5KTUA

Crystal structure of the bromodomain of human crebbp bound to pyrazolopiperidine scaffold
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
b'ELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Discovery of a Potent and Selective in Vivo Probe (GNE-272) for the Bromodomains of CBP/EP300.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 37
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ktuA00
3G0JA 5D3RA 4YYGA 4YYNA 4KCXA 4TS8A 5DFBA 3LQIA 5AMFA 5H1VA 5HELA 5G4SA 5H85A 2RNYA 4QC1A 5C87A 5HENA 5A81A 5DFCA 3SVFA 5ENFA 4A9OA 4N4FA 4ALGA 5DW1A 4NUCA 5FG4A 3DAIA 5HQ7A 2DWWA 5I88A 4CUUA 5DYXA 2DATA 5EA1A 4YK0A 5I29A 2GRCA 5L97A 4F3IA 5I89A 4CURA 5E73A 4IR4A 3LJWA 5I83A 5J0DA 5D3JA 4NR4A 5C7NA 4N4GA 3MB4A 2RS9B 2D9EA 5C89A 4MEOA 4QSVA 5IGKA 4UIXA 4LZRA 4NRBA 4YYHA 5FE6A 4OUFA 4NRCA 5EI4A 5TCMA 5D0CA 4A9MA 5H1TA 4A9JA 3HMHA 5HRVA 4QEWA 4YABA 4UIVA 5ENCA 3U5OA 4NYWA 4TT4A 4NRAA 4WIVA 4O7FA 4QR4A 4HBVA 5FE5A 4QBMA 2DVVA 4Q0NA 3UV4A 5D24A 4IOQA 4CL9A 5ENEA 4QC3A 2YEKA 2R10A 5FDZA 4NQNA 5ENGA 3AADA 5I7YA 3HMEA 4CFKA 3HMFA 5A5SA 5DLXA 3G0LA 3S91A 4KV4A 5BT3A 5FE0A 5A5NA 4LDFA 4YH3A 3U5LA 3U5PA 3LQHA 3LQJA 2DVSA 5CUAA 4HXRA 4HXOA 5A82A 2I7KA 4O7CA 5FH7A 5BT5A 5D3PA 4LYWA 4PKLA 5E9KA 4J0RA 4IR3A 2RFJA 5DFDA 4C66A 5KTXA 5DW2A 2L5EA 4Z93A 4TU4A 4XY9A 3U5MA 3UVDA 4J1PA 5CTLA 5A83A 3D7CA 4QSUA 5E3GA 5HEMA 5F36A 5A5OA 5F62A 5E9VA 4HXMA 4BJXA 2R0VA 5ENHA 5DX4A 4YBSA 1E6IA 5DYCA 5EQ1A 2N9GA 5E9IA 5COIA 3DWYA 1JM4B 3GG3A 4TQNA 3NXBA 4QR3A 2L85A 4O74A 5DYUA 5ETDA 3AQAA 5F63A 2L84A 4QZSA 5CUCA 3MB3A 3P1FA 4PY6A 5LVRA 3MULA 5AD2A 4PCIA 5D3SA 5F61A 5C85A 5DBMA 5A5PA 4BW3A 4NR7A 3K2JA 2YQDA 5ENBA 4O71A 5IGNA 4TZ8A 5HCLA 4QR5A 1ZS5A 4IR5A 4DONA 5HRWA 5KU3A 4QYDA 4WHWA 5HRXA 4NQMA 5CQAA 4HBYA 4BW4A 5DYAA 4RVRA 2G4AA 2WP1A 5EPRA 4UYEA 5EWDA 1JSPB 4HXSA 5F25A 5IG6A 4N4HA 5E3DA 4QY4A 4MR3A 2DVRA 2FSAA 2F6NA 5EM3A 3QZVA 3Q2FA 5E7DA 2E3KA 4NUDA 4ZW1A 4YYIA 2F6JA 5FE9A 5CQTA 4WHUA 4E96A 5A85A 4QYLA 4HBWA 3IU6A 5KHMA 4TU6A 4PCEA 5D3TA 4IOOA 4HXKA 4ZQLA 5E74A 5HM0A 4XUAA 4O78A 5CQ6A 2RNWA 5IGMA 4Y03A 5FB0A 4CUQA 4ZC9A 2NXBA 5LVQA 4XY8A 5EV9A 4GPJA 5KTUA 4A9LA 5EVAA 2DVQA 5CS8A 3P1DA 5AMEA 4HXPA 2D82A 4Z6HA 4A9KA 4O77A 4UYHA 5F1HA 3JVMA 5CUDA 3S92A 5E0RA 2YEMA 5CQ7A 5HLSA 4YADA 4TYLA 4NR8A 3IU5A 5L99A 5FE2A 1X0JA 4YATA 4MR6A 4PTBA 2YDWA 5ENIA 4YBMA 5EICA 5DY7A 4OGJA 4QNSA 5E9MA 4YBTA 2R0YA 4LYIA 2YYNA 5ETBA 4O75A 5LUUA 3O37A 5DLZA 5ACYA 2E7OA 4NR9A 5C8GA 5FBXA 3ZYUA 5FE7A 5G4RA 3UVWA 4X2IA 5CQ8A 3UVXA 3U5NA 4HXLA 5CUBA 5D3NA 3QZTA 4QUUA 4IORA 4UYFB 5LKZA 4Q0OA 4QEUA 5BT4A 5I80A 5A7CA 2R0SA 4ALHA 4QSPA 4UIUA 5FE1A 5A5RA 4Z1SA 4LRGA 4LZ2A 3Q2EA 5D3LA 3LXJA 2KTBB 3UVYA 4IR6A 5LJ1A 4LZSA 4O70A 5FB1A 4NYXA 5EP7A 4QSXA 5I7XA 5FG6A 4YYMA 3O33A 5CUEA 3FKMX 5FH6A 4NUEA 5EISA 2WP2A 5EPSA 4MEPA 4A9EA 4NR6A 5EWVA 5EK9A 4N3WA 5L98A 4XUBA 5F60A 4A9FA 4PS5A 5CUGA 5I86A 5CZGA 5C4QA 2YW5A 3TLPA 5CQ3A 2E7NA 4A9IA 4CUPA 5F5ZA 4BHWA 5I40A 4YYJA 4LYSA 1N72A 4YY6A 4NR5A 4MR5A 4O7AA 4NS5A 4LR6A 5D3HA 4LC2A 1WUGA 5EWWA 4O7EA 4QSTA 3O36A 4C67A 3JVLA 5KO4A 2RNXA 4YAXA 5CPEA 3I3JA 3O35A 3ONIA 5EU1A 3U5KA 5II2A 4TZ2A 1F68A 4J3IA 3MXFA 5AD3A 1WUMA 4YC9A 5DKDA 5FE8A 4AKNA 4TTEA 5HFQA 5HFRA 5EWCA 5D26A 4YYKA 2MJVB 4QSRA 4BW2A 4O7BA 4YH4A 3P1CA 5H1UA 2OO1A 4QSSA 3SVHA 4UIZA 5CQ5A 4CUTA 5FFYA 5TB6A 5CP5A 5FFVA 4A9HA 4OGIA 4MEQA 5L8TA 3QZSA 5L96A 5HQ5A 2YELA 2OUOA 3O34A 5DKHA 4NYVA 3RCWA 3UV2A 5K29A 4J0SA 5I1QA 2DKWA 4QUTA 4QSWA 5CGPA 5LJ0A 2RO1A 5LKXA 5E9LA 2RI7A 5DKCA 5EPBA 4QEVA 5F1LA 4KV1A 5FG5A 5HJCA 4UITA 5LJ2A 5FE4A 5E9YA 4QB3A 4HXNA 4CLBA 4BW1A 5D25A 4TT6A 4MENA 5CY9A 4QSQA 1EQFA 3JVKA 4UYDA 4O72A 4UIYA 5FFWA 3MQMA 4HBXA 5LKUA 5EGUA 4A9NA 5FH8A 2I8NA 5II1A 5HQ6A 4YYDA 5IIDA 5IBNA 4FLPA 3P5OA 4NXJA 2LSPB 4O76A 3MUKA 4UYGA 5CQ4A 5F2PA 5JI8A 5LKTA 5CFWA 4UYFA 4UIWA 5KTWA 5A5QA 5JWMA 4CFLA 5F3AA 3JVJA 3UV5A 5EWHA 3SVGA 3P1EA 4TT2A 5CU8A 3U5JA 4N4IA 5L8UA 4Z6IA 4MR4A 5ENJA 5CRZA 3UW9A 5CRMA 4XYAA 4CUSA 2H60A 5IGLA 5D7XA 2OSSA 5FE3A 4Z1QA 4YY4A
chains in the Genus database with same CATH superfamily
3G0JA 5D3RA 4YYGA 4YYNA 4KCXA 4TS8A 5DFBA 3LQIA 5AMFA 5H1VA 5HELA 5G4SA 5H85A 2RNYA 4QC1A 5C87A 5HENA 5A81A 5DFCA 3SVFA 5ENFA 4A9OA 4N4FA 4ALGA 5DW1A 4NUCA 5FG4A 3DAIA 5HQ7A 2DWWA 5I88A 4CUUA 5DYXA 2DATA 5EA1A 4Z1QA 4YK0A 5I29A 2GRCA 5L97A 4F3IA 5I89A 4CURA 4AI6A 5E73A 4IR4A 3LJWA 5I83A 5J0DA 5D3JA 1ZKRA 4NR4A 5C7NA 4N4GA 3MB4A 2RS9B 2D9EA 5C89A 4MEOA 4QSVA 5IGKA 4UIXA 4LZRA 4NRBA 4YYHA 5FE6A 4OUFA 4NRCA 5EI4A 5TCMA 5D0CA 4A9MA 5H1TA 4A9JA 3HMHA 5HRVA 4QEWA 4YABA 4UIVA 5ENCA 3U5OA 4NYWA 4TT4A 4NRAA 4WIVA 4O7FA 4QR4A 4HBVA 5FE5A 4QBMA 2DVVA 4Q0NA 3UV4A 5D24A 4IOQA 4CL9A 5ENEA 4QC3A 2YEKA 2R10A 3D1BA 5FDZA 4NQNA 5ENGA 3AADA 5I7YA 3HMEA 4CFKA 3HMFA 5A5SA 5DLXA 3G0LA 3S91A 4KV4A 5BT3A 5FE0A 5A5NA 4LDFA 2EJNA 4YH3A 3U5LA 3U5PA 3LQHA 3LQJA 2DVSA 5CUAA 4HXRA 4HXOA 5A82A 2I7KA 4O7CA 5FH7A 5BT5A 5D3PA 4LYWA 4PKLA 5E9KA 4J0RA 4IR3A 2RFJA 5DFDA 4C66A 5KTXA 5DW2A 2L5EA 4Z93A 4TU4A 4XY9A 3U5MA 3UVDA 4J1PA 5CTLA 5A83A 3D7CA 4QSUA 5E3GA 5HEMA 5F36A 5A5OA 5F62A 5E9VA 4HXMA 4BJXA 2R0VA 5ENHA 5DX4A 4YBSA 1E6IA 5DYCA 5EQ1A 2N9GA 5E9IA 5COIA 3DWYA 1JM4B 3GG3A 4TQNA 3NXBA 4QR3A 2L85A 4O74A 5DYUA 5ETDA 3AQAA 5F63A 2L84A 4QZSA 5CUCA 3MB3A 3P1FA 4PY6A 5LVRA 3MULA 5AD2A 4PCIA 5D3SA 5F61A 5C85A 5DBMA 5A5PA 4BW3A 4NR7A 3K2JA 2YQDA 5ENBA 4O71A 5IGNA 4TZ8A 5HCLA 4QR5A 1ZS5A 4IR5A 4DONA 5HRWA 5KU3A 4QYDA 4WHWA 5HRXA 4NQMA 5CQAA 4HBYA 4BW4A 5DYAA 4RVRA 2G4AA 2WP1A 5EPRA 4UYEA 5EWDA 1JSPB 4HXSA 5F25A 5IG6A 4N4HA 5E3DA 4QY4A 4MR3A 2DVRA 2FSAA 3VKHA 2F6NA 5EM3A 3QZVA 3Q2FA 5E7DA 2E3KA 4NUDA 4ZW1A 4YYIA 2F6JA 5FE9A 5CQTA 4WHUA 4E96A 5A85A 4QYLA 4HBWA 3IU6A 5KHMA 4TU6A 4PCEA 5D3TA 4IOOA 4HXKA 4ZQLA 5E74A 5HM0A 4XUAA 4O78A 5CQ6A 2RNWA 5IGMA 4Y03A 5FB0A 4CUQA 4ZC9A 2NXBA 3D1DA 4AKGA 5LVQA 4XY8A 5EV9A 4GPJA 5KTUA 4A9LA 5EVAA 2DVQA 5CS8A 3P1DA 5AMEA 4HXPA 2D82A 4Z6HA 4A9KA 4O77A 4UYHA 5F1HA 3JVMA 5CUDA 3S92A 5E0RA 2YEMA 5CQ7A 3VKGA 5HLSA 4YADA 4TYLA 4NR8A 3IU5A 5L99A 5FE2A 1X0JA 4YATA 4MR6A 4PTBA 2YDWA 5ENIA 4YBMA 5EICA 5DY7A 4OGJA 4QNSA 5E9MA 4YBTA 2R0YA 4LYIA 2YYNA 5ETBA 4O75A 5LUUA 3O37A 5DLZA 5ACYA 2E7OA 4NR9A 5C8GA 5FBXA 3ZYUA 5FE7A 5G4RA 3UVWA 4X2IA 5CQ8A 3UVXA 3U5NA 4HXLA 5CUBA 5D3NA 3QZTA 4QUUA 4IORA 4AKHA 4UYFB 5LKZA 4Q0OA 4QEUA 5BT4A 5I80A 5A7CA 2R0SA 4ALHA 4QSPA 4UIUA 5FE1A 5A5RA 4Z1SA 4LRGA 4LZ2A 3Q2EA 5D3LA 3LXJA 2KTBB 3UVYA 4IR6A 5LJ1A 4LZSA 4O70A 5FB1A 4NYXA 5EP7A 4QSXA 5I7XA 5FG6A 4YYMA 3O33A 5CUEA 3FKMX 5FH6A 4NUEA 5EISA 2WP2A 5EPSA 4MEPA 4A9EA 4NR6A 5EWVA 5EK9A 4N3WA 5L98A 4XUBA 5F60A 4A9FA 4PS5A 5CUGA 5I86A 5CZGA 5C4QA 2YW5A 3TLPA 5CQ3A 2E7NA 4A9IA 4CUPA 5F5ZA 4BHWA 5I40A 4YYJA 4LYSA 1N72A 4YY6A 4NR5A 4MR5A 4O7AA 4NS5A 4LR6A 5D3HA 4LC2A 1WUGA 5EWWA 4O7EA 4QSTA 3O36A 4C67A 3JVLA 5KO4A 2RNXA 4YAXA 5CPEA 3I3JA 3O35A 3ONIA 5EU1A 3U5KA 5II2A 4TZ2A 1F68A 4J3IA 3MXFA 5AD3A 1WUMA 4YC9A 5DKDA 5FE8A 4AKNA 4TTEA 5HFQA 5HFRA 5EWCA 5D26A 4YYKA 2MJVB 4QSRA 4BW2A 4O7BA 4YH4A 3P1CA 5H1UA 2OO1A 4QSSA 3SVHA 4UIZA 5CQ5A 4CUTA 5FFYA 5TB6A 5CP5A 5FFVA 4A9HA 4OGIA 4MEQA 5L8TA 3QZSA 5L96A 5HQ5A 2YELA 2OUOA 3O34A 5DKHA 4NYVA 3RCWA 3UV2A 5K29A 4J0SA 5I1QA 2DKWA 4QUTA 4QSWA 5CGPA 5LJ0A 2RO1A 5LKXA 5E9LA 2RI7A 5DKCA 5EPBA 4AKIA 4QEVA 5F1LA 4KV1A 5FG5A 5HJCA 4UITA 5LJ2A 5FE4A 5E9YA 4QB3A 4HXNA 4CLBA 4BW1A 5D25A 4TT6A 4MENA 5CY9A 4QSQA 1EQFA 3JVKA 4UYDA 4O72A 4UIYA 5FFWA 3MQMA 4HBXA 5LKUA 5EGUA 4A9NA 5FH8A 2I8NA 5II1A 5HQ6A 4YYDA 5IIDA 5IBNA 4FLPA 3P5OA 4NXJA 2LSPB 4O76A 3MUKA 4UYGA 5CQ4A 5F2PA 5JI8A 5LKTA 5CFWA 4UYFA 4UIWA 5KTWA 5A5QA 5JWMA 4CFLA 5F3AA 1PUOA 3JVJA 3UV5A 5EWHA 3SVGA 3P1EA 4TT2A 5CU8A 3U5JA 4N4IA 5L8UA 4Z6IA 4MR4A 5ENJA 5CRZA 3UW9A 5CRMA 4XYAA 4CUSA 2H60A 5IGLA 5D7XA 2OSSA 5FE3A 3ERRA 4YY4A
chains in the Genus database with same CATH topology
3G0JA 5D3RA 4YYGA 4YYNA 4KCXA 4TS8A 5DFBA 3LQIA 5AMFA 5H1VA 5HELA 5G4SA 5H85A 2RNYA 4QC1A 5C87A 5HENA 5A81A 5DFCA 3SVFA 5ENFA 4A9OA 4N4FA 4ALGA 5DW1A 4NUCA 5FG4A 3DAIA 5HQ7A 2DWWA 5I88A 4CUUA 5DYXA 2DATA 5EA1A 4YK0A 5I29A 2GRCA 5L97A 4F3IA 5I89A 4CURA 5E73A 4IR4A 3LJWA 5I83A 5J0DA 5D3JA 4NR4A 5C7NA 4N4GA 3MB4A 2RS9B 2D9EA 5C89A 4MEOA 4QSVA 5IGKA 4UIXA 4LZRA 4NRBA 4YYHA 5FE6A 4OUFA 4NRCA 5EI4A 5TCMA 5D0CA 4A9MA 5H1TA 4A9JA 3HMHA 5HRVA 4QEWA 4YABA 4UIVA 5ENCA 3U5OA 4NYWA 4TT4A 4NRAA 4WIVA 4O7FA 4QR4A 4HBVA 5FE5A 4QBMA 2DVVA 4Q0NA 3UV4A 5D24A 4IOQA 4CL9A 5ENEA 4QC3A 2YEKA 2R10A 5FDZA 4NQNA 5ENGA 3AADA 5I7YA 3HMEA 4CFKA 3HMFA 5A5SA 5DLXA 3G0LA 3S91A 4KV4A 5BT3A 5FE0A 5A5NA 4LDFA 4YH3A 3U5LA 3U5PA 3LQHA 3LQJA 2DVSA 5CUAA 4HXRA 4HXOA 5A82A 2I7KA 4O7CA 5FH7A 5BT5A 5D3PA 4LYWA 4PKLA 5E9KA 4J0RA 4IR3A 2RFJA 5DFDA 4C66A 5KTXA 5DW2A 2L5EA 4Z93A 4TU4A 4XY9A 3U5MA 3UVDA 4J1PA 5CTLA 5A83A 3D7CA 4QSUA 5E3GA 5HEMA 5F36A 5A5OA 5F62A 5E9VA 4HXMA 4BJXA 2R0VA 5ENHA 5DX4A 4YBSA 1E6IA 5DYCA 5EQ1A 2N9GA 5E9IA 5COIA 3DWYA 1JM4B 3GG3A 4TQNA 3NXBA 4QR3A 2L85A 4O74A 5DYUA 5ETDA 3AQAA 5F63A 2L84A 4QZSA 5CUCA 3MB3A 3P1FA 4PY6A 5LVRA 3MULA 5AD2A 4PCIA 5D3SA 5F61A 5C85A 5DBMA 5A5PA 4BW3A 4NR7A 3K2JA 2YQDA 5ENBA 4O71A 5IGNA 4TZ8A 5HCLA 4QR5A 1ZS5A 4IR5A 4DONA 5HRWA 5KU3A 4QYDA 4WHWA 5HRXA 4NQMA 5CQAA 4HBYA 4BW4A 5DYAA 4RVRA 2G4AA 2WP1A 5EPRA 4UYEA 5EWDA 1JSPB 4HXSA 5F25A 5IG6A 4N4HA 5E3DA 4QY4A 4MR3A 2DVRA 2FSAA 2F6NA 5EM3A 3QZVA 3Q2FA 5E7DA 2E3KA 4NUDA 4ZW1A 4YYIA 2F6JA 5FE9A 5CQTA 4WHUA 4E96A 5A85A 4QYLA 4HBWA 3IU6A 5KHMA 4TU6A 4PCEA 5D3TA 4IOOA 4HXKA 4ZQLA 5E74A 5HM0A 4XUAA 4O78A 5CQ6A 2RNWA 5IGMA 4Y03A 5FB0A 4CUQA 4ZC9A 2NXBA 5LVQA 4XY8A 5EV9A 4GPJA 5KTUA 4A9LA 5EVAA 2DVQA 5CS8A 3P1DA 5AMEA 4HXPA 2D82A 4Z6HA 4A9KA 4O77A 4UYHA 5F1HA 3JVMA 5CUDA 3S92A 5E0RA 2YEMA 5CQ7A 5HLSA 4YADA 4TYLA 4NR8A 3IU5A 5L99A 5FE2A 1X0JA 4YATA 4MR6A 4PTBA 2YDWA 5ENIA 4YBMA 5EICA 5DY7A 4OGJA 4QNSA 5E9MA 4YBTA 2R0YA 4LYIA 2YYNA 5ETBA 4O75A 5LUUA 3O37A 5DLZA 5ACYA 2E7OA 4NR9A 5C8GA 5FBXA 3ZYUA 5FE7A 5G4RA 3UVWA 4X2IA 5CQ8A 3UVXA 3U5NA 4HXLA 5CUBA 5D3NA 3QZTA 4QUUA 4IORA 4UYFB 5LKZA 4Q0OA 4QEUA 5BT4A 5I80A 5A7CA 2R0SA 4ALHA 4QSPA 4UIUA 5FE1A 5A5RA 4Z1SA 4LRGA 4LZ2A 3Q2EA 5D3LA 3LXJA 2KTBB 3UVYA 4IR6A 5LJ1A 4LZSA 4O70A 5FB1A 4NYXA 5EP7A 4QSXA 5I7XA 5FG6A 4YYMA 3O33A 5CUEA 3FKMX 5FH6A 4NUEA 5EISA 2WP2A 5EPSA 4MEPA 4A9EA 4NR6A 5EWVA 5EK9A 4N3WA 5L98A 4XUBA 5F60A 4A9FA 4PS5A 5CUGA 5I86A 5CZGA 5C4QA 2YW5A 3TLPA 5CQ3A 2E7NA 4A9IA 4CUPA 5F5ZA 4BHWA 5I40A 4YYJA 4LYSA 1N72A 4YY6A 4NR5A 4MR5A 4O7AA 4NS5A 4LR6A 5D3HA 4LC2A 1WUGA 5EWWA 4O7EA 4QSTA 3O36A 4C67A 3JVLA 5KO4A 2RNXA 4YAXA 5CPEA 3I3JA 3O35A 3ONIA 5EU1A 3U5KA 5II2A 4TZ2A 1F68A 4J3IA 3MXFA 5AD3A 1WUMA 4YC9A 5DKDA 5FE8A 4AKNA 4TTEA 5HFQA 5HFRA 5EWCA 5D26A 4YYKA 2MJVB 4QSRA 4BW2A 4O7BA 4YH4A 3P1CA 5H1UA 2OO1A 4QSSA 3SVHA 4UIZA 5CQ5A 4CUTA 5FFYA 5TB6A 5CP5A 5FFVA 4A9HA 4OGIA 4MEQA 5L8TA 3QZSA 5L96A 5HQ5A 2YELA 2OUOA 3O34A 5DKHA 4NYVA 3RCWA 3UV2A 5K29A 4J0SA 5I1QA 2DKWA 4QUTA 4QSWA 5CGPA 5LJ0A 2RO1A 5LKXA 5E9LA 2RI7A 5DKCA 5EPBA 4QEVA 5F1LA 4KV1A 5FG5A 5HJCA 4UITA 5LJ2A 5FE4A 5E9YA 4QB3A 4HXNA 4CLBA 4BW1A 5D25A 4TT6A 4MENA 5CY9A 4QSQA 1EQFA 3JVKA 4UYDA 4O72A 4UIYA 5FFWA 3MQMA 4HBXA 5LKUA 5EGUA 4A9NA 5FH8A 2I8NA 5II1A 5HQ6A 4YYDA 5IIDA 5IBNA 4FLPA 3P5OA 4NXJA 2LSPB 4O76A 3MUKA 4UYGA 5CQ4A 5F2PA 5JI8A 5LKTA 5CFWA 4UYFA 4UIWA 5KTWA 5A5QA 5JWMA 4CFLA 5F3AA 3JVJA 3UV5A 5EWHA 3SVGA 3P1EA 4TT2A 5CU8A 3U5JA 4N4IA 5L8UA 4Z6IA 4MR4A 5ENJA 5CRZA 3UW9A 5CRMA 4XYAA 4CUSA 2H60A 5IGLA 5D7XA 2OSSA 5FE3A 4Z1QA 4YY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G0J A;  5D3R A;  4YYG A;  4YYN A;  4KCX A;  4TS8 A;  5DFB A;  3LQI A;  5AMF A;  5H1V A;  5HEL A;  5G4S A;  5H85 A;  2RNY A;  4QC1 A;  5C87 A;  5HEN A;  5A81 A;  5DFC A;  3SVF A;  5ENF A;  4A9O A;  4N4F A;  4ALG A;  5DW1 A;  4NUC A;  5FG4 A;  3DAI A;  5HQ7 A;  2DWW A;  5I88 A;  4CUU A;  5DYX A;  2DAT A;  5EA1 A;  4YK0 A;  5I29 A;  2GRC A;  5L97 A;  4F3I A;  5I89 A;  4CUR A;  5E73 A;  4IR4 A;  3LJW A;  5I83 A;  5J0D A;  5D3J A;  4NR4 A;  5C7N A;  4N4G A;  3MB4 A;  2RS9 B;  2D9E A;  5C89 A;  4MEO A;  4QSV A;  5IGK A;  4UIX A;  4LZR A;  4NRB A;  4YYH A;  5FE6 A;  4OUF A;  4NRC A;  5EI4 A;  5TCM A;  5D0C A;  4A9M A;  5H1T A;  4A9J A;  3HMH A;  5HRV A;  4QEW A;  4YAB A;  4UIV A;  5ENC A;  3U5O A;  4NYW A;  4TT4 A;  4NRA A;  4WIV A;  4O7F A;  4QR4 A;  4HBV A;  5FE5 A;  4QBM A;  2DVV A;  4Q0N A;  3UV4 A;  5D24 A;  4IOQ A;  4CL9 A;  5ENE A;  4QC3 A;  2YEK A;  2R10 A;  5FDZ A;  4NQN A;  5ENG A;  3AAD A;  5I7Y A;  3HME A;  4CFK A;  3HMF A;  5A5S A;  5DLX A;  3G0L A;  3S91 A;  4KV4 A;  5BT3 A;  5FE0 A;  5A5N A;  4LDF A;  4YH3 A;  3U5L A;  3U5P A;  3LQH A;  3LQJ A;  2DVS A;  5CUA A;  4HXR A;  4HXO A;  5A82 A;  2I7K A;  4O7C A;  5FH7 A;  5BT5 A;  5D3P A;  4LYW A;  4PKL A;  5E9K A;  4J0R A;  4IR3 A;  2RFJ A;  5DFD A;  4C66 A;  5KTX A;  5DW2 A;  2L5E A;  4Z93 A;  4TU4 A;  4XY9 A;  3U5M A;  3UVD A;  4J1P A;  5CTL A;  5A83 A;  3D7C A;  4QSU A;  5E3G A;  5HEM A;  5F36 A;  5A5O A;  5F62 A;  5E9V A;  4HXM A;  4BJX A;  2R0V A;  5ENH A;  5DX4 A;  4YBS A;  1E6I A;  5DYC A;  5EQ1 A;  2N9G A;  5E9I A;  5COI A;  3DWY A;  1JM4 B;  3GG3 A;  4TQN A;  3NXB A;  4QR3 A;  2L85 A;  4O74 A;  5DYU A;  5ETD A;  3AQA A;  5F63 A;  2L84 A;  4QZS A;  5CUC A;  3MB3 A;  3P1F A;  4PY6 A;  5LVR A;  3MUL A;  5AD2 A;  4PCI A;  5D3S A;  5F61 A;  5C85 A;  5DBM A;  5A5P A;  4BW3 A;  4NR7 A;  3K2J A;  2YQD A;  5ENB A;  4O71 A;  5IGN A;  4TZ8 A;  5HCL A;  4QR5 A;  1ZS5 A;  4IR5 A;  4DON A;  5HRW A;  5KU3 A;  4QYD A;  4WHW A;  5HRX A;  4NQM A;  5CQA A;  4HBY A;  4BW4 A;  5DYA A;  4RVR A;  2G4A A;  2WP1 A;  5EPR A;  4UYE A;  5EWD A;  1JSP B;  4HXS A;  5F25 A;  5IG6 A;  4N4H A;  5E3D A;  4QY4 A;  4MR3 A;  2DVR A;  2FSA A;  2F6N A;  5EM3 A;  3QZV A;  3Q2F A;  5E7D A;  2E3K A;  4NUD A;  4ZW1 A;  4YYI A;  2F6J A;  5FE9 A;  5CQT A;  4WHU A;  4E96 A;  5A85 A;  4QYL A;  4HBW A;  3IU6 A;  5KHM A;  4TU6 A;  4PCE A;  5D3T A;  4IOO A;  4HXK A;  4ZQL A;  5E74 A;  5HM0 A;  4XUA A;  4O78 A;  5CQ6 A;  2RNW A;  5IGM A;  4Y03 A;  5FB0 A;  4CUQ A;  4ZC9 A;  2NXB A;  5LVQ A;  4XY8 A;  5EV9 A;  4GPJ A;  5KTU A;  4A9L A;  5EVA A;  2DVQ A;  5CS8 A;  3P1D A;  5AME A;  4HXP A;  2D82 A;  4Z6H A;  4A9K A;  4O77 A;  4UYH A;  5F1H A;  3JVM A;  5CUD A;  3S92 A;  5E0R A;  2YEM A;  5CQ7 A;  5HLS A;  4YAD A;  4TYL A;  4NR8 A;  3IU5 A;  5L99 A;  5FE2 A;  1X0J A;  4YAT A;  4MR6 A;  4PTB A;  2YDW A;  5ENI A;  4YBM A;  5EIC A;  5DY7 A;  4OGJ A;  4QNS A;  5E9M A;  4YBT A;  2R0Y A;  4LYI A;  2YYN A;  5ETB A;  4O75 A;  5LUU A;  3O37 A;  5DLZ A;  5ACY A;  2E7O A;  4NR9 A;  5C8G A;  5FBX A;  3ZYU A;  5FE7 A;  5G4R A;  3UVW A;  4X2I A;  5CQ8 A;  3UVX A;  3U5N A;  4HXL A;  5CUB A;  5D3N A;  3QZT A;  4QUU A;  4IOR A;  4UYF B;  5LKZ A;  4Q0O A;  4QEU A;  5BT4 A;  5I80 A;  5A7C A;  2R0S A;  4ALH A;  4QSP A;  4UIU A;  5FE1 A;  5A5R A;  4Z1S A;  4LRG A;  4LZ2 A;  3Q2E A;  5D3L A;  3LXJ A;  2KTB B;  3UVY A;  4IR6 A;  5LJ1 A;  4LZS A;  4O70 A;  5FB1 A;  4NYX A;  5EP7 A;  4QSX A;  5I7X A;  5FG6 A;  4YYM A;  3O33 A;  5CUE A;  3FKM X;  5FH6 A;  4NUE A;  5EIS A;  2WP2 A;  5EPS A;  4MEP A;  4A9E A;  4NR6 A;  5EWV A;  5EK9 A;  4N3W A;  5L98 A;  4XUB A;  5F60 A;  4A9F A;  4PS5 A;  5CUG A;  5I86 A;  5CZG A;  5C4Q A;  2YW5 A;  3TLP A;  5CQ3 A;  2E7N A;  4A9I A;  4CUP A;  5F5Z A;  4BHW A;  5I40 A;  4YYJ A;  4LYS A;  1N72 A;  4YY6 A;  4NR5 A;  4MR5 A;  4O7A A;  4NS5 A;  4LR6 A;  5D3H A;  4LC2 A;  1WUG A;  5EWW A;  4O7E A;  4QST A;  3O36 A;  4C67 A;  3JVL A;  5KO4 A;  2RNX A;  4YAX A;  5CPE A;  3I3J A;  3O35 A;  3ONI A;  5EU1 A;  3U5K A;  5II2 A;  4TZ2 A;  1F68 A;  4J3I A;  3MXF A;  5AD3 A;  1WUM A;  4YC9 A;  5DKD A;  5FE8 A;  4AKN A;  4TTE A;  5HFQ A;  5HFR A;  5EWC A;  5D26 A;  4YYK A;  2MJV B;  4QSR A;  4BW2 A;  4O7B A;  4YH4 A;  3P1C A;  5H1U A;  2OO1 A;  4QSS A;  3SVH A;  4UIZ A;  5CQ5 A;  4CUT A;  5FFY A;  5TB6 A;  5CP5 A;  5FFV A;  4A9H A;  4OGI A;  4MEQ A;  5L8T A;  3QZS A;  5L96 A;  5HQ5 A;  2YEL A;  2OUO A;  3O34 A;  5DKH A;  4NYV A;  3RCW A;  3UV2 A;  5K29 A;  4J0S A;  5I1Q A;  2DKW A;  4QUT A;  4QSW A;  5CGP A;  5LJ0 A;  2RO1 A;  5LKX A;  5E9L A;  2RI7 A;  5DKC A;  5EPB A;  4QEV A;  5F1L A;  4KV1 A;  5FG5 A;  5HJC A;  4UIT A;  5LJ2 A;  5FE4 A;  5E9Y A;  4QB3 A;  4HXN A;  4CLB A;  4BW1 A;  5D25 A;  4TT6 A;  4MEN A;  5CY9 A;  4QSQ A;  1EQF A;  3JVK A;  4UYD A;  4O72 A;  4UIY A;  5FFW A;  3MQM A;  4HBX A;  5LKU A;  5EGU A;  4A9N A;  5FH8 A;  2I8N A;  5II1 A;  5HQ6 A;  4YYD A;  5IID A;  5IBN A;  4FLP A;  3P5O A;  4NXJ A;  2LSP B;  4O76 A;  3MUK A;  4UYG A;  5CQ4 A;  5F2P A;  5JI8 A;  5LKT A;  5CFW A;  4UYF A;  4UIW A;  5KTW A;  5A5Q A;  5JWM A;  4CFL A;  5F3A A;  3JVJ A;  3UV5 A;  5EWH A;  3SVG A;  3P1E A;  4TT2 A;  5CU8 A;  3U5J A;  4N4I A;  5L8U A;  4Z6I A;  4MR4 A;  5ENJ A;  5CRZ A;  3UW9 A;  5CRM A;  4XYA A;  4CUS A;  2H60 A;  5IGL A;  5D7X A;  2OSS A;  5FE3 A;  4Z1Q A;  4YY4 A; 
#chains in the Genus database with same CATH topology
 3G0J A;  5D3R A;  4YYG A;  4YYN A;  4KCX A;  4TS8 A;  5DFB A;  3LQI A;  5AMF A;  5H1V A;  5HEL A;  5G4S A;  5H85 A;  2RNY A;  4QC1 A;  5C87 A;  5HEN A;  5A81 A;  5DFC A;  3SVF A;  5ENF A;  4A9O A;  4N4F A;  4ALG A;  5DW1 A;  4NUC A;  5FG4 A;  3DAI A;  5HQ7 A;  2DWW A;  5I88 A;  4CUU A;  5DYX A;  2DAT A;  5EA1 A;  4Z1Q A;  4YK0 A;  5I29 A;  2GRC A;  5L97 A;  4F3I A;  5I89 A;  4CUR A;  4AI6 A;  5E73 A;  4IR4 A;  3LJW A;  5I83 A;  5J0D A;  5D3J A;  1ZKR A;  4NR4 A;  5C7N A;  4N4G A;  3MB4 A;  2RS9 B;  2D9E A;  5C89 A;  4MEO A;  4QSV A;  5IGK A;  4UIX A;  4LZR A;  4NRB A;  4YYH A;  5FE6 A;  4OUF A;  4NRC A;  5EI4 A;  5TCM A;  5D0C A;  4A9M A;  5H1T A;  4A9J A;  3HMH A;  5HRV A;  4QEW A;  4YAB A;  4UIV A;  5ENC A;  3U5O A;  4NYW A;  4TT4 A;  4NRA A;  4WIV A;  4O7F A;  4QR4 A;  4HBV A;  5FE5 A;  4QBM A;  2DVV A;  4Q0N A;  3UV4 A;  5D24 A;  4IOQ A;  4CL9 A;  5ENE A;  4QC3 A;  2YEK A;  2R10 A;  3D1B A;  5FDZ A;  4NQN A;  5ENG A;  3AAD A;  5I7Y A;  3HME A;  4CFK A;  3HMF A;  5A5S A;  5DLX A;  3G0L A;  3S91 A;  4KV4 A;  5BT3 A;  5FE0 A;  5A5N A;  4LDF A;  2EJN A;  4YH3 A;  3U5L A;  3U5P A;  3LQH A;  3LQJ A;  2DVS A;  5CUA A;  4HXR A;  4HXO A;  5A82 A;  2I7K A;  4O7C A;  5FH7 A;  5BT5 A;  5D3P A;  4LYW A;  4PKL A;  5E9K A;  4J0R A;  4IR3 A;  2RFJ A;  5DFD A;  4C66 A;  5KTX A;  5DW2 A;  2L5E A;  4Z93 A;  4TU4 A;  4XY9 A;  3U5M A;  3UVD A;  4J1P A;  5CTL A;  5A83 A;  3D7C A;  4QSU A;  5E3G A;  5HEM A;  5F36 A;  5A5O A;  5F62 A;  5E9V A;  4HXM A;  4BJX A;  2R0V A;  5ENH A;  5DX4 A;  4YBS A;  1E6I A;  5DYC A;  5EQ1 A;  2N9G A;  5E9I A;  5COI A;  3DWY A;  1JM4 B;  3GG3 A;  4TQN A;  3NXB A;  4QR3 A;  2L85 A;  4O74 A;  5DYU A;  5ETD A;  3AQA A;  5F63 A;  2L84 A;  4QZS A;  5CUC A;  3MB3 A;  3P1F A;  4PY6 A;  5LVR A;  3MUL A;  5AD2 A;  4PCI A;  5D3S A;  5F61 A;  5C85 A;  5DBM A;  5A5P A;  4BW3 A;  4NR7 A;  3K2J A;  2YQD A;  5ENB A;  4O71 A;  5IGN A;  4TZ8 A;  5HCL A;  4QR5 A;  1ZS5 A;  4IR5 A;  4DON A;  5HRW A;  5KU3 A;  4QYD A;  4WHW A;  5HRX A;  4NQM A;  5CQA A;  4HBY A;  4BW4 A;  5DYA A;  4RVR A;  2G4A A;  2WP1 A;  5EPR A;  4UYE A;  5EWD A;  1JSP B;  4HXS A;  5F25 A;  5IG6 A;  4N4H A;  5E3D A;  4QY4 A;  4MR3 A;  2DVR A;  2FSA A;  3VKH A;  2F6N A;  5EM3 A;  3QZV A;  3Q2F A;  5E7D A;  2E3K A;  4NUD A;  4ZW1 A;  4YYI A;  2F6J A;  5FE9 A;  5CQT A;  4WHU A;  4E96 A;  5A85 A;  4QYL A;  4HBW A;  3IU6 A;  5KHM A;  4TU6 A;  4PCE A;  5D3T A;  4IOO A;  4HXK A;  4ZQL A;  5E74 A;  5HM0 A;  4XUA A;  4O78 A;  5CQ6 A;  2RNW A;  5IGM A;  4Y03 A;  5FB0 A;  4CUQ A;  4ZC9 A;  2NXB A;  3D1D A;  4AKG A;  5LVQ A;  4XY8 A;  5EV9 A;  4GPJ A;  5KTU A;  4A9L A;  5EVA A;  2DVQ A;  5CS8 A;  3P1D A;  5AME A;  4HXP A;  2D82 A;  4Z6H A;  4A9K A;  4O77 A;  4UYH A;  5F1H A;  3JVM A;  5CUD A;  3S92 A;  5E0R A;  2YEM A;  5CQ7 A;  3VKG A;  5HLS A;  4YAD A;  4TYL A;  4NR8 A;  3IU5 A;  5L99 A;  5FE2 A;  1X0J A;  4YAT A;  4MR6 A;  4PTB A;  2YDW A;  5ENI A;  4YBM A;  5EIC A;  5DY7 A;  4OGJ A;  4QNS A;  5E9M A;  4YBT A;  2R0Y A;  4LYI A;  2YYN A;  5ETB A;  4O75 A;  5LUU A;  3O37 A;  5DLZ A;  5ACY A;  2E7O A;  4NR9 A;  5C8G A;  5FBX A;  3ZYU A;  5FE7 A;  5G4R A;  3UVW A;  4X2I A;  5CQ8 A;  3UVX A;  3U5N A;  4HXL A;  5CUB A;  5D3N A;  3QZT A;  4QUU A;  4IOR A;  4AKH A;  4UYF B;  5LKZ A;  4Q0O A;  4QEU A;  5BT4 A;  5I80 A;  5A7C A;  2R0S A;  4ALH A;  4QSP A;  4UIU A;  5FE1 A;  5A5R A;  4Z1S A;  4LRG A;  4LZ2 A;  3Q2E A;  5D3L A;  3LXJ A;  2KTB B;  3UVY A;  4IR6 A;  5LJ1 A;  4LZS A;  4O70 A;  5FB1 A;  4NYX A;  5EP7 A;  4QSX A;  5I7X A;  5FG6 A;  4YYM A;  3O33 A;  5CUE A;  3FKM X;  5FH6 A;  4NUE A;  5EIS A;  2WP2 A;  5EPS A;  4MEP A;  4A9E A;  4NR6 A;  5EWV A;  5EK9 A;  4N3W A;  5L98 A;  4XUB A;  5F60 A;  4A9F A;  4PS5 A;  5CUG A;  5I86 A;  5CZG A;  5C4Q A;  2YW5 A;  3TLP A;  5CQ3 A;  2E7N A;  4A9I A;  4CUP A;  5F5Z A;  4BHW A;  5I40 A;  4YYJ A;  4LYS A;  1N72 A;  4YY6 A;  4NR5 A;  4MR5 A;  4O7A A;  4NS5 A;  4LR6 A;  5D3H A;  4LC2 A;  1WUG A;  5EWW A;  4O7E A;  4QST A;  3O36 A;  4C67 A;  3JVL A;  5KO4 A;  2RNX A;  4YAX A;  5CPE A;  3I3J A;  3O35 A;  3ONI A;  5EU1 A;  3U5K A;  5II2 A;  4TZ2 A;  1F68 A;  4J3I A;  3MXF A;  5AD3 A;  1WUM A;  4YC9 A;  5DKD A;  5FE8 A;  4AKN A;  4TTE A;  5HFQ A;  5HFR A;  5EWC A;  5D26 A;  4YYK A;  2MJV B;  4QSR A;  4BW2 A;  4O7B A;  4YH4 A;  3P1C A;  5H1U A;  2OO1 A;  4QSS A;  3SVH A;  4UIZ A;  5CQ5 A;  4CUT A;  5FFY A;  5TB6 A;  5CP5 A;  5FFV A;  4A9H A;  4OGI A;  4MEQ A;  5L8T A;  3QZS A;  5L96 A;  5HQ5 A;  2YEL A;  2OUO A;  3O34 A;  5DKH A;  4NYV A;  3RCW A;  3UV2 A;  5K29 A;  4J0S A;  5I1Q A;  2DKW A;  4QUT A;  4QSW A;  5CGP A;  5LJ0 A;  2RO1 A;  5LKX A;  5E9L A;  2RI7 A;  5DKC A;  5EPB A;  4AKI A;  4QEV A;  5F1L A;  4KV1 A;  5FG5 A;  5HJC A;  4UIT A;  5LJ2 A;  5FE4 A;  5E9Y A;  4QB3 A;  4HXN A;  4CLB A;  4BW1 A;  5D25 A;  4TT6 A;  4MEN A;  5CY9 A;  4QSQ A;  1EQF A;  3JVK A;  4UYD A;  4O72 A;  4UIY A;  5FFW A;  3MQM A;  4HBX A;  5LKU A;  5EGU A;  4A9N A;  5FH8 A;  2I8N A;  5II1 A;  5HQ6 A;  4YYD A;  5IID A;  5IBN A;  4FLP A;  3P5O A;  4NXJ A;  2LSP B;  4O76 A;  3MUK A;  4UYG A;  5CQ4 A;  5F2P A;  5JI8 A;  5LKT A;  5CFW A;  4UYF A;  4UIW A;  5KTW A;  5A5Q A;  5JWM A;  4CFL A;  5F3A A;  1PUO A;  3JVJ A;  3UV5 A;  5EWH A;  3SVG A;  3P1E A;  4TT2 A;  5CU8 A;  3U5J A;  4N4I A;  5L8U A;  4Z6I A;  4MR4 A;  5ENJ A;  5CRZ A;  3UW9 A;  5CRM A;  4XYA A;  4CUS A;  2H60 A;  5IGL A;  5D7X A;  2OSS A;  5FE3 A;  3ERR A;  4YY4 A; 
#chains in the Genus database with same CATH homology
 3G0J A;  5D3R A;  4YYG A;  4YYN A;  4KCX A;  4TS8 A;  5DFB A;  3LQI A;  5AMF A;  5H1V A;  5HEL A;  5G4S A;  5H85 A;  2RNY A;  4QC1 A;  5C87 A;  5HEN A;  5A81 A;  5DFC A;  3SVF A;  5ENF A;  4A9O A;  4N4F A;  4ALG A;  5DW1 A;  4NUC A;  5FG4 A;  3DAI A;  5HQ7 A;  2DWW A;  5I88 A;  4CUU A;  5DYX A;  2DAT A;  5EA1 A;  4YK0 A;  5I29 A;  2GRC A;  5L97 A;  4F3I A;  5I89 A;  4CUR A;  5E73 A;  4IR4 A;  3LJW A;  5I83 A;  5J0D A;  5D3J A;  4NR4 A;  5C7N A;  4N4G A;  3MB4 A;  2RS9 B;  2D9E A;  5C89 A;  4MEO A;  4QSV A;  5IGK A;  4UIX A;  4LZR A;  4NRB A;  4YYH A;  5FE6 A;  4OUF A;  4NRC A;  5EI4 A;  5TCM A;  5D0C A;  4A9M A;  5H1T A;  4A9J A;  3HMH A;  5HRV A;  4QEW A;  4YAB A;  4UIV A;  5ENC A;  3U5O A;  4NYW A;  4TT4 A;  4NRA A;  4WIV A;  4O7F A;  4QR4 A;  4HBV A;  5FE5 A;  4QBM A;  2DVV A;  4Q0N A;  3UV4 A;  5D24 A;  4IOQ A;  4CL9 A;  5ENE A;  4QC3 A;  2YEK A;  2R10 A;  5FDZ A;  4NQN A;  5ENG A;  3AAD A;  5I7Y A;  3HME A;  4CFK A;  3HMF A;  5A5S A;  5DLX A;  3G0L A;  3S91 A;  4KV4 A;  5BT3 A;  5FE0 A;  5A5N A;  4LDF A;  4YH3 A;  3U5L A;  3U5P A;  3LQH A;  3LQJ A;  2DVS A;  5CUA A;  4HXR A;  4HXO A;  5A82 A;  2I7K A;  4O7C A;  5FH7 A;  5BT5 A;  5D3P A;  4LYW A;  4PKL A;  5E9K A;  4J0R A;  4IR3 A;  2RFJ A;  5DFD A;  4C66 A;  5KTX A;  5DW2 A;  2L5E A;  4Z93 A;  4TU4 A;  4XY9 A;  3U5M A;  3UVD A;  4J1P A;  5CTL A;  5A83 A;  3D7C A;  4QSU A;  5E3G A;  5HEM A;  5F36 A;  5A5O A;  5F62 A;  5E9V A;  4HXM A;  4BJX A;  2R0V A;  5ENH A;  5DX4 A;  4YBS A;  1E6I A;  5DYC A;  5EQ1 A;  2N9G A;  5E9I A;  5COI A;  3DWY A;  1JM4 B;  3GG3 A;  4TQN A;  3NXB A;  4QR3 A;  2L85 A;  4O74 A;  5DYU A;  5ETD A;  3AQA A;  5F63 A;  2L84 A;  4QZS A;  5CUC A;  3MB3 A;  3P1F A;  4PY6 A;  5LVR A;  3MUL A;  5AD2 A;  4PCI A;  5D3S A;  5F61 A;  5C85 A;  5DBM A;  5A5P A;  4BW3 A;  4NR7 A;  3K2J A;  2YQD A;  5ENB A;  4O71 A;  5IGN A;  4TZ8 A;  5HCL A;  4QR5 A;  1ZS5 A;  4IR5 A;  4DON A;  5HRW A;  5KU3 A;  4QYD A;  4WHW A;  5HRX A;  4NQM A;  5CQA A;  4HBY A;  4BW4 A;  5DYA A;  4RVR A;  2G4A A;  2WP1 A;  5EPR A;  4UYE A;  5EWD A;  1JSP B;  4HXS A;  5F25 A;  5IG6 A;  4N4H A;  5E3D A;  4QY4 A;  4MR3 A;  2DVR A;  2FSA A;  2F6N A;  5EM3 A;  3QZV A;  3Q2F A;  5E7D A;  2E3K A;  4NUD A;  4ZW1 A;  4YYI A;  2F6J A;  5FE9 A;  5CQT A;  4WHU A;  4E96 A;  5A85 A;  4QYL A;  4HBW A;  3IU6 A;  5KHM A;  4TU6 A;  4PCE A;  5D3T A;  4IOO A;  4HXK A;  4ZQL A;  5E74 A;  5HM0 A;  4XUA A;  4O78 A;  5CQ6 A;  2RNW A;  5IGM A;  4Y03 A;  5FB0 A;  4CUQ A;  4ZC9 A;  2NXB A;  5LVQ A;  4XY8 A;  5EV9 A;  4GPJ A;  5KTU A;  4A9L A;  5EVA A;  2DVQ A;  5CS8 A;  3P1D A;  5AME A;  4HXP A;  2D82 A;  4Z6H A;  4A9K A;  4O77 A;  4UYH A;  5F1H A;  3JVM A;  5CUD A;  3S92 A;  5E0R A;  2YEM A;  5CQ7 A;  5HLS A;  4YAD A;  4TYL A;  4NR8 A;  3IU5 A;  5L99 A;  5FE2 A;  1X0J A;  4YAT A;  4MR6 A;  4PTB A;  2YDW A;  5ENI A;  4YBM A;  5EIC A;  5DY7 A;  4OGJ A;  4QNS A;  5E9M A;  4YBT A;  2R0Y A;  4LYI A;  2YYN A;  5ETB A;  4O75 A;  5LUU A;  3O37 A;  5DLZ A;  5ACY A;  2E7O A;  4NR9 A;  5C8G A;  5FBX A;  3ZYU A;  5FE7 A;  5G4R A;  3UVW A;  4X2I A;  5CQ8 A;  3UVX A;  3U5N A;  4HXL A;  5CUB A;  5D3N A;  3QZT A;  4QUU A;  4IOR A;  4UYF B;  5LKZ A;  4Q0O A;  4QEU A;  5BT4 A;  5I80 A;  5A7C A;  2R0S A;  4ALH A;  4QSP A;  4UIU A;  5FE1 A;  5A5R A;  4Z1S A;  4LRG A;  4LZ2 A;  3Q2E A;  5D3L A;  3LXJ A;  2KTB B;  3UVY A;  4IR6 A;  5LJ1 A;  4LZS A;  4O70 A;  5FB1 A;  4NYX A;  5EP7 A;  4QSX A;  5I7X A;  5FG6 A;  4YYM A;  3O33 A;  5CUE A;  3FKM X;  5FH6 A;  4NUE A;  5EIS A;  2WP2 A;  5EPS A;  4MEP A;  4A9E A;  4NR6 A;  5EWV A;  5EK9 A;  4N3W A;  5L98 A;  4XUB A;  5F60 A;  4A9F A;  4PS5 A;  5CUG A;  5I86 A;  5CZG A;  5C4Q A;  2YW5 A;  3TLP A;  5CQ3 A;  2E7N A;  4A9I A;  4CUP A;  5F5Z A;  4BHW A;  5I40 A;  4YYJ A;  4LYS A;  1N72 A;  4YY6 A;  4NR5 A;  4MR5 A;  4O7A A;  4NS5 A;  4LR6 A;  5D3H A;  4LC2 A;  1WUG A;  5EWW A;  4O7E A;  4QST A;  3O36 A;  4C67 A;  3JVL A;  5KO4 A;  2RNX A;  4YAX A;  5CPE A;  3I3J A;  3O35 A;  3ONI A;  5EU1 A;  3U5K A;  5II2 A;  4TZ2 A;  1F68 A;  4J3I A;  3MXF A;  5AD3 A;  1WUM A;  4YC9 A;  5DKD A;  5FE8 A;  4AKN A;  4TTE A;  5HFQ A;  5HFR A;  5EWC A;  5D26 A;  4YYK A;  2MJV B;  4QSR A;  4BW2 A;  4O7B A;  4YH4 A;  3P1C A;  5H1U A;  2OO1 A;  4QSS A;  3SVH A;  4UIZ A;  5CQ5 A;  4CUT A;  5FFY A;  5TB6 A;  5CP5 A;  5FFV A;  4A9H A;  4OGI A;  4MEQ A;  5L8T A;  3QZS A;  5L96 A;  5HQ5 A;  2YEL A;  2OUO A;  3O34 A;  5DKH A;  4NYV A;  3RCW A;  3UV2 A;  5K29 A;  4J0S A;  5I1Q A;  2DKW A;  4QUT A;  4QSW A;  5CGP A;  5LJ0 A;  2RO1 A;  5LKX A;  5E9L A;  2RI7 A;  5DKC A;  5EPB A;  4QEV A;  5F1L A;  4KV1 A;  5FG5 A;  5HJC A;  4UIT A;  5LJ2 A;  5FE4 A;  5E9Y A;  4QB3 A;  4HXN A;  4CLB A;  4BW1 A;  5D25 A;  4TT6 A;  4MEN A;  5CY9 A;  4QSQ A;  1EQF A;  3JVK A;  4UYD A;  4O72 A;  4UIY A;  5FFW A;  3MQM A;  4HBX A;  5LKU A;  5EGU A;  4A9N A;  5FH8 A;  2I8N A;  5II1 A;  5HQ6 A;  4YYD A;  5IID A;  5IBN A;  4FLP A;  3P5O A;  4NXJ A;  2LSP B;  4O76 A;  3MUK A;  4UYG A;  5CQ4 A;  5F2P A;  5JI8 A;  5LKT A;  5CFW A;  4UYF A;  4UIW A;  5KTW A;  5A5Q A;  5JWM A;  4CFL A;  5F3A A;  3JVJ A;  3UV5 A;  5EWH A;  3SVG A;  3P1E A;  4TT2 A;  5CU8 A;  3U5J A;  4N4I A;  5L8U A;  4Z6I A;  4MR4 A;  5ENJ A;  5CRZ A;  3UW9 A;  5CRM A;  4XYA A;  4CUS A;  2H60 A;  5IGL A;  5D7X A;  2OSS A;  5FE3 A;  4Z1Q A;  4YY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...