3HA 5FE5A 5C7NA 4A9OA 2RO1A 5FE1A 5CQ5A 4MR3A 2GRCA 4QUUA 4YK0A 5DKCA 2YEMA 5DYCA 5D26A 5F63A 3HMHA 5KO4A 5KHMA 5A5NA 4QC3A 2E7OA 4HXKA 3MULA 5H85A 4CUUA 4Z6HA 3SVFA 5EA1A 4NRCA 4BW4A 4ZW1A 2E7NA 5FE4A 4Z1SA 4HXRA 5A81A 5BT3A 2L85A 4ALGA 4QR4A 4J3IA 5G4RA 4HBXA 2RI7A 3HMFA 5HQ6A 5CPEA 3D1DA 5L97A 4UIYA 5I88A 4N4FA 5I29A 5BT5A 5C85A 4TT4A 3U5OA 4QSSA 5D3LA 5EPSA 4CLBA 4HBYA 3LQIA 3UV5A 4AKNA 2I8NA 4YADA 5CQ4A 5F36A 2OSSA 4QZSA 4UYEA 5DKHA 5DYUA 4O75A 5L98A 5KTWA 5DBMA 5D3PA 2D9EA 4J0SA 5ENEA 3SVHA 5EP7A 5CGPA 3RCWA 4XYAA 4CFKA 5A5PA 5EGUA 4NRAA 5KTUA 4YYKA 3ONIA 4QUTA 5TCMA 5LKZA 5FE6A 3LQHA 3O37A 5ENGA 5HRXA 3AADA 3G0JA 4YYDA 5F3AA 5EV9A 4YABA 5LJ1A 2FSAA
chains in the Genus database with same CATH topology
4QSQA 5L8TA 4BHWA 5DKDA 5HRVA 5A82A 5LVRA 4NYWA 4UYFA 2OUOA 5H1TA 4YYNA 3JVJA 4KV4A 4YH3A 4DONA 4PS5A 3UVXA 5LJ2A 5ENHA 5HELA 5KU3A 5FE0A 3O33A 5CUBA 5II2A 4N3WA 2I7KA 5CY9A 4NQMA 5ETBA 4O76A 4UYFB 5EWVA 5I86A 4MEOA 4TZ2A 5G4SA 4QSWA 4WIVA 5IIDA 4PTBA 5I80A 4QR3A 5HRWA 5DYXA 3U5NA 5ETDA 5F2PA 5HLSA 4NR8A 4NR9A 4UIUA 2F6JA 2N9GA 5HCLA 4OGIA 4HBWA 4O7EA 3U5JA 5JWMA 5HEMA 4BW3A 4YY4A 3QZTA 2RS9B 4NR5A 5ENIA 4OUFA 4LDFA 3DWYA 5D3TA 4YYGA 3U5MA 5CRMA 5E7DA 4O72A 5HFQA 5A85A 5CUCA 2R0YA 4YH4A 3UW9A 2YW5A 5CTLA 5FBXA 5F1HA 5J0DA 2MJVB 5A5OA 5HJCA 5FB1A 4A9LA 4QSRA 2DKWA 4RVRA 4A9JA 5KTXA 4O71A 5EISA 5IG6A 4NUCA 4YYJA 4PY6A 5FH7A 3JVKA 5BT4A 5CFWA 5EPBA 2E3KA 4XY9A 3D7CA 4HXMA 4UITA 5CP5A 5CQ8A 4MEQA 2RNXA 5D3SA 5HQ5A 3S91A 4NR7A 5A83A 4YYHA 5D3NA 4YBMA 1WUGA 5A5SA 5DW2A 1ZS5A 4UIWA 4TTEA 5FE3A 4TYLA 4NR4A 5II1A 5FG4A 3MXFA 1JSPB 3MB4A 5F5ZA 4GPJA 5FE7A 5C89A 1EQFA 4HXLA 4MEPA 3U5PA 3P1EA 4UYHA 5EU1A 2DVRA 5E9LA 3AQAA 5HENA 5CZGA 2WP2A 2YELA 4HXPA 5A5RA 5EPRA 1X0JA 4A9EA 3MQMA 4O78A 5COIA 4IR4A 4MR6A 4LYWA 5FG5A 3QZSA 5D0CA 2RFJA 5AD3A 5IGMA 4TU6A 3P5OA 4CURA 5TB6A 2R0SA 4A9MA 4CL9A 4NYVA 4UYGA 3HMEA 3UV2A 4NQNA 5F25A 4PKLA 5L8UA 4Z6IA 4WHUA 5EM3A 5I7XA 4BJXA 5EWDA 2DWWA 4A9KA 5E9KA 5EWCA 5FH8A 3O35A 3TLPA 5C8GA 3P1DA 4QSVA 5CUGA 5CQAA 5FFYA 5E3GA 4HBVA 4UIXA 2F6NA 5AMFA 4UYDA 4LYIA 4LZRA 5IGNA 4MR5A 5DLXA 4CUTA 4YC9A 4ZC9A 3O36A 4TT2A 3G0LA 4YYMA 5HM0A 4TT6A 4O7FA 3JVLA 4NRBA 5CQ6A 3P1FA 5D3JA 5FFVA 4C66A 4NUEA 5H1VA 3DAIA 3IU6A 4LRGA 5FE2A 2DVQA 4QSUA 5D7XA 3LJWA 2DVVA 4QSTA 4IR3A 3IU5A 3UV4A 4IR5A 4NS5A 4QR5A 5IGKA 4O7AA 3NXBA 5FE8A 4LZ2A 4A9HA 4PCIA 4QNSA 4TU4A 3FKMX 4UIVA 4Y03A 3ZYUA 5FE9A 4QYDA 5CQTA 5HFRA 4NR6A 5DY7A 5AMEA 4XUAA 2OO1A 3O34A 5JI8A 5I89A 5DLZA 3UVDA 4O7BA 4MENA 2RNWA 2YEKA 3SVGA 4YBSA 5C87A 5CQ7A 3MB3A 5EK9A 4O7CA 2L5EA 4HXSA 2WP1A 5E74A 4TS8A 2YDWA 4O77A 5FB0A 2G4AA 4QC1A 5FDZA 1F68A 5CU8A 5I7YA 5FH6A 5H1UA 4BW2A 2DVSA 2NXBA 4NXJA 4O74A 5D24A 4XUBA 5E0RA 4PCEA 4QEWA 4A9NA 5I1QA 4LYSA 1WUMA 2L84A 5LJ0A 4UIZA 4BW1A 4A9FA 4LR6A 1N72A 5ENCA 4Q0NA 5F60A 4QY4A 5LUUA 4N4HA 4FLPA 5EI4A 5EWHA 4QSPA 2YQDA 5DX4A 5ENFA 2R10A 5LKXA 5CS8A 5L96A 3LXJA 1E6IA 3QZVA 5F1LA 4NUDA 4N4IA 4J0RA 5ENBA 2RNYA 4KCXA 3U5LA 5ACYA 4XY8A 4TZ8A 5CQ3A 5EQ1A 5HQ7A 4E96A 5F61A 5DFBA 4QBMA 3K2JA 4QYLA 4MR4A 4TQNA 4YYIA 3JVMA 5A7CA 4KV1A 5DFDA 4QB3A 3U5KA 4LZSA 3UVWA 5I83A 3Q2EA 4NYXA 5EVAA 4QSXA 4N4GA 5L99A 4X2IA 5E9IA 5DYAA 5A5QA 5ENJA 2H60A 2D82A 4J1PA 4YATA 5E73A 4ALHA 2LSPB 5EWWA 5CUEA 3UVYA 5LKTA 5DFCA 5CUAA 4CFLA 5CRZA 1JM4B 5IBNA 4O70A 4Z93A 5E9VA 4YBTA 2R0VA 5I40A 4Q0OA 5DW1A 3Q2FA 4LC2A 5F62A 4QEVA 4OGJA 4IR6A 5FFWA 5IGLA 5C4QA 4YAXA 5E9YA 4HXOA 4CUPA 5E9MA 4CUQA 2KTBB 5LKUA 3LQJA 5D25A 4F3IA 3S92A 4C67A 4YY6A 5FG6A 2DATA 4WHWA 5K29A 5EICA 5E3DA 5LVQA 4A9IA 4ZQLA 4Z1QA 4IOQA 3P1CA 4HXNA 3GG3A 4IORA 3MUKA 5AD2A 5D3RA 4QEUA 3I3JA 4IOOA 4CUSA 2YYNA 5CUDA 5D3HA 5FE5A 5C7NA 4A9OA 2RO1A 5FE1A 5CQ5A 4MR3A 2GRCA 4QUUA 4YK0A 5DKCA 2YEMA 5DYCA 5D26A 5F63A 3HMHA 5KO4A 5KHMA 5A5NA 4QC3A 2E7OA 4HXKA 3MULA 5H85A 4CUUA 4Z6HA 3SVFA 5EA1A 4NRCA 4BW4A 4ZW1A 2E7NA 5FE4A 4Z1SA 4HXRA 5A81A 5BT3A 2L85A 4ALGA 4QR4A 4J3IA 5G4RA 4HBXA 2RI7A 3HMFA 5HQ6A 5CPEA 5L97A 4UIYA 5I88A 4N4FA 5I29A 5BT5A 5C85A 4TT4A 3U5OA 4QSSA 5D3LA 5EPSA 4CLBA 4HBYA 3LQIA 3UV5A 4AKNA 2I8NA 4YADA 5CQ4A 5F36A 2OSSA 4QZSA 4UYEA 5DKHA 5DYUA 4O75A 5L98A 5KTWA 5DBMA 5D3PA 2D9EA 4J0SA 5ENEA 3SVHA 5EP7A 5CGPA 3RCWA 4XYAA 4CFKA 5A5PA 5EGUA 4NRAA 5KTUA 4YYKA 3ONIA 4QUTA 5TCMA 5LKZA 5FE6A 3LQHA 3O37A 5ENGA 5HRXA 3AADA 3G0JA 4YYDA 5F3AA 5EV9A 4YABA 5LJ1A 2FSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QSQ A;  5L8T A;  4BHW A;  5DKD A;  5HRV A;  5A82 A;  5LVR A;  4NYW A;  4UYF A;  2OUO A;  5H1T A;  4YYN A;  3JVJ A;  4KV4 A;  4YH3 A;  4DON A;  4PS5 A;  3UVX A;  5LJ2 A;  5ENH A;  5HEL A;  5KU3 A;  5FE0 A;  3O33 A;  5CUB A;  5II2 A;  4N3W A;  2I7K A;  5CY9 A;  4NQM A;  5ETB A;  4O76 A;  4UYF B;  5EWV A;  5I86 A;  4MEO A;  4TZ2 A;  5G4S A;  4QSW A;  4WIV A;  5IID A;  4PTB A;  5I80 A;  4QR3 A;  5HRW A;  5DYX A;  3U5N A;  5ETD A;  5F2P A;  5HLS A;  4NR8 A;  4NR9 A;  4UIU A;  2F6J A;  2N9G A;  5HCL A;  4OGI A;  4HBW A;  4O7E A;  3U5J A;  5JWM A;  5HEM A;  4BW3 A;  4YY4 A;  3QZT A;  2RS9 B;  4NR5 A;  5ENI A;  4OUF A;  4LDF A;  3DWY A;  5D3T A;  4YYG A;  3U5M A;  5CRM A;  5E7D A;  4O72 A;  5HFQ A;  5A85 A;  5CUC A;  2R0Y A;  4YH4 A;  3UW9 A;  2YW5 A;  5CTL A;  5FBX A;  5F1H A;  5J0D A;  2MJV B;  5A5O A;  5HJC A;  5FB1 A;  4A9L A;  4QSR A;  2DKW A;  4RVR A;  4A9J A;  5KTX A;  4O71 A;  5EIS A;  5IG6 A;  4NUC A;  4YYJ A;  4PY6 A;  5FH7 A;  3JVK A;  5BT4 A;  5CFW A;  5EPB A;  2E3K A;  4XY9 A;  3D7C A;  4HXM A;  4UIT A;  5CP5 A;  5CQ8 A;  4MEQ A;  2RNX A;  5D3S A;  5HQ5 A;  3S91 A;  4NR7 A;  5A83 A;  4YYH A;  5D3N A;  4YBM A;  1WUG A;  5A5S A;  5DW2 A;  1ZS5 A;  4UIW A;  4TTE A;  5FE3 A;  4TYL A;  4NR4 A;  5II1 A;  5FG4 A;  3MXF A;  1JSP B;  3MB4 A;  5F5Z A;  4GPJ A;  5FE7 A;  5C89 A;  1EQF A;  4HXL A;  4MEP A;  3U5P A;  3P1E A;  4UYH A;  5EU1 A;  2DVR A;  5E9L A;  3AQA A;  5HEN A;  5CZG A;  2WP2 A;  2YEL A;  4HXP A;  5A5R A;  5EPR A;  1X0J A;  4A9E A;  3MQM A;  4O78 A;  5COI A;  4IR4 A;  4MR6 A;  4LYW A;  5FG5 A;  3QZS A;  5D0C A;  2RFJ A;  5AD3 A;  5IGM A;  4TU6 A;  3P5O A;  4CUR A;  5TB6 A;  2R0S A;  4A9M A;  4CL9 A;  4NYV A;  4UYG A;  3HME A;  3UV2 A;  4NQN A;  5F25 A;  4PKL A;  5L8U A;  4Z6I A;  4WHU A;  5EM3 A;  5I7X A;  4BJX A;  5EWD A;  2DWW A;  4A9K A;  5E9K A;  5EWC A;  5FH8 A;  3O35 A;  3TLP A;  5C8G A;  3P1D A;  4QSV A;  5CUG A;  5CQA A;  5FFY A;  5E3G A;  4HBV A;  4UIX A;  2F6N A;  5AMF A;  4UYD A;  4LYI A;  4LZR A;  5IGN A;  4MR5 A;  5DLX A;  4CUT A;  4YC9 A;  4ZC9 A;  3O36 A;  4TT2 A;  3G0L A;  4YYM A;  5HM0 A;  4TT6 A;  4O7F A;  3JVL A;  4NRB A;  5CQ6 A;  3P1F A;  5D3J A;  5FFV A;  4C66 A;  4NUE A;  5H1V A;  3DAI A;  3IU6 A;  4LRG A;  5FE2 A;  2DVQ A;  4QSU A;  5D7X A;  3LJW A;  2DVV A;  4QST A;  4IR3 A;  3IU5 A;  3UV4 A;  4IR5 A;  4NS5 A;  4QR5 A;  5IGK A;  4O7A A;  3NXB A;  5FE8 A;  4LZ2 A;  4A9H A;  4PCI A;  4QNS A;  4TU4 A;  3FKM X;  4UIV A;  4Y03 A;  3ZYU A;  5FE9 A;  4QYD A;  5CQT A;  5HFR A;  4NR6 A;  5DY7 A;  5AME A;  4XUA A;  2OO1 A;  3O34 A;  5JI8 A;  5I89 A;  5DLZ A;  3UVD A;  4O7B A;  4MEN A;  2RNW A;  2YEK A;  3SVG A;  4YBS A;  5C87 A;  5CQ7 A;  3MB3 A;  5EK9 A;  4O7C A;  2L5E A;  4HXS A;  2WP1 A;  5E74 A;  4TS8 A;  2YDW A;  4O77 A;  5FB0 A;  2G4A A;  4QC1 A;  5FDZ A;  1F68 A;  5CU8 A;  5I7Y A;  5FH6 A;  5H1U A;  4BW2 A;  2DVS A;  2NXB A;  4NXJ A;  4O74 A;  5D24 A;  4XUB A;  5E0R A;  4PCE A;  4QEW A;  4A9N A;  5I1Q A;  4LYS A;  1WUM A;  2L84 A;  5LJ0 A;  4UIZ A;  4BW1 A;  4A9F A;  4LR6 A;  1N72 A;  5ENC A;  4Q0N A;  5F60 A;  4QY4 A;  5LUU A;  4N4H A;  4FLP A;  5EI4 A;  5EWH A;  4QSP A;  2YQD A;  5DX4 A;  5ENF A;  2R10 A;  5LKX A;  5CS8 A;  5L96 A;  3LXJ A;  1E6I A;  3QZV A;  5F1L A;  4NUD A;  4N4I A;  4J0R A;  5ENB A;  2RNY A;  4KCX A;  3U5L A;  5ACY A;  4XY8 A;  4TZ8 A;  5CQ3 A;  5EQ1 A;  5HQ7 A;  4E96 A;  5F61 A;  5DFB A;  4QBM A;  3K2J A;  4QYL A;  4MR4 A;  4TQN A;  4YYI A;  3JVM A;  5A7C A;  4KV1 A;  5DFD A;  4QB3 A;  3U5K A;  4LZS A;  3UVW A;  5I83 A;  3Q2E A;  4NYX A;  5EVA A;  4QSX A;  4N4G A;  5L99 A;  4X2I A;  5E9I A;  5DYA A;  5A5Q A;  5ENJ A;  2H60 A;  2D82 A;  4J1P A;  4YAT A;  5E73 A;  4ALH A;  2LSP B;  5EWW A;  5CUE A;  3UVY A;  5LKT A;  5DFC A;  5CUA A;  4CFL A;  5CRZ A;  1JM4 B;  5IBN A;  4O70 A;  4Z93 A;  5E9V A;  4YBT A;  2R0V A;  5I40 A;  4Q0O A;  5DW1 A;  3Q2F A;  4LC2 A;  5F62 A;  4QEV A;  4OGJ A;  4IR6 A;  5FFW A;  5IGL A;  5C4Q A;  4YAX A;  5E9Y A;  4HXO A;  4CUP A;  5E9M A;  4CUQ A;  2KTB B;  5LKU A;  3LQJ A;  5D25 A;  4F3I A;  3S92 A;  4C67 A;  4YY6 A;  5FG6 A;  2DAT A;  4WHW A;  5K29 A;  5EIC A;  5E3D A;  5LVQ A;  4A9I A;  4ZQL A;  4Z1Q A;  4IOQ A;  3P1C A;  4HXN A;  3GG3 A;  4IOR A;  3MUK A;  5AD2 A;  5D3R A;  4QEU A;  3I3J A;  4IOO A;  4CUS A;  2YYN A;  5CUD A;  5D3H A;  5FE5 A;  5C7N A;  4A9O A;  2RO1 A;  5FE1 A;  5CQ5 A;  4MR3 A;  2GRC A;  4QUU A;  4YK0 A;  5DKC A;  2YEM A;  5DYC A;  5D26 A;  5F63 A;  3HMH A;  5KO4 A;  5KHM A;  5A5N A;  4QC3 A;  2E7O A;  4HXK A;  3MUL A;  5H85 A;  4CUU A;  4Z6H A;  3SVF A;  5EA1 A;  4NRC A;  4BW4 A;  4ZW1 A;  2E7N A;  5FE4 A;  4Z1S A;  4HXR A;  5A81 A;  5BT3 A;  2L85 A;  4ALG A;  4QR4 A;  4J3I A;  5G4R A;  4HBX A;  2RI7 A;  3HMF A;  5HQ6 A;  5CPE A;  5L97 A;  4UIY A;  5I88 A;  4N4F A;  5I29 A;  5BT5 A;  5C85 A;  4TT4 A;  3U5O A;  4QSS A;  5D3L A;  5EPS A;  4CLB A;  4HBY A;  3LQI A;  3UV5 A;  4AKN A;  2I8N A;  4YAD A;  5CQ4 A;  5F36 A;  2OSS A;  4QZS A;  4UYE A;  5DKH A;  5DYU A;  4O75 A;  5L98 A;  5KTW A;  5DBM A;  5D3P A;  2D9E A;  4J0S A;  5ENE A;  3SVH A;  5EP7 A;  5CGP A;  3RCW A;  4XYA A;  4CFK A;  5A5P A;  5EGU A;  4NRA A;  5KTU A;  4YYK A;  3ONI A;  4QUT A;  5TCM A;  5LKZ A;  5FE6 A;  3LQH A;  3O37 A;  5ENG A;  5HRX A;  3AAD A;  3G0J A;  4YYD A;  5F3A A;  5EV9 A;  4YAB A;  5LJ1 A;  2FSA A; 
#chains in the Genus database with same CATH topology
 4QSQ A;  5L8T A;  4BHW A;  5DKD A;  5HRV A;  5A82 A;  5LVR A;  4NYW A;  4UYF A;  2OUO A;  5H1T A;  4YYN A;  3JVJ A;  4KV4 A;  4YH3 A;  4DON A;  4PS5 A;  3UVX A;  5LJ2 A;  5ENH A;  5HEL A;  5KU3 A;  5FE0 A;  3O33 A;  5CUB A;  5II2 A;  4N3W A;  2I7K A;  5CY9 A;  4NQM A;  5ETB A;  4O76 A;  4UYF B;  5EWV A;  5I86 A;  4MEO A;  4TZ2 A;  5G4S A;  4QSW A;  4WIV A;  5IID A;  4PTB A;  5I80 A;  4QR3 A;  5HRW A;  5DYX A;  3U5N A;  5ETD A;  5F2P A;  5HLS A;  4NR8 A;  4NR9 A;  4UIU A;  2F6J A;  2N9G A;  5HCL A;  4OGI A;  4HBW A;  4O7E A;  3U5J A;  5JWM A;  4AKI A;  5HEM A;  4BW3 A;  4YY4 A;  3QZT A;  2RS9 B;  4NR5 A;  5ENI A;  4OUF A;  4LDF A;  3DWY A;  1ZKR A;  5D3T A;  4YYG A;  3U5M A;  5CRM A;  5E7D A;  4O72 A;  5HFQ A;  5A85 A;  5CUC A;  2R0Y A;  4YH4 A;  3UW9 A;  2YW5 A;  5CTL A;  5FBX A;  5F1H A;  5J0D A;  2MJV B;  5A5O A;  5HJC A;  5FB1 A;  4A9L A;  4QSR A;  2DKW A;  4RVR A;  4A9J A;  5KTX A;  4O71 A;  5EIS A;  5IG6 A;  4NUC A;  4YYJ A;  4PY6 A;  5FH7 A;  3JVK A;  5BT4 A;  5CFW A;  5EPB A;  2E3K A;  4XY9 A;  3D7C A;  4HXM A;  4UIT A;  5CP5 A;  5CQ8 A;  4MEQ A;  2RNX A;  5D3S A;  5HQ5 A;  3S91 A;  4NR7 A;  5A83 A;  4YYH A;  5D3N A;  4YBM A;  1WUG A;  5A5S A;  5DW2 A;  1ZS5 A;  4UIW A;  4TTE A;  5FE3 A;  4TYL A;  4NR4 A;  5II1 A;  5FG4 A;  3MXF A;  1JSP B;  3MB4 A;  5F5Z A;  4GPJ A;  5FE7 A;  5C89 A;  1EQF A;  4HXL A;  4MEP A;  3U5P A;  3P1E A;  4UYH A;  5EU1 A;  2DVR A;  5E9L A;  3AQA A;  2EJN A;  5HEN A;  5CZG A;  2WP2 A;  2YEL A;  4HXP A;  5A5R A;  5EPR A;  1X0J A;  4A9E A;  3MQM A;  4O78 A;  5COI A;  4IR4 A;  4MR6 A;  4LYW A;  5FG5 A;  3QZS A;  5D0C A;  2RFJ A;  5AD3 A;  5IGM A;  4AI6 A;  4TU6 A;  3P5O A;  4CUR A;  5TB6 A;  2R0S A;  4A9M A;  4CL9 A;  4NYV A;  4UYG A;  3HME A;  3UV2 A;  4NQN A;  5F25 A;  4PKL A;  5L8U A;  4Z6I A;  4WHU A;  5EM3 A;  5I7X A;  4BJX A;  5EWD A;  2DWW A;  4A9K A;  5E9K A;  5EWC A;  5FH8 A;  3O35 A;  3TLP A;  5C8G A;  3P1D A;  4QSV A;  5CUG A;  5CQA A;  5FFY A;  5E3G A;  4HBV A;  4UIX A;  2F6N A;  5AMF A;  4UYD A;  4LYI A;  4LZR A;  5IGN A;  4MR5 A;  5DLX A;  4CUT A;  4YC9 A;  1PUO A;  4ZC9 A;  3O36 A;  4TT2 A;  3G0L A;  4YYM A;  5HM0 A;  4TT6 A;  4O7F A;  3JVL A;  4NRB A;  5CQ6 A;  3P1F A;  5D3J A;  5FFV A;  4C66 A;  4NUE A;  5H1V A;  3DAI A;  3IU6 A;  4LRG A;  5FE2 A;  2DVQ A;  4QSU A;  5D7X A;  3LJW A;  2DVV A;  4QST A;  4IR3 A;  3IU5 A;  3UV4 A;  4IR5 A;  4NS5 A;  4QR5 A;  5IGK A;  4O7A A;  3NXB A;  5FE8 A;  4LZ2 A;  4A9H A;  4PCI A;  4QNS A;  4AKH A;  4TU4 A;  3FKM X;  4UIV A;  4Y03 A;  3ZYU A;  5FE9 A;  4QYD A;  5CQT A;  5HFR A;  4NR6 A;  5DY7 A;  5AME A;  4XUA A;  2OO1 A;  3O34 A;  5JI8 A;  5I89 A;  5DLZ A;  3UVD A;  4O7B A;  4MEN A;  2RNW A;  2YEK A;  3SVG A;  4YBS A;  5C87 A;  5CQ7 A;  3MB3 A;  5EK9 A;  4O7C A;  2L5E A;  4HXS A;  2WP1 A;  5E74 A;  4TS8 A;  2YDW A;  4O77 A;  5FB0 A;  2G4A A;  4QC1 A;  5FDZ A;  1F68 A;  5CU8 A;  5I7Y A;  5FH6 A;  5H1U A;  4BW2 A;  2DVS A;  2NXB A;  4NXJ A;  4O74 A;  5D24 A;  4XUB A;  5E0R A;  4PCE A;  4QEW A;  4A9N A;  5I1Q A;  4LYS A;  1WUM A;  2L84 A;  5LJ0 A;  4UIZ A;  4BW1 A;  4A9F A;  4LR6 A;  1N72 A;  5ENC A;  4Q0N A;  5F60 A;  4QY4 A;  5LUU A;  4N4H A;  4FLP A;  5EI4 A;  5EWH A;  4QSP A;  2YQD A;  5DX4 A;  5ENF A;  2R10 A;  5LKX A;  5CS8 A;  5L96 A;  3LXJ A;  1E6I A;  3QZV A;  5F1L A;  4NUD A;  4N4I A;  4J0R A;  5ENB A;  2RNY A;  4KCX A;  3U5L A;  4AKG A;  5ACY A;  4XY8 A;  4TZ8 A;  5CQ3 A;  5EQ1 A;  5HQ7 A;  4E96 A;  5F61 A;  5DFB A;  4QBM A;  3K2J A;  4QYL A;  3ERR A;  4MR4 A;  4TQN A;  4YYI A;  3JVM A;  5A7C A;  4KV1 A;  5DFD A;  4QB3 A;  3U5K A;  4LZS A;  3UVW A;  5I83 A;  3Q2E A;  4NYX A;  5EVA A;  4QSX A;  4N4G A;  5L99 A;  4X2I A;  5E9I A;  5DYA A;  5A5Q A;  5ENJ A;  2H60 A;  2D82 A;  4J1P A;  4YAT A;  5E73 A;  4ALH A;  2LSP B;  5EWW A;  5CUE A;  3D1B A;  3UVY A;  5LKT A;  5DFC A;  5CUA A;  4CFL A;  5CRZ A;  1JM4 B;  5IBN A;  4O70 A;  4Z93 A;  5E9V A;  4YBT A;  2R0V A;  5I40 A;  4Q0O A;  5DW1 A;  3Q2F A;  4LC2 A;  5F62 A;  4QEV A;  4OGJ A;  4IR6 A;  5FFW A;  5IGL A;  5C4Q A;  4YAX A;  3VKH A;  3VKG A;  5E9Y A;  4HXO A;  4CUP A;  5E9M A;  4CUQ A;  2KTB B;  5LKU A;  3LQJ A;  5D25 A;  4F3I A;  3S92 A;  4C67 A;  4YY6 A;  5FG6 A;  2DAT A;  4WHW A;  5K29 A;  5EIC A;  5E3D A;  5LVQ A;  4A9I A;  4ZQL A;  4Z1Q A;  4IOQ A;  3P1C A;  4HXN A;  3GG3 A;  4IOR A;  3MUK A;  5AD2 A;  5D3R A;  4QEU A;  3I3J A;  4IOO A;  4CUS A;  2YYN A;  5CUD A;  5D3H A;  5FE5 A;  5C7N A;  4A9O A;  2RO1 A;  5FE1 A;  5CQ5 A;  4MR3 A;  2GRC A;  4QUU A;  4YK0 A;  5DKC A;  2YEM A;  5DYC A;  5D26 A;  5F63 A;  3HMH A;  5KO4 A;  5KHM A;  5A5N A;  4QC3 A;  2E7O A;  4HXK A;  3MUL A;  5H85 A;  4CUU A;  4Z6H A;  3SVF A;  5EA1 A;  4NRC A;  4BW4 A;  4ZW1 A;  2E7N A;  5FE4 A;  4Z1S A;  4HXR A;  5A81 A;  5BT3 A;  2L85 A;  4ALG A;  4QR4 A;  4J3I A;  5G4R A;  4HBX A;  2RI7 A;  3HMF A;  5HQ6 A;  5CPE A;  3D1D A;  5L97 A;  4UIY A;  5I88 A;  4N4F A;  5I29 A;  5BT5 A;  5C85 A;  4TT4 A;  3U5O A;  4QSS A;  5D3L A;  5EPS A;  4CLB A;  4HBY A;  3LQI A;  3UV5 A;  4AKN A;  2I8N A;  4YAD A;  5CQ4 A;  5F36 A;  2OSS A;  4QZS A;  4UYE A;  5DKH A;  5DYU A;  4O75 A;  5L98 A;  5KTW A;  5DBM A;  5D3P A;  2D9E A;  4J0S A;  5ENE A;  3SVH A;  5EP7 A;  5CGP A;  3RCW A;  4XYA A;  4CFK A;  5A5P A;  5EGU A;  4NRA A;  5KTU A;  4YYK A;  3ONI A;  4QUT A;  5TCM A;  5LKZ A;  5FE6 A;  3LQH A;  3O37 A;  5ENG A;  5HRX A;  3AAD A;  3G0J A;  4YYD A;  5F3A A;  5EV9 A;  4YAB A;  5LJ1 A;  2FSA A; 
#chains in the Genus database with same CATH homology
 4QSQ A;  5L8T A;  4BHW A;  5DKD A;  5HRV A;  5A82 A;  5LVR A;  4NYW A;  4UYF A;  2OUO A;  5H1T A;  4YYN A;  3JVJ A;  4KV4 A;  4YH3 A;  4DON A;  4PS5 A;  3UVX A;  5LJ2 A;  5ENH A;  5HEL A;  5KU3 A;  5FE0 A;  3O33 A;  5CUB A;  5II2 A;  4N3W A;  2I7K A;  5CY9 A;  4NQM A;  5ETB A;  4O76 A;  4UYF B;  5EWV A;  5I86 A;  4MEO A;  4TZ2 A;  5G4S A;  4QSW A;  4WIV A;  5IID A;  4PTB A;  5I80 A;  4QR3 A;  5HRW A;  5DYX A;  3U5N A;  5ETD A;  5F2P A;  5HLS A;  4NR8 A;  4NR9 A;  4UIU A;  2F6J A;  2N9G A;  5HCL A;  4OGI A;  4HBW A;  4O7E A;  3U5J A;  5JWM A;  5HEM A;  4BW3 A;  4YY4 A;  3QZT A;  2RS9 B;  4NR5 A;  5ENI A;  4OUF A;  4LDF A;  3DWY A;  5D3T A;  4YYG A;  3U5M A;  5CRM A;  5E7D A;  4O72 A;  5HFQ A;  5A85 A;  5CUC A;  2R0Y A;  4YH4 A;  3UW9 A;  2YW5 A;  5CTL A;  5FBX A;  5F1H A;  5J0D A;  2MJV B;  5A5O A;  5HJC A;  5FB1 A;  4A9L A;  4QSR A;  2DKW A;  4RVR A;  4A9J A;  5KTX A;  4O71 A;  5EIS A;  5IG6 A;  4NUC A;  4YYJ A;  4PY6 A;  5FH7 A;  3JVK A;  5BT4 A;  5CFW A;  5EPB A;  2E3K A;  4XY9 A;  3D7C A;  4HXM A;  4UIT A;  5CP5 A;  5CQ8 A;  4MEQ A;  2RNX A;  5D3S A;  5HQ5 A;  3S91 A;  4NR7 A;  5A83 A;  4YYH A;  5D3N A;  4YBM A;  1WUG A;  5A5S A;  5DW2 A;  1ZS5 A;  4UIW A;  4TTE A;  5FE3 A;  4TYL A;  4NR4 A;  5II1 A;  5FG4 A;  3MXF A;  1JSP B;  3MB4 A;  5F5Z A;  4GPJ A;  5FE7 A;  5C89 A;  1EQF A;  4HXL A;  4MEP A;  3U5P A;  3P1E A;  4UYH A;  5EU1 A;  2DVR A;  5E9L A;  3AQA A;  5HEN A;  5CZG A;  2WP2 A;  2YEL A;  4HXP A;  5A5R A;  5EPR A;  1X0J A;  4A9E A;  3MQM A;  4O78 A;  5COI A;  4IR4 A;  4MR6 A;  4LYW A;  5FG5 A;  3QZS A;  5D0C A;  2RFJ A;  5AD3 A;  5IGM A;  4TU6 A;  3P5O A;  4CUR A;  5TB6 A;  2R0S A;  4A9M A;  4CL9 A;  4NYV A;  4UYG A;  3HME A;  3UV2 A;  4NQN A;  5F25 A;  4PKL A;  5L8U A;  4Z6I A;  4WHU A;  5EM3 A;  5I7X A;  4BJX A;  5EWD A;  2DWW A;  4A9K A;  5E9K A;  5EWC A;  5FH8 A;  3O35 A;  3TLP A;  5C8G A;  3P1D A;  4QSV A;  5CUG A;  5CQA A;  5FFY A;  5E3G A;  4HBV A;  4UIX A;  2F6N A;  5AMF A;  4UYD A;  4LYI A;  4LZR A;  5IGN A;  4MR5 A;  5DLX A;  4CUT A;  4YC9 A;  4ZC9 A;  3O36 A;  4TT2 A;  3G0L A;  4YYM A;  5HM0 A;  4TT6 A;  4O7F A;  3JVL A;  4NRB A;  5CQ6 A;  3P1F A;  5D3J A;  5FFV A;  4C66 A;  4NUE A;  5H1V A;  3DAI A;  3IU6 A;  4LRG A;  5FE2 A;  2DVQ A;  4QSU A;  5D7X A;  3LJW A;  2DVV A;  4QST A;  4IR3 A;  3IU5 A;  3UV4 A;  4IR5 A;  4NS5 A;  4QR5 A;  5IGK A;  4O7A A;  3NXB A;  5FE8 A;  4LZ2 A;  4A9H A;  4PCI A;  4QNS A;  4TU4 A;  3FKM X;  4UIV A;  4Y03 A;  3ZYU A;  5FE9 A;  4QYD A;  5CQT A;  5HFR A;  4NR6 A;  5DY7 A;  5AME A;  4XUA A;  2OO1 A;  3O34 A;  5JI8 A;  5I89 A;  5DLZ A;  3UVD A;  4O7B A;  4MEN A;  2RNW A;  2YEK A;  3SVG A;  4YBS A;  5C87 A;  5CQ7 A;  3MB3 A;  5EK9 A;  4O7C A;  2L5E A;  4HXS A;  2WP1 A;  5E74 A;  4TS8 A;  2YDW A;  4O77 A;  5FB0 A;  2G4A A;  4QC1 A;  5FDZ A;  1F68 A;  5CU8 A;  5I7Y A;  5FH6 A;  5H1U A;  4BW2 A;  2DVS A;  2NXB A;  4NXJ A;  4O74 A;  5D24 A;  4XUB A;  5E0R A;  4PCE A;  4QEW A;  4A9N A;  5I1Q A;  4LYS A;  1WUM A;  2L84 A;  5LJ0 A;  4UIZ A;  4BW1 A;  4A9F A;  4LR6 A;  1N72 A;  5ENC A;  4Q0N A;  5F60 A;  4QY4 A;  5LUU A;  4N4H A;  4FLP A;  5EI4 A;  5EWH A;  4QSP A;  2YQD A;  5DX4 A;  5ENF A;  2R10 A;  5LKX A;  5CS8 A;  5L96 A;  3LXJ A;  1E6I A;  3QZV A;  5F1L A;  4NUD A;  4N4I A;  4J0R A;  5ENB A;  2RNY A;  4KCX A;  3U5L A;  5ACY A;  4XY8 A;  4TZ8 A;  5CQ3 A;  5EQ1 A;  5HQ7 A;  4E96 A;  5F61 A;  5DFB A;  4QBM A;  3K2J A;  4QYL A;  4MR4 A;  4TQN A;  4YYI A;  3JVM A;  5A7C A;  4KV1 A;  5DFD A;  4QB3 A;  3U5K A;  4LZS A;  3UVW A;  5I83 A;  3Q2E A;  4NYX A;  5EVA A;  4QSX A;  4N4G A;  5L99 A;  4X2I A;  5E9I A;  5DYA A;  5A5Q A;  5ENJ A;  2H60 A;  2D82 A;  4J1P A;  4YAT A;  5E73 A;  4ALH A;  2LSP B;  5EWW A;  5CUE A;  3UVY A;  5LKT A;  5DFC A;  5CUA A;  4CFL A;  5CRZ A;  1JM4 B;  5IBN A;  4O70 A;  4Z93 A;  5E9V A;  4YBT A;  2R0V A;  5I40 A;  4Q0O A;  5DW1 A;  3Q2F A;  4LC2 A;  5F62 A;  4QEV A;  4OGJ A;  4IR6 A;  5FFW A;  5IGL A;  5C4Q A;  4YAX A;  5E9Y A;  4HXO A;  4CUP A;  5E9M A;  4CUQ A;  2KTB B;  5LKU A;  3LQJ A;  5D25 A;  4F3I A;  3S92 A;  4C67 A;  4YY6 A;  5FG6 A;  2DAT A;  4WHW A;  5K29 A;  5EIC A;  5E3D A;  5LVQ A;  4A9I A;  4ZQL A;  4Z1Q A;  4IOQ A;  3P1C A;  4HXN A;  3GG3 A;  4IOR A;  3MUK A;  5AD2 A;  5D3R A;  4QEU A;  3I3J A;  4IOO A;  4CUS A;  2YYN A;  5CUD A;  5D3H A;  5FE5 A;  5C7N A;  4A9O A;  2RO1 A;  5FE1 A;  5CQ5 A;  4MR3 A;  2GRC A;  4QUU A;  4YK0 A;  5DKC A;  2YEM A;  5DYC A;  5D26 A;  5F63 A;  3HMH A;  5KO4 A;  5KHM A;  5A5N A;  4QC3 A;  2E7O A;  4HXK A;  3MUL A;  5H85 A;  4CUU A;  4Z6H A;  3SVF A;  5EA1 A;  4NRC A;  4BW4 A;  4ZW1 A;  2E7N A;  5FE4 A;  4Z1S A;  4HXR A;  5A81 A;  5BT3 A;  2L85 A;  4ALG A;  4QR4 A;  4J3I A;  5G4R A;  4HBX A;  2RI7 A;  3HMF A;  5HQ6 A;  5CPE A;  5L97 A;  4UIY A;  5I88 A;  4N4F A;  5I29 A;  5BT5 A;  5C85 A;  4TT4 A;  3U5O A;  4QSS A;  5D3L A;  5EPS A;  4CLB A;  4HBY A;  3LQI A;  3UV5 A;  4AKN A;  2I8N A;  4YAD A;  5CQ4 A;  5F36 A;  2OSS A;  4QZS A;  4UYE A;  5DKH A;  5DYU A;  4O75 A;  5L98 A;  5KTW A;  5DBM A;  5D3P A;  2D9E A;  4J0S A;  5ENE A;  3SVH A;  5EP7 A;  5CGP A;  3RCW A;  4XYA A;  4CFK A;  5A5P A;  5EGU A;  4NRA A;  5KTU A;  4YYK A;  3ONI A;  4QUT A;  5TCM A;  5LKZ A;  5FE6 A;  3LQH A;  3O37 A;  5ENG A;  5HRX A;  3AAD A;  3G0J A;  4YYD A;  5F3A A;  5EV9 A;  4YAB A;  5LJ1 A;  2FSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...